current user: public

If you have questions about the server, please let us know.

Query: d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst NNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFGLast
1 -23.700[F] COG0026 Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)  ali follow..  41  310HSDCVMTNLIGDDINDAWLSKKDCLVHLYGKEARPGRKMGHVTELLHTGKA............................ 363
2 -21.800[F] COG0027 Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase)  ali follow..  18  318ISPSASKAIVVEGKSAEVLAEPHTNLRLFGKEVDGHRRMGVILARDISVEKALEKARRAYDKLEIA............. 392
3 -15.400[F] KOG2835 Phosphoribosylamidoimidazole-succinocarboxamide synthase  ali follow..  25  314.TNAIMLNVLGDKHTKRALATPGSSVYLYGKESRPNRKVGHINIIASSMAECEQRLNYITGRTDIPIKISVAQKLDL.. 397
4 -6.680[R] KOG3375 Phosphoprotein/predicted coiled-coil protein  ali follow..  10  126........................KMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLN 180
5 -5.870[R] COG3481 Predicted HD-superfamily hydrolase  ali follow..  25  185..................LLYAGVILHDLGK-TVEGNLLGHISIMVTELSKAAEELQ...................... 234
6 -5.830[J] KOG3353 60S ribosomal protein L22  ali follow..  133............................HGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQKLM.. 181
7 -5.830[Q] COG3527 Alpha-acetolactate decarboxylase  ali follow..  17  154.......AIVGTPELFHGVGSAGFHIHFADDERAYG---GHVDFEVDDVVVEIQNFETFQQHFPVNNET.......... 215
8 -5.760[NU] COG3168 Tfp pilus assembly protein PilP  ali follow..  11  104.....MVGTLSNAQGTFALVKGAGGVHRVRVGDYLGRNDGKVVGISEGKIDVIEIVPD..................... 156
9 -5.580[J] COG0091 Ribosomal protein L22  ali follow..  133............................HGRVTAYLSSPSHIEIIVAEEEEAVPKANDTVSRVSLKQGAKARNLAAR.. 181
10 -5.490[A] COG5176 Splicing factor (branch point binding protein)  ali follow..  162......VNFVGGRTLRKLQEDSNCKIAIRGRGSVKEGKNAHCLIIADSEDKIQKGIKVCQNIVI............... 239

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.