current user: public

If you have questions about the server, please let us know.

Query: d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQFLast
1 -83.200[I] KOG1680 Enoyl-CoA hydratase  ali follow..  20  2.ITLSRTGAAENVALITLNRPSALNALCRELMLELSENLLKVEDQSYHVIVLTGSEKAFAAGADIKEMAKLEFAD----VFENDYFTNWDTLSHITKPVIAAVNGFALGGGTELALMCDIVYAGENAIFGQPEITIGTIPGGGTQRWPRYVSKSVAMEICLSGDRLGAQEAKEDGLVSKVFPVQQLVAVLLADRIAKNSPLIVKTVKRSLNAYQTSLNQGLEMEKQLFQSTFATNDRREGMSAFAEKRA. 250
2 -82.800[I] COG1024 Enoyl-CoA hydratase/carnithine racemase  ali follow..  20  4EFKDIIYEEKGQVAWVTLNRPATYNAFTPVMNREVTVALKKANSDAIRAIVLTGTGRAFCSGEDLDGVTVDTDHGAI---LRARYHPMMQGMKQVEKPIIAAVNGTAAGAGMSLALAADFRLVHENAKFVSAFLGVGLIPDGFLYQLPRMIGYAKALELAVLGKPLSAEDAQRCGLVTEVFAADEWEVASFSMKLAALPTKAIGLIKRLMIGMNEGFLEVLEKEAQAQRIAGQSADHREGLEAFKQSRP. 254
3 -81.700[H] COG0447 Dihydroxynaphthoic acid synthase  ali follow..  18  21GYSDIRYKSTDGIAKITINRPEVRNAFRPQTVKEMMTAFSDARDENIGVIVLTGEGKAFCSGGDQKVRGDYGGYKDDSGVHHLNVLDFQRDIRSCPKPVVAMVAGYAIGGGHVLHMLCDLTIAAENAIFGQTGPKVGSFDGWGASYMARLVGQKKAREIWFLCRQYNAQEALDMGLVNTVVPYADLETVRWCREMLRNSPIAIRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNEKRA. 275
4 -74.000[I] KOG0016 Enoyl-CoA hydratase/isomerase  ali follow..  18  56TYRDIVVKKEDGFTQIVLSRSTEKNALNTEVIKEIVNALNSAAADDSKLVLFSAAGSVFCCGLDFGYFVKHLRNNRNTAEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTVMIQIKELASYNPIVLEECKALVRNIKLELEQANERECEVLRKIWSSAQGIESMKAAFPPRK. 319
5 -68.900[I] KOG1679 Enoyl-CoA hydratase  ali follow..  19  1..............................MVETFNDVLEDIKDNGSRVVVLRSLSGIFCAGADLKERKGMTPE--EATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQALKLAEEILPNGPVGVRMAKLAIDGMQVDLATGYSIEEICYSQVIPTKDRLEGLAAFAEKRK. 227
6 -44.300[I] KOG1684 Enoyl-CoA hydratase  ali follow..  15  10..SSVLATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDESKSFFREEY-STNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSGIATHYCESSKIPAKKTLETLSKMSPTSMKVTFRQLEGSQLSLAQCLIMEYRLAVRHLERSDFKEGVRALLIDK.. 317
7 -42.400[I] KOG1683 Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase  ali follow..  18  31..STHRVEKQGDVAVMKIDLPNTENVLNKALFAEMNETLDRLQDQSVKAIVVSGKPNSFVAGADIQMFKA-EKTAAGVSNLLREGQKQLLTIELSQKPIVAAIMGSCMGGGLEIALACHYRIAVNDTLLGLPEVTLGIMPGGGTQRLPKLTTVQNVLDLTLTGKRIKANKAMKIGIVDRVIQPLGDGAKNKLIKLTNGNYPAPLKILDVVRTAYLDPKNGYEAEAKAFGELSQTFQSKALFGLFEGSTN. 340
8 -10.600[I] COG0777 Acetyl-CoA carboxylase beta subunit  ali follow..  14  126............VALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVVLFTASG-----GARMQE-------GIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTSFAMEGDIILAEPQSLVGFA----GVIENTVRESLPEDFQ--------------KAEFLLEHGFVDAIVKRRDL-------------PDTIASLVRLHGGS..................................... 286
9 -9.700[O] COG1030 Membrane-bound serine protease (ClpP class)  ali follow..  28.......AEKQTVYVIPVE-----KNVEQGLASFLSRSLQDAKDAHADHIILD------TPGGLVKSAI-----------------DMADLITESEIPVTAYVNKRALSAGAYIALQADHIYMAPGGKMGAAAIKNNRDPKYALAMADPDIDAKEVGAPKGDLLTLNADKAIEVGYSEGTADNLSTLVKKLGFEKAQISYAKESFAEKTARWLTNPVIVPILLTIAFLGLTVELFSPGVGLPGTA..... 264
10 -9.070[I] COG0825 Acetyl-CoA carboxylase alpha subunit  ali follow..  11  107.......RLEGRPVMIIGHQKGREGMPAPEGYRKALRLMEMAERFNMPIITFIDTPGAYPG------------VGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSV-------------------ISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYG.......... 317

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.