current user: public

If you have questions about the server, please let us know.

Query: d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst MKVEELAESISSYAVGILKEEGIEELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREAIKGGKSLYVVPLRALAGEKYESFKKWEKIGLRIGISTGDYESRDEHLGDCDIIVTTSEKADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMRRMNKALRVIGLSATAPNVTEIAEWLDADYYVSDWRLast
1 -58.600[R] COG1204 Superfamily II helicase  ali follow..  24 1351.........NNPSFISLYP--NFKFFNKIQTQVFNSVYTNDSVFIGAPNGSGKTVCAELALLHHWSQYGTAVYIAPIQEIVDRRYEEWGKFSDLGDVLVKLTGERSQDLKLIQVADLIFCTPSQWDSLSKRWRSSIQKVDFYICDELQLLGGF-YGPLYEIVISRIRYMEKNIRVVGLSVSVANARDLGEWLGTSNFSPKDR 1557
2 -57.200[R] COG1202 Superfamily II helicase, archaea-specific  ali follow..  40  200........DIPESFKNVLKLEGITELLPVQVLAIKNGLKGENLLVVSATASGKTLIGELAGIPKALEGKKMLFLVPLVALANQKYEDFKRYSKLGLKVAIRVGMSRIKTREGIDADIIVGTYEGVDYLLRSG-KKIGNVGTVVIDEIHMIDDEERGPRLDGLIARLRKLYPKAQFIGLSATVGNPQELARSLGMKLVLYDER 401
3 -41.500[R] COG1201 Lhr-like helicases  ali follow..  29  1MTFNNDFNSFHPKIQEALRTLGFTRPTEPQERAFPHILDGKHTLLIAPTGSGKTESAVLPVFNAILKKKSALYITPLRALNRDMLSRIEVGKLLDIKVQVRHGDTPQSERQ-NPPDLLITTPETLQAMFSRLRKNMETVTHVVVDEIHELASSKRGAQLAIGLERLVEISGEFQRIGLSATVGNPWEIAKFL.......... 205
4 -33.200[L] COG4581 Superfamily II RNA helicase  ali follow..  29  280........................ELDNFQKEAIYHLEMGDSVFVAAHTSAGKTVVAEYAIALAQKHMTKAIYTSPIKALSNQKFRDFKHFEDVGI----LTGDVQVN----PEGSCLLMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDLERGVVWEEVIIML---PPHVTLILLSATVPNTKEFASWVGIYVISTLKR 453
5 -31.300[L] COG1111 ERCC4-like helicases  ali follow..  22  1.........MARYIEHPLIKPEKIEARTYQQLLAADVIRKGNSMIVAPTALGKTVVAVLVAAERLRRGSKVLILSPSKPLAIQHEESFREF--MLATCTSLTGSIKPEKERWIKSQIISATPQTVESDILAGRYDLRDVSLIVFDECH---RAVGSYSYVFLASNYIQNARHPLILGLTASPGADED............... 177
6 -24.100[R] KOG0354 DEAD-box like helicase  ali follow..  22  75...........................DYQFNIVQKALF-ENVLVALPTGLGKTFIAAVVMMNYLRPKSYIVFMAPTKPLVTQQMEACYKITGIPKSTAELSGHVPVTNQYYQSRNVFFVTPQTILNDIKHGICDRTRISCLVIDEAH---RSTGNYAYVEVVHLLSLSNKNFRILALSATPGNKLEAIQNVIDSLHISR.. 248
7 -23.800[J] KOG0328 Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily  ali follow..  15  32........NLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQSLLRETQVLCLSPTRELAVQIQKVILALGDMNVQCHVCIGGTNLGED--YGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYL---PPATQVVLISATLPH.................. 211
8 -23.800[A] KOG0350 DEAD-box ATP-dependent RNA helicase  ali follow..  22  132........NISSKLVERLQKQNITRGFAVQAAVLPLLLQGGDVCVSAATGSGKTLSYVIPIVQCLSHRTRCVVIVPTRELTVQVAKTFEYYMSAGLQVCAWTGQKSLRHET-CRIDVLVSTPGRLDHIRNDESFSLQHLRYMVIDEADRLLDQSFQDWVDTVMMEISHLPSPLQKLVFSATLTDPSKIAS............ 370
