current user: public

If you have questions about the server, please let us know.

Query: d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP207

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# E-value Template Links and tools%idFirst HEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRLLast
1 2.000e-47UniRef50_A0A2K9UYR0 Globin-like protein n=3 Tax=Actiniaria TaxID=6103 RepID=A0A2K9UYR0_EXAPA  ali  23  21..EGLTAQQIELVRDTWKDVKQDLE------GHGVTFYTRLFTEHPETQQLFTFRDDKLKEDDRFKFQAKRVMEMVGAAVDGLDDVPSLAGVLKDLGARHV-KWNVKEEHYGPVGEALVFTLQEKFTTEVKEAWLAVYGIVADNMKAG. 167
2 1.000e-42UniRef50_A0A166P7X2 Hemin receptor n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A166P7X2_9GAMM  ali  19  1....MTPEQIARVQASWQQVEGIADQA------AALFYQRLFTQAPELEPLFK---------GNMEEQGKKLMSMIGVAVKGLDRLDTIVPAVQKLGERHKD-YGVKPEDYDAVAQALLWTLAQGLGDDTESAWTEAYTLLASTMIDA. 132
3 2.000e-42UniRef50_A5EFK6 Putative nitric oxide dioxygenase (NOD) n=135 Tax=Bacteria TaxID=2 RepID=A5EFK6_BRASB  ali  16  1....MTPSQITLVQESFAKVAPISDQA------AVLFYDRLFEVAPPVRAMFP---------EDLTEQRKKLMGTLAVVVGGLSNLDTVLPAASALAKRHVN-YGAKPEHYPVVGAALLWTLEEAWTPEVAEAWTAAYGTLSGYMISE. 132
4 2.000e-42UniRef50_Q0VR92 Oxidoreductase n=6 Tax=Bacteria TaxID=2 RepID=Q0VR92_ALCBS  ali  20  1....MTPVQIALVQNSWDKVDAISDQA------ASLFYDRLFTNDPALKPLFK---------GNMEEQGKKLMTMIGVAVRGLDKLDTIVPAVQKLGARHKD-YGVKPADYDTVAQALLWTLGQGLGDDTEAAWVAAYTILATTMIAA. 132
5 1.000e-41UniRef50_A0A1Z5H8E0 Nitric oxide dioxygenase n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Z5H8E0_9GAMM  ali  23  38...LLSSEQINLVRESWKRVLPIKEQA------AELFYQRLFELDPDVKSLFK---------GRLDFQGDKLMTTLDVVVNSLDDLHEVEGMLQAMGRRHI-IYGVEAAHYETVGAALLWVLAEHFTEEVEEAWVTAYGVIATTMKEA. 170
6 1.000e-41UniRef50_A0A1Z9E261 Hemin receptor n=1 Tax=Gammaproteobacteria bacterium TMED119 TaxID=1986671 RepID=A0A1Z9E261_9GAMM  ali  21  1....MTPEQITLVQESWAKVVPIKETA------AELFYGRLFAEYPEVKPYFK---------GDMTEQGKLLMQMISTAVNGLENLDALLEPVKALGSRHKD-YGVKQADYDKVGASLLWTLKEDFTEEVKAAWTETYTIVADVMIGG. 132
7 3.000e-41UniRef50_H0TDW5 Putative nitric oxide dioxygenase (NOD) flavohemoprotein n=102 Tax=root TaxID=1 RepID=H0TDW5_9BRAD  ali  17  1....MTPAQIALVQDSFAKVAPISDQA------AIIFYDRLFEVAPQVRALFP---------DDLTEQRKKLMGTLAVVVNGLTNLPSILPAASALATRHVG-YGAKAEHYPVVGGALLWTLEDAWTPEVAEAWSAAYGTLSSYMIAE. 132
8 7.000e-41UniRef50_A0A2N1IDL0 Methyl-accepting chemotaxis protein n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2N1IDL0_9GAMM  ali  21  1....MTPNQISLVQTSWQKVLPIAPQA------AEIFYTTLFEMDPSLKALFPN---------DIAEQGKKLMAMLDTAVKLLDNPDKLIPAVQNLGAKHL-KYGAEPEHYDTVGAALLKTLAQGLGDDTKKAWTAVYQTLASTMIAA. 132
