current user: public

If you have questions about the server, please let us know.

Query: d2bkma_ a.1.1.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPDDLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHLDLast
1 -62.500[R] COG2346 Truncated hemoglobins  ali follow..  40  21SETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADN. 150
2 -12.100[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  16  18............VETGPKLTAHFYDRMTHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENLPA-EKIAQKHTSFQIKPEQYNIVGTHLLATLDEFNPGQEVLDAWGKAYGVLANVFIHREAEI. 138
3 -6.460[C] COG3005 Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit  ali follow..  14  322.............................................................YADSLYNGTCNQCHGAPDKAHFDANGWIGTLNGMIGFTSLDKREERTLLKYLQMNASDTTNTPHSDK 388
4 -6.150[P] COG3626 Uncharacterized enzyme of phosphonate metabolism  ali follow..  13  1.....MYVAVGGEKAIDAAHALQESRRRGDTDLPEL---SVAQIEQQLNLAVDRVMTEGGIADRELAALALKQAS-----DNVEAIFLLRAYRTTLAKLAVSEPLDTTEMRLERRISAVYKDIPGGQ. 116
5 -5.180[S] COG5452 Uncharacterized conserved protein  ali follow..  20  67...........GQEIAQEIVDAFFEDV--DHSIRELGVGDAS-VPKKMKKLAGMFYGRLESYAA--------------ALEGRDAGALAAALRRNFHADVEDAPSMRGLASYLLAVESVLSDTAEEA. 165
6 -5.040[F] COG1428 Deoxynucleoside kinases  ali follow..  14  10....VLAGMIGGKSSYTELIANFYESIKDNRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDQN---TQINFEEGNISEPEMDTYLDLLDNMMEELAYMPKKAPDLLIYLRGSLDTVLSR..... 145
7 -5.000[N] COG1724 Predicted periplasmic or secreted lipoprotein  ali follow..  15  2..............................SYLPIVDPKTMEKVLLKLGFQRVRQKGSHVFYRHSNGKYTTIPFHAKETCPS-------HLIRKIIREAGISVEEFKKVLENL............... 77
8 -4.890[S] COG1650 Uncharacterized protein conserved in archaea  ali follow..  128.LVSATFIEVGSTEA-------------RDKRAVGVLAQALEEALTKEFEGPTPTMAGDLHYVTISDRGEFDLGHVVPKYINITTNIVENILKKHIFRKNIKNPIRTEIIELLRAKGIEVTLK..... 250
9 -4.820[S] COG4728 Uncharacterized protein conserved in bacteria  ali follow..  26  65EEALVIYQALYGEFGLVRPLEMFTEAVEVDGEWVPRFV.......................................................................................... 103
10 -4.810[J] COG1534 Predicted RNA-binding protein containing KH domain, possibly ribosomal protein  ali follow..  22........QVGKGGVNDNMIKQIAEALEARELIKVSVLQNCEEDKNDVAEALVKGSRS...................................................................... 71

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.