9 -23.600[J] KOG0327 Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases  ali follow..  21  38........NLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQILKATQALVLAPTRELAQQIQKVVMALGDMGASCHACIGGTNVRAEQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKL---NSNTQVVLLSATMPS.................. 218
10 -23.200[A] KOG0330 ATP-dependent RNA helicase  ali follow..  19  52........GVIDELCEACEKLGFKTPTPIQQEAIPVVLNKRDVIGLAQTGSGKTAAFALPVIQELWNNPSAVVLAPTRELAYQISEQFEAIGGIGVRSVVIVGGMDMVTQAVKKPHVLVCTPGRLDHLENTKGFSLKNLKYLIMDEADRLLDMDFGPIIDKILKII---PHERRTLLFSATMTS.................. 232
11 -22.800[A] KOG0329 ATP-dependent RNA helicase  ali follow..  17  51........LLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLTGQVSVLVMCHTRELAFQISKEYERFSKYNVKVAVFFGGLSIKKDKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECKMLEQLDMRRDVQEIFRMT---PHEKQVMMFSATLSK.................. 233
12 -22.700[A] KOG0344 ATP-dependent RNA helicase  ali follow..  25  63........KINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKKGFRALIISPTRELASQIHRELIKISETGFRIHMIHKAAKFGPKSSKKFDILVTTPNRLIYLLKQDPPGLASVEWLVVDESKLFEDGKTGFRDQLASIFLACTSHKVRRAMFSATFADVEQWCK............ 257
13 -22.700[A] KOG0326 ATP-dependent RNA helicase  ali follow..  21  91........CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLKDNIQAMVIVPTRELALQVSQICIQVSK-GAKVMATTGGTNLRDD--DTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTL---PKNRQILLYSATFPL.................. 271
14 -22.500[A] KOG0348 ATP-dependent RNA helicase  ali follow..  23  35........GLDTKLSDQLKERGFEAPTLVQAQAIPVILSGRDVLVNAPTGTGKTIAYLAPLIHHLQGHSPALVIVPTRELCLQVYETLEKLLH-WIVPGYVMGGEKKAKEK-KGISILIATPGRLDHLKNTASFVHKNLRWVIFDEADSILELGYGKEIEQIIKLLGSGQNE-QNLLLSATLNKVNDLAK............ 246
15 -22.300[A] KOG0346 RNA helicase  ali follow..  18  20........NLDPRLQRAIHKCEFEKPTSVQSETIPLALEGKDLVAQARTGSGKTAAYLIPILELLLKQKFALLLVPTRELAQQVYNVLEKLTAFHIRFINVATNSSDTVQR-DLPDIVIATPSRCVVHVASGVLPLDKLKFLVIDEADLMLSFGYNEDMKTLSRSL---PRGTQSFLMSATLSNIASLQK............ 214
16 -22.000[KL] COG1061 DNA or RNA helicases of superfamily II  ali follow..  27  78........................EPYPHQSEALAAWKLAGR-VVVLPTAAGKTYLAQLAMQAT---PRTTLIVVPTLDLMHQWYAHLVAAFP-DAEVGLLGGGSR------DKSPVLVATYD---SAAIHAEALGNQYALIVFDECHHLPTDFSKVIAEYAIAPYR--------LGLSATPERTDGKHADL.......... 225
17 -21.900[A] KOG0340 ATP-dependent RNA helicase  ali follow..  23  64........GLAEWAVETCKELGMRKPTPVQTHCVPKILAGRDVLGLAQTGSGKTAAFALPILHRLAEDPYALVVTPTRELAFQLAEQFKALGSLNLRCSVIVGGMDMLTQTMSRPHIVITTPGRIKVLLENNPDVFSRTKFLVLDEADRVLDVGFQDELRTIFQCL---PKSRQTLLFSATMTS.................. 246