9 8.000e-41UniRef50_Q7WUM8 Flavohemoprotein n=33 Tax=Proteobacteria TaxID=1224 RepID=HMP_RHIME  ali  19  2....LTQKTKDIVKATAPVLAQ------HGYAIIQHFYKRMFQAHPELKNIFNMAHQERGE------QQQALARAVYAYAANIENPESLSAVLKDIAHKHAS-LGVRPEQYPIVGEHLLASIKEVLGDEIISAWAQAYGNLAD-ILAGM 136
10 9.000e-41UniRef50_A0A1M3FWD1 Hemoglobin n=1 Tax=Sphingobacteriales bacterium 46-32 TaxID=1895839 RepID=A0A1M3FWD1_9SPHI  ali  22  1....MTQQEITIIRRTWKIFRSINPDI-----VGDAFYSKLFADAPAVRKMFP---------AEMNAQYKKLVDMLSGIVANLDDISVLSGDIAAMARRHVE-YGVRPGHYKVVGNALLWTLQQGLGPAVESAWRKCYQQLAEAMIAA. 133
11 1.000e-40UniRef50_A0A0R3NBJ6 Hemin receptor n=4 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A0A0R3NBJ6_9BRAD  ali  21  1....MSPETKELLKSTWAKVVPISDVA------AGLFYERLFTLDPSLQRLFK--------NADMKEQRRKLVQALSAVINSVDDLPSLVPTLEILGRNHI-RYGVEDRHYDTVGAALLWTLKEAWTPAAKSAWVVAYSTVSGVMRD.. 132
12 2.000e-40UniRef50_A0A0N1C593 Hemin receptor n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A0N1C593_9BRAD  ali  20  1....MTPDQIALVQQSFSKVAPISEQA------ASLFYGRLFEIAPEVKPLFAK--------ADIREQGKKLMGTLAVVVGGLTDLPSILPAASRLAKHHVG-YGVTAAHYAPVGAALLWTLEDAWTPELKEAWTGAYTTLSSYMI... 131
13 2.000e-40UniRef50_W6S202 Hemoglobin-like protein n=6 Tax=Firmicutes TaxID=1239 RepID=W6S202_9CLOT  ali  18  2....LDQKTIEIVKSTVPALKE------HGVEITKTFYKNMFENNPEVKRLFNMDRQASGEQPK------ALAMTILAAAQNIDNLEVLLPAVKKIGERHCDV-QIKEEHYPIVGANLLVAIKEVLGDEVIDAWGKAYEVIAKIFID.. 135
14 2.000e-40UniRef50_A0A1Q9AL98 Hemin receptor n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1Q9AL98_9RHIZ  ali  22  1....MTPTDIDLVQSSFAKV------VPIKEAAAELFYGRLFEIAPEVKPL---------SKGDMKEQGRKLMMTLGVVVNGLKDLPSIVPAAEALAVKH-NGYGVKPEHYQVVGDALLWTLEQGLGPDTKSAWATAYGTLSGVMIAA. 132
15 2.000e-40UniRef50_A0A2C9D3E3 Nitric oxide dioxygenase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A2C9D3E3_9RHIZ  ali  17  1....MTPEQVKLVQESFQKVAPIADAAADI------FYNRLFEVAPEVRSMFP---------ADMSDQKGKLMKTLGVAVQNLHQVQTILPVVQELGAKHVA-YGVKPEHYDTVGSTLLYTLEDAWTPELKDAWTETYVTVATVMKDA. 132
16 2.000e-40UniRef50_A0A150QD55 Hemoglobin (Fragment) n=1 Tax=Sorangium cellulosum TaxID=56 RepID=A0A150QD55_SORCE  ali  22  70..DLVSPRTIELVQSSWAKVMPISDAAS------ALFYERLFTIDPSVRPLFKN---------DIAEQKRKLMQMLSVAVDGLSNLPKLVPVLQSLGARHQG-YMVAEHHYDLVGEALLWTLREGLGEDVEAAWKEVYGVIADVMKK.. 202
17 3.000e-40UniRef50_A0A2D0NFV7 Hemin receptor n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0NFV7_9BACT  ali  20  1....MDPQTVNLVQTSFQKVIPIADLAM------KIFYTKLFEIDPSLQNLFPTGEE------QMGKQRNKLRDMLVVAVNSLSKPEVLIPALQNLGRRHVG-YGVAAEHYNTVGQALIDTLADDFTPEVKTAWGEVYGLIATTMIEA. 135
18 3.000e-40UniRef50_Q07S70 Globin n=6 Tax=cellular organisms TaxID=131567 RepID=Q07S70_RHOP5  ali  21  1....MTPDQIALVQQSFTKVAPIADVA------AGLFYGKLFDIAPEVRALFK---------GDIAEQGKKLMGTLGVVVSGLTDLDAILPAASRLARHHVS-YGVKPSHYAPVGAALLWTLEDEWTPDLAEAWTAAYGTLSGYMIE.. 131
