Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: d3ldaa1 a.60.4.1 (A:78-144) DNA repair protein Rad51, N-terminal domain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst GSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFLast
1 -15.600[L] KOG1433 DNA repair protein RAD51/RHP55  ali follow..  38  17EGPLSVTKLIGGSITAKDIKLLQQASLHTVESVANATKKQLMAIPGLGGGKVEQIITEANKLVPLGF 83
2 -15.000[DL] KOG1434 Meiotic recombination protein Dmc1  ali follow..  31  14KNILSVDELQNYGINASDLQKLKSGGIYTVNTVLSTTRRHLCKIKGLSEVKVEKIKEAAGKII.... 76
3 -13.600[L] KOG2841 Structure-specific endonuclease ERCC1-XPF, ERCC1 component  ali follow..  20  181.......LTSIRGINKSDSLSLLSK-FGSLERALVASRDELEQLEGWGPTKVNRFLEAVQQ...... 233
4 -13.600[L] COG5241 Nucleotide excision repair endonuclease NEF1, RAD10 subunit  ali follow..  20  181.......LTSIRGINKSDSLSLLSK-FGSLERALVASRDELEQLEGWGPTKVNRFLEAVQQ...... 233
5 -11.900[L] COG3359 Predicted exonuclease  ali follow..  12  5......TYIHIPGVGKALEQKIWASGINSWDEFLEMEDRI--SIPPSRKTRICEEIKTSCRHLAEK. 62
6 -11.800[S] COG3743 Uncharacterized conserved protein  ali follow..  18  141......DLKAISGIGPKLEKVLNGLGIWTYAQIAAWSPQEIAWVDD-GRIGRDDWTAQAAVLAA... 202
7 -10.900[R] COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains  ali follow..  22  461.....IDAASIPGVGPARKAALRSFGIETAADV---TRRGVKQVKGFGDHLTQAVID--KASCERRF 518
8 -10.800[R] COG1623 Predicted nucleic-acid-binding protein (contains the HHH domain)  ali follow..  18  312.......LNRIPRVQKFLMDKLIVE-FGNLDALLNASVEDLSAVDGVGSLWARHITDGLGRL..... 365
9 -10.800[L] COG0322 Nuclease subunit of the excinuclease complex  ali follow..  25  566.......LSDIPGVGSKRRQALLTR-FGGLRGVIAASREDLEKVEGISKALAETIYNHLH....... 617
10 -9.970[L] COG0632 Holliday junction resolvasome, DNA-binding subunit  ali follow..  17  75.......LIKVNGVGPKLALAILSG--QFVGAVEREDITTLVKLPGVGKKTAERLVVEMKDRFK... 133
11 -9.620[K] COG0202 DNA-directed RNA polymerase, alpha subunit/40 kD subunit  ali follow..  256........VDELELSVRSANCLKNDNIVYIGDLIQKTEAEMLRTPNFGRKSLNEIKEVLASM..... 309
12 -9.590[L] COG0389 Nucleotidyltransferase/DNA polymerase involved in DNA repair  ali follow..  21  171AFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFG..................... 216
13 -9.420[L] KOG2093 Translesion DNA polymerase - REV1 deoxycytidyl transferase  ali follow..  13  491AYMAPMSLDLLPGVGSSISHKLKQAGLNNCGDVQNTTLEKMEKV--LGKKLGQNLFQNCRGI..... 550

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.