18 -21.600[A] KOG0345 ATP-dependent RNA helicase  ali follow..  19  15.RFSDLEPPLSGDIIEALNQSDFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRSTMGVIISPTRELSTQIYNVAQPFVS-NVNSVLLVGGREVKADM-EGCNVLIGTPGRLDIMERMEILDFRNLEILILDEADRLLEMGFQRQVNYIISRL---PKQRRTGLFSATQTEVEELAK............ 217
19 -21.200[LKJ] COG0513 Superfamily II DNA and RNA helicases  ali follow..  21  8........GLSPKVIAAVEAAGYTAPTPIQAGAIPPALERKDVLGIAQTGTGKTASFVLPMLTLLEKGRRTLILEPTRELAAQVEENFVKYGIHRLNVALLIGGVSFEEQ--RGADVLIATPGRMLDHFERGKLLLTGVEILVIDEADRMLDMGFIPDIERICKLI---PFTRQTLFFSATMPP.................. 190
20 -21.200[A] KOG0342 ATP-dependent RNA helicase pitchoune  ali follow..  20  95........QLSENIQKAIKEMGFETMTEIQKRSIPPLLAGRDVLGAAKTGSGKTLAFLIPTIEMLYALKGVIIISPTRELALQIFGVAKELLKHHQTFGIVIGGANRRAEA-KGVNLLVATPGRLDHLQNTKGFVFRNLRSLVIDEADRILEIGFEDEMRQIMKIL---SENRQTLLFSATQTTVEDLAR............ 287
21 -20.200[R] COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster  ali follow..  23  80........................PPHAHQARAFQRLGSPQPTLVATGTGSGKTECFMFPLLNHCAGASKAIIIYPMNALATDQASRFAKTLHGKVTVGLFVGDSEIEPSKKMSADILLTNYKMLDYLLMRPGDQ-GSLRYLVVDELHTF-DGAQGSDLACLVRRLKHHNQRFACVGTSATVGDELGQLLDYAKTIFDQPF. 293
22 -20.000[A] KOG0332 ATP-dependent RNA helicase  ali follow..  16  215........RLKPEVLKALDTMNFQFPTRIQETALPLLLPPSNLIAQAQSGTGKTAAFVLTMLCRILMCPQCICLAPTLELAKQIGEVVEKMGKLKIHYAIKGGNMAAMRGRKLTEQIVIGTPGIRDYLQKYKCIDPSKIRCLVLDEAVMIYHQGFTDISTTIYNMVEDASDSVQSMLFSATYDE.................. 401
23 -19.600[A] KOG0341 DEAD-box protein abstrakt  ali follow..  21  152........KFPRPVLDTLKEKGIVQPTPIQVQGLPVILAGRDMIGIAFTGSGKTLVFVLPMIMIALQEEMGLIVCPSRELARQTYEVVEQFVAPPLRSLLCIGGIDMRSQL-RGVHIVVATPGRLKDMLAKKKMSLDACRYLTLDEADRLVDLGFEDDIREVFDHFK---SQRQTLLFSATMPKIQIFAR............ 352
24 -19.200[A] KOG0336 ATP-dependent RNA helicase  ali follow..  21  230..........YPDLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPIMLVLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQ--KGVDIIIATPGRLNDLQMNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVR---PDRQTVMTSATWPTVRQLAL............ 419
25 -19.200[A] KOG0343 RNA Helicase  ali follow..  23  47........PISDPTLKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYREKGALIISPTRELAMQIYEVLTKIGSTSFSAGLVIGDVKFELERISRINILIGTPGRIQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTL---SPSRQTLLFSATQSQVADLAR............ 237
26 -19.200[L] COG0514 Superfamily II DNA helicase  ali follow..  18  34.....................GYQQFRVGQQEVIEAALAGRDSLVIMPTGGGKSLCYQIPAL---VLEGVTLVISPLISLMKDQVDQLKA---NGVAAECVNSTLAREELI-GQLKLLYVSPERVLTAEFIERLSHLPLAMIAVDEAHCISQWGHDFRPEYALGQLKQRFPNVPVMALTATADDAHDIMQRLQLN....... 211