19 3.000e-40UniRef50_UPI000248E5F7 globin n=2 Tax=Aquimarina TaxID=290174 RepID=UPI000248E5F7  ali  21  142....LTERKKRLVQSSFTKVAPIADKA------AEIFYNKLFELDPSVKPMFK---------GDMKQQGAKLMSMIGTAVNGLDNLEAIVPAVQNLGKNHLA-YGVKNEHYDTVGSALLYTLETGLGDDVKDAWTEVYSVLATTMKDA. 273
20 3.000e-40UniRef50_A0A2L0EJF9 Uncharacterized protein n=1 Tax=Sorangium cellulosum TaxID=56 RepID=A0A2L0EJF9_SORCE  ali  22  72..ELLSPRTIELVQWSWAKVMPISDAA------AALFYERLFTLDPSVRPLFKN---------DIAEQKKKLMQTLAVAVDGLNNLGKLVPVLQSLGVRHHG-YMVAEHHYDVVGEALLWTLREGLGDDIETAWKEVYGVIADVMKK.. 204
21 4.000e-40UniRef50_A0A0J5PJK4 Flavohemoprotein, putative n=6 Tax=Aspergillaceae TaxID=1131492 RepID=A0A0J5PJK4_ASPFM  ali  20  103....LTTQQKEIVKST------IPALQEHGVTITTLFYKRLLEAHPELKNIFNTAHQATGEQPAALAH------AVWAYASNIDQPEALSTAVSRIGHKHAS-LGVLPEHYPIVGQHLLVSIKDVLGPAVLNAWAAAYQELADMFI... 235
22 4.000e-40UniRef50_A0A257CVZ8 Hemin receptor n=19 Tax=Bacteria TaxID=2 RepID=A0A257CVZ8_9BURK  ali  20  1....MNANQIALVQSSFEDVRPIAEVA------AELFYGRLFETDPMLKPMFK---------GDMANQGRMLMSVLSAAVKGLSDLDALAPVLRNLGARHHN-YGVQEEHYVTVGSTLLWTLGDKFTPEVRAAWTDAYGLIADVM.... 129
23 4.000e-40UniRef50_A7RGQ4 Predicted protein n=2 Tax=Actiniaria TaxID=6103 RepID=A7RGQ4_NEMVE  ali  25  29...PLSTRRKKLVRESWELIE------PVKITIGKRLFTRLFDVNPNMQDTFPNFKGDILNSRSLYLHAKRVMVAVENAVTVLDDAETFESYLINLGGRHLP-WGVTKDHFGVVGEAFIWALQDVLGEDVAEAWIDLYGYIVQAMLEGL 175
24 5.000e-40UniRef50_UPI0009957A22 NO-inducible flavohemoprotein n=1 Tax=Bacillus patagoniensis TaxID=228576 RepID=UPI0009957A22  ali  19  6...QLSEQQVELIKSSVPVL------AEHGLTITKRFYADLFEAHPELLNLFNHANQKQ------DKQQQALANTLYAAAANIENLEELLPVVKQIAHKHRS-LQVKPEHYPIVGEHLLEAIKKVLGSELLDAWANAYDIIADVFIS.. 140
25 5.000e-40UniRef50_A0A163CMC1 Flavohemoprotein n=8 Tax=Betaproteobacteria TaxID=28216 RepID=A0A163CMC1_9NEIS  ali  17  2....LSEQTRALVKATVPVLKE------HGVTLTSHFYQRMFRHNPELKNVFNQGHQASGQ------QQQALAGAVLGYAEHIDDPSVLAPVVMRIAHKHAS-LGIRAEHYPIVGGHLLASIREVLGDELIAAWAEAYGQLADILIAA. 136
26 5.000e-40UniRef50_R1FSQ6 Uncharacterized protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1FSQ6_EMIHU  ali  24  4......PDTIPELRSSWSA------------AVGVLFFKRIFEIAPGALELFSFRDVELYESAKLKSHALKVMNTVGVAVSMLDDVPALLPVLEGLGKKHVD-YGVVPAHYEVVGQALLDTLADAFTPELKAAWAEIYGVVSSTMIKG. 139
27 7.000e-40UniRef50_A0A2S5LYU6 Flavohemoprotein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2S5LYU6_9PROT  ali  16  2....LSDQTIAIVKSTAPILQE------HGETLTKHFYKRMFSHNPEVAPYFNPANQAAGL------QQKALAGAICAYAANIDNLEMLGGAVELIAQKHVS-LQIKPEHYPIVGENLLASIREILGDEVVNAWAEAYGFLADIMI... 134
