current user: public

If you have questions about the server, please let us know.

Query: d4hswa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKFFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMKLast
1 -42.500[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  12  10.VKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNM----------SNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGTHLLATLDEMPGQEVLDAWGKAYGVLANVFIHREAE 137
2 -26.800[C] KOG3378 Globins and related hemoproteins  ali follow..  10  267.FTETFPVIFKEYKRNGLVLFAKYFSEFPHYKNIWPQFRTLQDSALLASNELANHCSVYMSGLKV........................................................................ 330
3 -7.500[R] COG2346 Truncated hemoglobins  ali follow..  31GGDATVRALTRR--------FYELMDTLPEAARCRA----------IHPADLSGSEAKFYDYLTGYLGGPPVYVE-KHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETENAKLREIIWAPVERLAFHMQNQEAD 149
4 -6.940[A] COG5107 Pre-mRNA 3`-end processing (cleavage and polyadenylation) factor  ali follow..  43...LSYFQLIQYLETQEREVYEQFHNTFPFYSPAWTLQ------KGELARDEFETVEKILAQCLSGKLENNDLSLWSTYLDYIRRKNNLITGGQEARAVIVKAFQLVMQKCAIFEPKSSWNEYLNFLEQWKPFNKWE 178
5 -6.670[A] KOG2047 mRNA splicing factor  ali follow..  28...KLWIAKAESPFKKRFIIYERALKALPGSYKLWYAYLRERLDIVRNLPVTHPQYDSLNNTFERGLVTMHKMPRI---------MYLQTLTVQQLITRTRRTFDRALCALPVTQHDRIWEPYLVF........... 147
6 -5.810[L] COG1421 Uncharacterized protein predicted to be involved in DNA repair  ali follow..  12  29................................KKYADTGGYADVIARANNLKTTQLRKFFSAIRSMEKKADSWKSIEADFYLLKPQARGRDLIPEGFYEVMKKMMDKVDRGDDDEKIENFRVFVRFLESIV...... 130
7 -5.680[K] KOG2549 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA)  ali follow..  12  178.FQKIAELAMSKSNPPLYKEALVSLASDSGLHPLVPYFTNFIADEVSNGLNDFRLLFNLMHIVRSLLQN---HQLMPSVVTCLVSRKLGNRFADNHWEDFAANLVSLICKRYGTVYITLQSRLTRTLVNALLD.... 317
8 -5.370[R] COG1075 Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold  ali follow..  13  76GF-DYFYRIPEDLRAHGANVYL------------------STSSAFQRPDGPNGRGEQLLAYVKAVLAITGAEK-----VNLIG--YSQGGLTVRYVAAVAPSLVASVTTMGTPHHGSELADYLDETFN........ 188
9 -5.350[S] KOG3077 Uncharacterized conserved protein  ali follow..  158..LQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKD.... 288
10 -5.310[S] COG5592 Uncharacterized conserved protein  ali follow..  14  3..................DLSELLMVEHSAIRILSRVVYGKESLEAFEEYLVKDHVEVEEKILFPVIVDFEDRKGFEQTVNRIKADHKL-----------IETLAENMLKWKRSGNDDLYNLRMPLFYKTLTDHNLS 115

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.