27 -19.000[R] COG1203 Predicted helicases  ali follow..  25  2.............VIKAFRKLTGHSPYEYQKEAMDNLLEGKSLIIRAPTGAGKTEASLIPFIYGLNDYPQLIYSLPTRTLVESIGERAIKYSFKKLRVAIHHGKKATSS--LFEEDIIVTTIDQTAGAYLSVPLSMPK-ALTVFDEVHTLDPEKGLQTAAAIAMQSAKLG--LPSIIMSATLPD.................. 182
28 -18.500[A] KOG0347 RNA helicase  ali follow..  17  197........RLHPLLMKSIYRLDFKEPTKIQKACFNAAYQGKDVIGAAETGSGKTLAFGLPILQRLLDERRALIITPTRELALQVTEHLENAAKLSVKVVPIVGGMFSEKQE-EKPEIVVATPGRLWELMSAGEKHLHSLSFFVLDEADRMVERGHFRELQSILDLLNVPKKKRQTFVFSATIALSSDFRK............ 430
29 -18.400[A] KOG0331 ATP-dependent RNA helicase  ali follow..  17  100........NFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFCLVLAPTRELAQQVQQVAAEYCRCRLKSTCIYGGAPKGPQ--RGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIR---PDRQTLMWSATWPEVRQLAE............ 291
30 -18.200[KL] KOG1123 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3`-5` helicase subunit SSL2  ali follow..  17  331........................VLRPYQEKSLRKMFGNGR-VIVLPCGAGKSLVGVTACCTV---RKRALVLCNSGVSVEQWKQQFKMW--STADDSMICRFTSEAKDKPMGCGILVTTYSMITHTQKRSWEAEQTMGIMVLDEVHTIPAKMFRRVLTIVQSHCK--------LGLTATLLREDDLNFLIGPKLYEANWL 510
31 -17.900[L] COG4098 Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein)  ali follow..  20  94........................QLTPFQEKVSEGLLKQKPTLVHAVTGAGKTEMIYQVVAKVINAGGAVCLASPRIDVCLELYKRLQQ--DFSCGIALLHGESEPY----FRTPLVVATTHQL--------KFYQAFDLLIVDEVDAFPYVDNPMLYHAVKNSVK---ENGLRIFLTAT..................... 238
32 -17.500[A] KOG0333 U5 snRNP-like RNA helicase subunit  ali follow..  17  307........GFPDEVYQAVKEIGYLEPTPIQRQAIPIGLQNRDVIGVAETGSGKTAAFLLPLLVWITSLPKAIIMAPTRELAQQIEEETNKFGKLGIKTVSVIGGASREDQG-MGVEVVIATPGRLLDVLENRYLLLNQCTYVILDEADRMLDMGFEPDVQKVLEYMPDTNMK-QTVMFTATMSAIERLAR............ 527
33 -17.400[A] KOG0338 ATP-dependent RNA helicase  ali follow..  17  224........NLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRVLVLVPTRELGIQVHSVTRQLAQCNITTCLAVGGLDVKSQE-AAPDILIATPGRLDHLHNCPSFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMC---SHHRQTMLFSATMTDVKDLAS............ 414
34 -17.400[S] COG3421 Uncharacterized protein conserved in bacteria  ali follow..  19  54........................PFFEWQKSALENFVRPTHLLFNMATGAGKTMMMAALILYYFEKGRHFLFFVNQNNIVDKTENNFIDPAH-----VIPIRKVEMFSPHSDGIEIKFTSIQKLYNDIHTERENQTTLAVMLGDEAHHLNAQTKGKMVLELLLNKNGNPGQNVLLEFTATLPENADVQQ............ 279
35 -16.900[A] KOG0335 ATP-dependent RNA helicase  ali follow..  20  294........NLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGICIIVAPTRELVNQIYLEARKFSGTCVRAVVIYGGTQLGHSI-QGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPMPSKEQRQTLMFSATFPEIQRLAEFLKSNYL..... 501