28 8.000e-40UniRef50_A0A2K9UYS1 Globin-like protein n=3 Tax=Hexacorallia TaxID=6102 RepID=A0A2K9UYS1_EXAPA  ali  22  30.....SDSKKNIIVQTWKLVE------PVKVAAGKKLFSRLFELNPSLQDTFPAFKGDVLNSRSLYLHAKRVMGAVENAVSSLNDSEAFTSYLSNLGARHIP-WNMQKEHFNIVGECLLWTFQDMLGTEVAEAWAELYGYIVQSMLDGM 174
29 8.000e-40UniRef50_A0A2N5KSE6 Hemoglobin (Fragment) n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2N5KSE6_9ACTN  ali  19  6.....TVRQKELVQSTWKRVIPISKTAP------TLFYARLFELDPQLRALFP------AGERSMKAQHLKLMQMIHICVRGLDQLDRIVPAVQNLGRRHVG-YGARNGDYDTVGVALLWTLEQGLGDEVKEAWASVYGVLAATMIGA. 139
30 1.000e-39UniRef50_A0A2A5GVQ4 Flavohemoprotein n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A2A5GVQ4_9PROT  ali  18  2....LSQQTIDIVKSTAPILQE------HGETLTKHFYKRMFSHNPEVLPFFNPANQTEGT------QQRALANAICAYAANIDNLEVLGSAVELIAQKHAS-LQIKPEHYPIVGENLLESIREVLGDDIINAWGEAYGFLADILI... 134
31 1.000e-39UniRef50_Q9XDU3 Bacterial hemoglobin n=17 Tax=Firmicutes TaxID=1239 RepID=Q9XDU3_CLOPF  ali  18  2....LDQKTIDIIKSTVPVLKSN------GLEITKTFYKNMFEQNPEVKPLFNMNKQESEEQPK------ALAMAILAVAQNIDNLEAIKPVVNRIGVIHCNA-KVQPEHYPIVGKHLLGAIKEVLGDDIINAWAKTYGVIAEVFI... 134
32 2.000e-39UniRef50_W7E6F8 Flavohemoprotein n=11 Tax=Bacteria TaxID=2 RepID=W7E6F8_9PROT  ali  18  2....LTENQKSIIKATVPVL------AEHGVALTSHFYERMFAQNPELKQVFNRGHQEAG------KQQHALAGAVLAYAQNIDNPTVLQGALVHIANKHVS-LGIRAEHYPIVGKHLLASIKEVLGDELIDAWGKAYEQLANLLIE.. 135
33 2.000e-39UniRef50_UPI0009E1D017 globin-1-like isoform X1 n=2 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E1D017  ali  20  82...PLTPAQKYLVRETWETIE------LHKNSVGKKTFLRFFEKNPEYQKLFPEFKDELEKTNALYGHTKRVMKAVENAVSALDDAESFSAYLDELGRRHKTRS-LRPTHLEAMQDALMFTLQDSWTDETSDAWKKLFHFIIDHMIYGL 228
34 2.000e-39UniRef50_A0A1E5TA13 Hemin receptor n=4 Tax=Bacteria TaxID=2 RepID=A0A1E5TA13_9FLAO  ali  18  3......SKTIALVQESFEKVKPIAPAA------AEIFYNKLFELDPQLKPLFPNSEGE------MKEQRNKLMSMLGAAVAGLSNLDALIPILKNLGKRHVD-YKVEAFHYVTVGEALIGALEDDFTQDVKEAWANVYGVISNVMIEG. 135
35 2.000e-39UniRef50_K9WVS1 Family 3 adenylate cyclase n=2 Tax=Cylindrospermum TaxID=56106 RepID=K9WVS1_9NOST  ali  20  726......PSQVDLVQSSFAKVKPIADKA------AEIFYNRLFELAPSFRPLFK---------GDMKQQERKLMNTLALAVEGLRQPDQIIPAVQKLGRNHAG-YGVKAEYYDIVGEALLWTLAQGLGEDVRKAWEEAYTFLSEIMKEA. 855
36 3.000e-39UniRef50_M5P8Y4 Flavohemoglobin Hmp n=1 Tax=Bacillus sonorensis L12 TaxID=1274524 RepID=M5P8Y4_9BACI  ali  19  2....LSEKTMQIVKSTAPVLKER------GTEITSCFYERMFKAHPELKNIFNMSRQQTGGQPK------ALAYTVLQAAENIDRLEALLPVVKQIGHKHKS-LQVKPEHYPIVGKHLLEAIEAVLGPDILQAWAEAYEEIARVFID.. 135
37 3.000e-39UniRef50_A0A2G5WM90 Flavohemoprotein n=29 Tax=Bacillales TaxID=1385 RepID=A0A2G5WM90_9BACL  ali  18  2....LDQKTIDIIKSTVPVLEQ------HGKTITTVFYKNMFEAHPELLDIFNHANQSQGR------QQTALANTVYAAAQHIDNLAAIIPAVVQIAHKHVS-LGILPEHYPIVGEHLLGAIKEVLGPEIVDAWAAAYGVIADAFI... 134