36 -16.800[LK] COG1200 RecG-like helicase  ali follow..  18  268........................QPTNAQKRVVSDIEQD-MRLVQGDVGSGKTLVAALAALTAIDNGKQVALMAPTEILAEQHANNFRRFKPFGIEVGWLAGKVKGKSRQ-GAVQMVVGT----HALFQEEVE-FSDLALVIIDEQHRFGVHQR----LMLREKGEKAGFYPHQLIMTATIPRTLAMTVYADLDT...... 445
37 -16.500[A] KOG0337 ATP-dependent RNA helicase  ali follow..  18  101........GLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQRRERALILSPTRELAVQTYKFIKELGRMELKSILVLGGDSMDSQ--TCPDVIVATPGRFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRL---PSSRQTVMFSATLPKLVEFAR............ 289
38 -16.300[A] KOG0339 ATP-dependent RNA helicase  ali follow..  20  271........SFDKLLMEAIRKSEYEQPTPIQAMAIPSALSGRDVLGIAKTGSGKTAAYLWPAIVHIMDQPDAVIVVPTRELAIQVFQEAKKFCKYNINPICAYGGGSKWEQQNEGAEMVVCTPGRIIDLVKMGATNFLRTTFLVFDEADRMFDMGFEAQVKSISDHVR---PDRQCLMFSATFKKVERLAR............ 463
39 -16.000[V] COG4096 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases  ali follow..  23  464..........................RYYQEDAVRAVEKQQEILLAMATGTGKTRTAIAMMFRLIQSQKRILFLVDRRSLGEQALGAFEDTRINGDTFNSIFDKGLTDKFPEDSTKIHVATVQSLVKRTLQSDEPMARYDCIVVDEAHRGYILDKEQTEGELQFRSQL---DAVKIALTAT..................... 638
40 -15.200[L] COG1110 Reverse gyrase  ali follow..  21  71...........SEVEDLFKRATGFRFWSAQRTWVKRILRGKSFSIIAPTGMGKSTFGAFISIYFAIKGKRSYIVVPTTPLVVQTVKKIQDMMEVNVRLVYYHGNLKKKEKE-GDFDILVTSSTRFDELLRD-----KRFDLIFVDDV------------DAFLKASKNIDRSLLLLGFT....................... 235
41 -13.100[R] COG4889 Predicted helicase  ali follow..  17  174.......................YSPRPHQQTAIEKAIEHDRGKLIMACGTGKTFTALRLSEEVARLNARILFLVPSISLLSQTLKEWTAQKTMDLRPVAVCSDSKVSKAA-AGLTVVFSTYQSLPAVHAAQEAGAEPFDLVICDEAHRTTGITLAGEDPSNFTRIHDASKAAKRLYMTAT..................... 368
42 -13.100[A] KOG0953 Mitochondrial RNA helicase SUV3, DEAD-box superfamily  ali follow..  14  137.....................................HAKTVFPHLDCMDDLKKISD---LRQPANWYSNARAITRKILLATE----YNKANERGTPCDLVTGEERFGISESLPANHVACTVEMTSV---------TPYEVAVIDEIQQIRDPQRGWAWTRAFLGLI--ADEVHVCGEPGALDLLQKICETTGETVEVRLYD 286
43 -12.300[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  16  7..........................................IGVGGPVGAGKTMLIERLTRYLSTKGYSMAAIT-DASMNFAAIEEMCKHPDLQLLFLESGGDSATFSPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSDLFIINKVDLA--PYVGANVEVMKADTLKSRGNKDFFVTNLKTDGLKSVADWIEKRL...... 199
44 -12.100[R] COG1783 Phage terminase large subunit  ali follow..  14  10........................VVNPHFEEYVFD--TQKTFLAVGAYGSSKSYATAEKIIIKLFEEKRKCLVV-HESHKDSTFALLTELEEMGVKRKVVITQSPMKIKFPNGSSIIFKGLDKPSKLKS-----IANISIIWVEECSEISYA----AYKELLGRLRHPFLKTHIILTS----NPVSIDNWVYLHFFEDF.. 178
45 -12.000[V] COG3587 Restriction endonuclease  ali follow..  19  73.........................................ILDISMETGTGKTYTYTQTMLHRWLGVFKFIVVVPTLSIKAGTQQFLQKKNKGKKSNAPITIEQFVKAENKKEIHVLLINAGMVNSSSMNDTDALAAVRFMIVDEPHKFPTRDSAKTWGNIKR------KPQYILRYGAT..................... 252
46 -11.700[R] COG5525 Bacteriophage tail assembly protein  ali follow..  15  61........................TLTPYVVEAMNCLSSRDAVVFVAPARTGKTLGLIDGWISYNIVCSDMLVVQMTQDKAQEHSKRFRHSPAIARRLSPHRNDNNVHDKTFRDGSFLKIGWPSINVFSSS------DFKCVALTDYDRFPEDGEGDAFSLASKRTTTFMSLGMTLVESSPGREITD............... 228
47 -11.700[A] KOG0349 Putative DEAD-box RNA helicase DDX1  ali follow..  25  8........GVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKALIVEPSRELAEQTLNNIKQFKKYKLRELLIIGGVAARDQL-NGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVGKRLQVIVCSATLHSFD................ 414
48 -11.600[S] KOG2340 Uncharacterized conserved protein  ali follow..  16  168........GLKQRILDSYKKQKPSGLTSMQIELAKAMFNYQDVFFTNMSHKLGTSLLALHALNHVFKTRKVLILLPTRNSAFEFINLLISYSG----RYLFSGNTDDM-SQFYNSDIIVASPLGLRLAIGNKGDYLSSIEIAMVDQAHALVMQNWEHIECIFFSRVRPWYLD-QTILFSQYNN................... 437
49 -11.500[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  13  31...................................GIPLGSLTLIEGENDTGKSVLCQQFVYGGLMSGHNIAYY----TTENTIKSFLRQMESLSLDVSDFYAWGYLRVFPVHLEGI--WSTEQMRSILNLVANHIKTIRIAIIDSLTMFTTYSTEDDVLEFLTRLKNLCDNGKTILITLHQHAFKE............... 179
50 -11.400[A] KOG0925 mRNA splicing factor ATP-dependent RNA helicase  ali follow..  16  77.........................VYQQREEFLKIYHENQIIVFVGETGSGKTTQIPQFVLYD-LTNTQIACTQPRRVAAMSVAKRVA--DEMDVDLGEEVGYNIRFEDCSGPNTLLKYMTDGMLLREAMTDHMLSRYSCIILDEAH-----ERTLATDILMGLMKRLRPDLKIIVMSATLDAKKFQKYFFDAPLLAVPGR 252
51 -11.300[S] COG5410 Uncharacterized protein conserved in bacteria  ali follow..  11  48..............................AGVVDDVIAGRDVVINVPPGSSKTELVAINVMARGLPYARFLHISYSDDLALLNSETAREIVQSDEYRALWPLEIADDAKSKKRWNVVVDGKKAGGVYAVSLGGQVTGFGAIIIDDPDAYSKTGRSKANRKLVSTVRKASPDTPIIVIMQRL-AQDDPTGFIQSGGFPGAWE 239
52 -11.000[LK] COG1197 Transcription-repair coupling factor (superfamily II helicase)  ali follow..  20  607.............................QEMAINAVISD-DRLVCGDVGFGKTEVAMRAAFLAVMNHKQVAVLVPTTLLAQQHYENFDRFANLPVNVEVLSRFKTAKEQK-GKVDILIGTHKLIQSDVK-----FNDLGLLIIDEEHRFGVGQK--------EKIKQLRANIDILTLTATIPRTLNMA............. 768
53 -11.000[A] KOG0922 DEAH-box RNA helicase  ali follow..  18  40.........................IASVEKRLVEEVQKNDILIIVGETGSGKTTLPQFLYNAGFCREGKMIGITQPRRIAAVTVAK-RVAEECEVQLGQKVGSIRFDDTTSGSTRLKYMT----DGLLLREDPHLSRYSVIIVDEAH-----DRSVHTDVLLALLKKIRSQPVSEKTEFGN.................... 194