38 3.000e-39UniRef50_UPI0009DEF53C hypothetical protein n=2 Tax=Kitasatospora TaxID=2063 RepID=UPI0009DEF53C  ali  17  156...........LIKSSFAVVE------PHGSEVTAYFYAHLFEHNPDVRKLF---------AEHMNDQQDRLWAAIGTLVNRLEDTDTVVNVLQGLGRRHIG-YGALPEHFPAVGGSLLASLADAWTPEIEAAWTALYGVITDVMSAAM 281
39 3.000e-39UniRef50_A0A1H8YFV1 Nitric oxide dioxygenase n=18 Tax=Bacteria TaxID=2 RepID=A0A1H8YFV1_9PROT  ali  16  1....MTPHQIKLVQTSFAQVAPIAATA------ADLFYGRLFEIAPHVRAMFP---------DDLREQKKKLMAMLGTAVAGLSHLETLVPVVQALGRRHAG-YGVKAPHYASVGSALLWTLEEAFTPEVRDAWATTYIVLSTTMMNA. 132
40 3.000e-39UniRef50_G4QHE2 Methyl-accepting chemotaxis protein n=2 Tax=Glaciecola TaxID=89404 RepID=G4QHE2_GLANF  ali  24  1....MTIKQSIVVQKSWQKLKPIAPQA------AKIFYETLFEMDPSLKPMFK---------GDMVEQGNKLMSMLDAAIKLLDDPDKLIPAVQKLGERHVS-YGVKPEHYSTVGAALLKTVETGLGDEVKRAWTAVYKTLADTMI... 130
41 3.000e-39UniRef50_A9GV91 Probable bacterial hemoglobin n=2 Tax=Sorangium cellulosum TaxID=56 RepID=A9GV91_SORC5  ali  22  70..ELLSQRTIELVQWSWAKVMPISDAA------AALFYERLFTLEPSVRPLFKN---------DIAEQKKKLMQTLSVAVDGLNNLPKLVPVLQALGVRHQG-YMVVDRHYDVVGEALLWTLREGLGDDVESAWKEVYGVVSDVMKK.. 202
42 4.000e-39UniRef50_UPI000C03F59C neuroglobin-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C03F59C  ali  23  66.DEQISQKQISLVQETWGLVSGDLEK------VGVDFYMRLFKANPDVLQLFSFSDDIMRADDRLKRQGLVTMQHVDLAVNSLNDLGSIVPALRDLGGRHA-MYKVEEHHYVLVGSVLLDTLNNGLGDEVKEAWTGVYGIVANTMQAG. 215
43 4.000e-39UniRef50_Q5QSA9 Globin X n=11 Tax=Euteleostomi TaxID=117571 RepID=Q5QSA9_DANRE  ali  16  28....LTTNHIRLIKESWRLIQEDIAK------VGIIMFVRLFETHPECKDVFFLFRDRLRTSRELRAHGLRVMSFIEKSVARLDQLERLETLALELGKSHY-RYNAPPKYYGYVGAEFICALKDRWTPELEEAWKTLFQYVTSIMREG. 173
44 4.000e-39UniRef50_UPI0003F6041F NO-inducible flavohemoprotein n=1 Tax=Bacillus TaxID=55087 RepID=UPI0003F6041F  ali  19  2....LSEKTMQIVKSTAPVLKE------KGTEITSCFYKRMFNAHPELKNIFNMSRQQTGGQPK------ALAYTVLQAAENIDRLEALLPVVKQIGHKHKS-LDVKPEHYPIVGQHLLEAIEIVLGDEILQAWAEAYEEIARVFIE.. 135
45 5.000e-39UniRef50_A0A2N7GG17 Hemin receptor n=2 Tax=Vibrio sp. 10N.261.55.A7 TaxID=1880851 RepID=A0A2N7GG17_9VIBR  ali  22  9.....TAIEKKLIQDSFSKVAPIADTA------AEIFYGKLFEYDPSLKRLFKS---------DMTSQGRKLMNTLGVAVKGLDDLESLVPVLEGIAIKHV-RYGVKIDDYTPVGNALIYALKTGLGDETRNAWVKIYSTIATVMRSA. 139
46 7.000e-39UniRef50_A0A1X9YXZ9 Flavohemoprotein n=13 Tax=Bacteroidetes TaxID=976 RepID=A0A1X9YXZ9_9BACT  ali  15  1....MTNEQKELIKATVPVLRK------HGVALTTHFYSRMFTHNPELKNVFNMGNQGNG------KQQLSLALAVLAYAEHIEDPSVLVSAVTKIGHKHVS-LDIRPEHYAIVGKHLLASIGEVLGDELIEAWAVAYQQLADLMT... 133