54 -10.900[L] KOG0442 Structure-specific endonuclease ERCC1-XPF, catalytic component XPF/ERCC4  ali follow..  2.........................ALKYHQQIISDLLDSNGGLLILSSGLSLALIASLLILHSPSQGTLLLLLSPAAQSLKSRIIHYISSLDS--TPTEITADLPANQRYYTSGSPFFITPRILIVDLLTQRIPVSSLAGIFILNAHSISET---STEAFIIRIVKSLNSSAYIRAFSDRFAKTERTMRALFLRKI..... 180
55 -10.800[V] COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases  ali follow..  15  283......................................QKEGGYIWHTTGSGKTVTSFKVALASAPRIKNVLFIVDRIDLIDQTLENFKSFAYAHFKNRIKKVNGRELKRELKRKGILLISVQGLTKAVKKGLENDDWN-VIIMDEAHRSASGESVKLIKKAL-------KKTTWFGFTGT..................... 422
56 -10.600[R] KOG3089 Predicted DEAD-box-containing helicase  ali follow..  12  97.ALPASSPEKIIEYLTTLIREKNPDLSVLELE--ELYFKRNDFLSTEKFDAERRLSNFPAFIQKFSVAPKKIVFSMSNIRVADVYRSLNGGKNC-ATVERLLTDSSKKSNKNKDSLYFIATPTRMQKIIEATDLLFQGKEKIILDASYL--DPKDNTILSFVLKTFLNKKSSVKIL.......................... 289
57 -10.300[R] COG4373 Mu-like prophage FluMu protein gp28  ali follow..  15  46.........................FLDYQARWFED--ESEVCIAEKSRRTGLTWAEAGAAKPKRRGGRNVFYVGSKQEMALEYISACALFSRA----EQTFWDRDKKEEILTYMIRFPNSGFKIQALSSRPSNLRGLQGDVVIDEAAFHESLDE---LLKAAMALTMWGARVRIISTHNGVDN.................. 210
58 -10.200[B] KOG0389 SNF2 family DNA-dependent ATPase  ali follow..  17  288........................QLADYQIIGLNWLTQEMNGILADEMGLGKT-IQVIAFLAYLKENGLSLIVVPSSTLDN--EAEISRWCP-ELVVEKYHGSQDERRRGFTGFDVLLTTYHIVGS--PEERKMFRVCKYVIFDEAHMLKNMT------QRYANLITINARMRILLTGTPLQNLISLLCFVMPKFFAKS.. 476
59 -10.200[L] COG1643 HrpA-like helicases  ali follow..  17  79.........................VSQKKQDILEAIRDHQVVIVAGETGSGKTTLPKICMELGRGIKGLIGHTQPRRLAARTVANRIA--EELQTEPGGCIGYKVRFSDHVSSNTMVKLMTDGILLAEIQQDRLLMQYDTLIIDEAH-----ERSLNIDFLLGYLKELRPDLKVIITSATIDPERFSRHFNNAPIIEVSGR 252
60 -10.100[A] KOG0923 mRNA splicing factor ATP-dependent RNA helicase  ali follow..  18  254.........................VYPFKEDLIAAVKEHQVLIIEGETGSGKTTVPQYLVEAGFTKDKKMIGCTQPRRVAAMSVAA-RVAEEMGVKLGNEVGSIRFEDCTSDRTILKYMT----DGTLHREEPDLASYSVMIIDEAH-----ERTLHTDILFGLVKDIRPELKLLISSATLDAEKFSAFFDDAPIFRIPGR 428
61 -9.820[L] KOG2228 Origin recognition complex, subunit 4  ali follow..  16  555..................HMDEQTKLYQWVRQTIVL--EGNSVIIVGPRGSGKSVLVDDILSRAAQEINEKSYVVRLNGTYQT--DDKLALREISRQLSIELESIESDEALKSEMNLLATLSHPVDLGIAEDVMTTSAAVIFVLEEFDLFVQHSRQMLLYNLFDIAQSRKAPILIIGLTTRYDCSESLEKRVKSRF...... 736
62 -9.780[S] COG5323 Uncharacterized conserved protein  ali follow..  13  8...KSWAVGLAFRQILAAQDEWLIRARDAQLPPDG---DWRVWLIMGGRGSGKTRAGAEWVSGMALGSGHIALVGETFNDAREVVDGPSGILSVSRLVRPRYEASRRRLIWDNGAVATLFSSEDPDSL--------PQFDAAWCDELAKWKNPQE--TWDMLQFGLRLGDNPRQVVTTTPR..................... 183
63 -9.720[L] COG1198 Primosomal protein N` (replication factor Y) - superfamily II helicase  ali follow..  21  261........................ELNPEQRQARDAVVSSPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAIGLSNGEKYDEWRKVERGDAQVVVGARSAIFA------LKNLGVMIIDEEH--DSNPRYHAREVAILRAQYNQATLVLGSATPSLESRARAGK............ 433
64 -9.690[L] KOG2373 Predicted mitochondrial DNA helicase twinkle  ali follow..  13  335TTFGAMRNDILSELQNIEKVNGVKW-FPVLNKLLKGHRRGELTILTGPTGSGKTTFMSEYSLDLAMQGVNTLWGS---EIRNTRLAATLLRQYVGYPLDDRLHEFNHWAAEFERLPLYFMTFHPLKPVLEAIEHASYVVMHVIIDNLQFMFRGDKFFEQDSIIAAFRSFATKHNVVFGTAKATQEADNVLIIQDKRLTSV.. 564
65 -9.610[U] COG0653 Preprotein translocase subunit SecA (ATPase, RNA helicase)  ali follow..  17  57...ETLDDILNEAFAVVRESKRVLGMRHFDVQMVGGMVLHFSGISEMRTGEGKTLVATLPTYLNALEG-KGVHVITVNDYLARRDADWMGYNFLGLSYGVIVNGLSQGERQRARSDITYGTNNEFDNLVYSVDEMVQRHNFAIVDEVDILIDEARTPLI........................................... 223
66 -9.440[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  54......................................KSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVLHNENNTKKGKVKPVHLIDVPGHSRLIEEYLPRAAAVVFVVDALEDILTNASVIKNKTPVLLCDKVTAHTKEFIRKQMEKEIDKLRHCHNKVTVAEASGLTGETDQVQEFIREHV...... 258
67 -9.200[R] COG3972 Superfamily I DNA and RNA helicases  ali follow..  13  200...................ESEIANFDQKQRRAALVTIDGPQRIRGLA-GSGKTVILKAAHLHMTRPNDKILVTFFTKSLRSPIKDLVTKFYR-NIHIRHGWGMPRSYSSARDAAPRGVEPFSFACEELINSAQSLEYYDHILIDEGQDFPDG-----YKLCFELAKGDRDKKNIVWAYDELQNI................. 388
68 -9.190[R] COG4626 Phage terminase-like protein, large subunit  ali follow..  15  66........................SCEQYVFDFVSAIFG-EEFFLLISKKNIKSTLAAGIMLTALIHNQELLILAPTQEVAGNSFNPAASMVAADPDLTILLHVNKNTKEITHTLTKAVLKIVSADSNTAAGKK----AAFVLIEELWLFGKKANAAAMLQEATGGLISRPEGFVIYITTQ..................... 232
69 -9.190[A] KOG1802 RNA helicase nonsense mRNA reducing factor (pNORF1)  ali follow..  15  406......................FAQLNSSQSNAVSHVLQRPLSLIQGPPGTGKTTSATIVYHLSKIHKDRILVCAPSNVAVDHLAAKLRDLGLKVVRLTAKSREDKTEAEILNKADVVCCTCVGAGDKRLD-----TKFRTVLIDES--------TQASEPCLIPIVKGAKQVILVGLGPVILERKAADAGLKQSLFEVQYR 639
70 -9.110[A] KOG1804 RNA helicase  ali follow..  15  308.......................PVLNENQKLAVKRILSGDCYILFGPPGTGKTVTIIEAVLQVHFADSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCEDIWKASRFRIIITTCSSSGLFYQIGVR--GHFTHVFVDE------AGQASEPECLIPLGLMSDISGQIV-LGPVIKSRLAMAYGLNVSFLE.... 504
71 -9.040[T] COG1702 Phosphate starvation-inducible protein PhoH, predicted ATPase  ali follow..  13  124.............................QKHYVDAIDTNTIVFGLGPAGSGKTYLAMAKAVQALQSKSRIILTRPAVEAGEK----------LGFLPGTLNEKIDPYLRPLHDALRDMVEPEVIPKLMEAGIVEVAPLAFVILDEAQNTTPAQ----MKMFLTRL---GFGSKMV.......................... 265

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.