47 7.000e-39UniRef50_A0A2W8V006 Nitric oxide dioxygenase n=1 Tax=Burkholderia multivorans TaxID=87883 RepID=A0A2W8V006_9BURK  ali  18  2....LTQQTKDIVKATAPVLAQ------HGYDIIQCFYRRLFDAHPELKNVFNMTHKEQGQ------QQQALARAVYAYAENIEDPGSLAAVLKNIANKHAS-LGVRPEHYPIVGEHLLGAIKETLGDEIISAWAQAYGNLAD-LLAGM 136
48 7.000e-39UniRef50_A0A1Y5EC26 Methyl-accepting chemotaxis protein n=17 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y5EC26_COLPS  ali  21  1....MTPNQISLVQKSWQKVLPIAPQA------AEIFYSTLFEMDPSLKALFPS---------NIADQGKKLMAMLDTAVKLLDNPDKLIPAVQNLGAKHL-KYGAEPEHYDTVGAALLKTLAQGLGQDTKKAWTVVYQTLATTMITA. 132
49 8.000e-39UniRef50_A0A2E3CUM4 Hemin receptor n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A2E3CUM4_9GAMM  ali  21  1....MTPEQITKVQTTFDMVEPIADKA------AELFYGRLFEIAPEVRPMFKS---------DMSEQGAKLMRMLGIAVRGLTKLETIVPAVQNLGVKHLE-YGVKEEHFQPVAEALLWTLEDAWDEEAKVAWTEAYVLLSTTMIDAM 133
50 9.000e-39UniRef50_A0A239M371 Flavohemoprotein n=25 Tax=Bacteroidetes TaxID=976 RepID=A0A239M371_9BACT  ali  15  1....MTTAQKELIKATVPILRE------HGVALTTHFYSRMFKHNPELKNVFNMGNQGNG------KQQLSLALAVLAYAEHIEDPSVLVSAVTKIGHKHVS-LDIRPEHYAIVGQHLLASIKEVLGDELIAAWAAAYQQLADLMT... 133
51 1.000e-38UniRef50_R7TFF7 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7TFF7_CAPTE  ali  22  18..ELFTDRQKAIITKTWRHMGNDLTGR------GSKVFLKIFNLHPEVKQLFPSLKDQLLKNPCFRGHASRFMQSVGAVVENLDTPGDLSPLLIDLGRKHVLFGGFTPEYFAAFTEGMMCILGKGFTDEVSVAWKTVFDFIMSQLQDG. 165
52 1.000e-38UniRef50_A6DJX1 Flavohemoglobin n=2 Tax=Lentisphaera TaxID=256846 RepID=A6DJX1_9BACT  ali  17  3....LSQETIDIVKATAPVVGENAEK------ITSRFYPIMFERYPMVKEFFNQSHQRDGL------QQKALAGAVVAYALNIDNLGALGGAVEGITERHAS-LNVQPEHYPIVGECLLAAIAEVLGPEIANAWGEAYGFLAEILIGA. 137
53 2.000e-38UniRef50_A0A1I1MV56 Flavohemoprotein n=1 Tax=Cupriavidus sp. OV038 TaxID=1855313 RepID=A0A1I1MV56_9BURK  ali  18  2....LTQKTKDIVKATAPVL------AEHGYDIIKCFYTRMFQAHPELKNIFNMAHQERGQ------QQQALARAVYAYAENIEDPSSLMAVLTNIANKHAS-LGVRPEQYPIVGEHLLAAIKEVLGDDIISAWAQAYGNLADVLM-GM 136
54 2.000e-38UniRef50_A0A1R4KM78 Flavohemoprotein n=64 Tax=Bacteroidetes TaxID=976 RepID=A0A1R4KM78_9SPHI  ali  14  5....MTTEQKQMVKATVPVLKE------HGVLLTTHFYKRMFEHNPELKHVFNMGNQQN------SKQQTALAHAVLAYAEHIEDPSVLLPVVNNIGHKHTS-LDIRPEHYAIVGRHLIASIGEVLGPELIDAWTTAYGQLADLM.... 136
55 3.000e-38UniRef50_A0A1S2VJ89 Hemoglobin n=4 Tax=Bacteria TaxID=2 RepID=A0A1S2VJ89_9BACT  ali  19  1....MTGEQIQLVKTTWRLLREI-----DPVLLGDVFYGRLFIDNPALQSLFKSP---------MDEQYKKLIDTISVVVARLENLPELIPDIQALAQRHVQ-YGVKPEQYDLVGAALLWTLEKGWTPAAAEAWSRCYHTLAQTMI... 131
56 3.000e-38UniRef50_A0A2N0QM05 Globin-like protein (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2N0QM05_9GLOM  ali  17  1....LSQQTIDVIKSTVPVLEQ------HGVTITKTFYSNMLNAHPELLNYFNRANQQKGR------QQTALANTVLAAAKYIDNLEPIVPVVMQIAHKHRG-LGILPEHYPIVGENLLRAIKEVLGDEIIDAWANAYGVIAEIFIS.. 134
57 3.000e-38UniRef50_A0A1Z3HMF2 Bacterial hemoglobin n=7 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z3HMF2_9CYAN  ali  18  12.....TALQIELLEQSFAKVK------PQANEFVASFYDNLFTDYPAAKPLFAHTN--------MAEQGQKLLMSLVFVIENLRQPGELTAALQGLGARHV-KYGALPEHYPLVGNSLLKTFEQYWTPDTKAAWVDAYGLITEVMLEG. 143
58 4.000e-38UniRef50_A0A2A5SZ43 Putative bacterial hemoglobin n=7 Tax=Bacteria TaxID=2 RepID=A0A2A5SZ43_9BACT  ali  19  1..MSLTPHQITLISQSFYKVEPISEK------ITEIFYKTLFAYEPTVKSLFK---------GDMQQQGRKLMVMLHTVVNSLNRLDNLVPVLQDLAKRHVD-YGVKKTHYTPVGNALIHTLQDDFTPEVKAAWIAILDIIADTMKAEM 135
59 4.000e-38UniRef50_A0A1Y0YLF9 Nitric oxide dioxygenase n=22 Tax=Bacillus TaxID=55087 RepID=A0A1Y0YLF9_BACLI  ali  17  2....LSEKTMQIVKSTAPVLKE------KGTEITTCFYKRMFDAHPELKNIFNMSRQQTGGQPK------ALAFTVLQAAENIDRLEDLLPVVKQIGHKHKS-LHVKPEHYPIVGQHLLEAIEIVLGEAATEAWAEAYEEIARVFIE.. 135
60 5.000e-38UniRef50_B3RYV6 Uncharacterized protein n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3RYV6_TRIAD  ali  20  14.QPSLTEEQKAIIRENWQDVEENM------SEVGLYLFSKLFTIAPEYREVFPF--ETTTDNVRLRVHATGVMKTVGKAVQNLDQFSELQSALSTLGQFHHRKA-IKFENFQAVGQALIQTLQENFTPEVHEAWSKTFDMITAAMKSGM 156
61 5.000e-38UniRef50_UPI000DA1778E NO-inducible flavohemoprotein n=3 Tax=Salinicola TaxID=404432 RepID=UPI000DA1778E  ali  19  3.....TAAQIEIVKRTIPVLRQ------HGETLTRHFYARLFEHAPDVRRYFNPAHQRSGG------QQRALAGAILAYAQHIDDPAALSDAIEVIAQKHAS-LTIQPEHYPIVGEHLLASIREVLGDDVLDAWAAAYDELAGVFIE.. 135
62 5.000e-38UniRef50_A0A2B4SEQ9 Neuroglobin n=2 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SEQ9_STYPI  ali  23  33...PLTADTKNTLRESWKLVE------PLKTEAGKLMFVRLFETHPNIQDTFPTFKDELMNSRSLYLHAKRVMAAVDNAINALDDCEVLIESLTSLGQRHQA-WSVMEDHFAVVGEALLWTLQDLLTSQVLEAWTELFKFITKTMLVGI 179
63 6.000e-38UniRef50_A0A261QJA7 Flavohemoprotein n=9 Tax=root TaxID=1 RepID=A0A261QJA7_9BACI  ali  20  2....LSEKTIEIVKATAPVLE------VKGKEITTYFYKTMFADHPELLNIFNHANQEKGR------QQTALANTVYAAAKYIDQLEVLVPAVKQIGHKHRS-LAVKPEHYPIVGEYLLKAIKEVLGDDIINAWAEAYGVIAKVFID.. 135
64 6.000e-38UniRef50_UPI000BAF0685 non-symbiotic hemoglobin 1-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAF0685  ali  20  38.....TEDQKQLVKATWDVVREDI------SKVGVITFLRLFEKFPDVQDLFVPFRGELRQNVGLREHGLRVMGTIEKCITRIDKPEKLTSMLEVLGEKHI-VFDTKIEYFDLLTPQLIQAIKDQWTPEVEHAWNNFLFYITGIMKNAM 182
65 7.000e-38UniRef50_UPI00077B149A neuroglobin-like isoform X1 n=2 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077B149A  ali  20  105.........ITRVQETWRSVKE----AYKLEHIGLEFYLRLFTDSPELLQLFSFSDIDLRNDKRLTRQGRVTMEHLDLAVSSLNNLGSIVPALKELGARHV-MYKVEEHHYEPVGAALLKTLGERFTPEVREAWTQVYKIVADTMKAG. 247
66 7.000e-38UniRef50_A0A1F7ZJE5 Flavohemoprotein n=1 Tax=Aspergillus bombycis TaxID=109264 RepID=A0A1F7ZJE5_9EURO  ali  19  260..HKLTPQQIQIVKST------IPALEAHGVAITTLFYQRLLQQHPELKNIFNTAHQATGEQPAALAH------SVWAYATNIEHPEALKPAISRIGHKHAS-LGITADQYPAVGEGLLAAIKEVLGDAVLDAWRAAYGELAGYFID.. 395
67 8.000e-38UniRef50_UPI000B8E4BF3 cytoglobin-2-like n=1 Tax=Zootermopsis nevadensis TaxID=136037 RepID=UPI000B8E4BF3  ali  17  80..EELTERQKELLEETWKELEGNIAK------VGVITFISLFETHPDVQQVFMPFNGDLKHSKQLRAHALRVMAFVQKAVARLHEPEKLETILQELGKKHYT-YGAKQKYVDLIGPQFIQALEDRWTPELQEAWIHLFKYMAYVMKTSM 227
68 8.000e-38UniRef50_B3DUZ7 Hemoglobin-like flavoprotein n=3 Tax=Methylacidiphilum infernorum (isolate V4) TaxID=481448 RepID=B3DUZ7_METI4  ali  19  4......QKEKELIKESWKRIEPN------KNEIGLLFYANLFKEEPTVSVLF---------QNPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQ-YGVVDSHYPLVGDCLLKSIQEYLGEEAKAAWTKVYGIAAQVMTAE. 133
69 1.000e-37UniRef50_A0A094H7R8 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4520 (FW-2644) TaxID=1420915 RepID=A0A094H7R8_9PEZI  ali  19  276....MTRQQQDIVKSTAPVL------AEHGIAITTHFYKRMLEARPELKNIFNIAHQATGAQPAALAH------AIWAYADNIDNLGALTSAVSRIGHKHAS-LGVTPDQYAIVGEHLLASIKEVLGDAVLDAWAAAYEQLAEIFIR.. 409
70 1.000e-37UniRef50_A0A1W7AAF8 Flavohemoprotein n=37 Tax=Bacteria TaxID=2 RepID=A0A1W7AAF8_9STAP  ali  17  2....LTEETKNIVKATIPVLEE------HGTEITSAFYKHMFEEHPELLNVFNKTNQKLGR------QQTALAQTVIAAAKHIDHLEAIIPNVNQIAHKHRA-LEIKPEHYPIVGENLIWAIQHVLGPEIVDAWSKTYGVIADVFIQ.. 135
71 1.000e-37UniRef50_A0A1S2DE36 Nitric oxide dioxygenase n=3 Tax=Salinicola TaxID=404432 RepID=A0A1S2DE36_9GAMM  ali  17  3.....TPAQIDVIKQTVPVLQQ------HGEALTRHFYARMFEHNPEVKRYFNPAHQRSGG------QQRALAGAILAYAQHIEDPSALASAIEVIAQKHTS-LTIQPEHYPIVGENLLASIKEVLGDDILDAWAAAYGELAQVFID.. 135
72 1.000e-37UniRef50_UPI0003F0C79F globin-1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0C79F  ali  24  19.KHLLDDRQKRIVRKTWRPLANDM------TENGQKIFINIFESHPEIKYMFPTRDDNLSANPHFRMHSSRFMQSVGAAIDNLNDLDALRPLLVKLAKTHVRFKGFKPDYFDAFEEAMLSVLGQRFTTEVEESWKLLFFYIKDCLKEG. 168
73 1.000e-37UniRef50_A0A210QE49 Neuroglobin n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QE49_MIZYE  ali  21  5.KTPLSSGDKILIKQSWSQFTSTGSLA----DVGVPMFAKLFADYPDVKTLFSFMRGGSLESEAVRNHAEGVMGVVGTAVESIDNLEGLVPTVRSLGAKHYT-YGAQTAHLGPVGECLLYALKEKFTNETKLAWLKLYDVISVAFQDGL 153
74 1.000e-37UniRef50_R7UKY8 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7UKY8_CAPTE  ali  20  19...FLTDKDKLLIRRNWKHLACNL------TERGARVFLRIFVDNPSVKDLFPFKKEELTRDVNFRGHASRFMQAVGAVVDNIDDFEQLAPLLNGLGRKHIDFHGFTPTHFNAFQDAMLAVWSEKLTPEGRDAWIKVFGFIMRELKKG. 165
75 1.000e-37UniRef50_X2GRE8 Dihydropteridine reductase n=14 Tax=Bacillales TaxID=1385 RepID=X2GRE8_9BACI  ali  17  2....LDQHTINVIKSTVPVLE------VHGVAITKTFYHNLFKDNPSLLNIFNHTNQTKGR------QQGALANTVYAAAQHIDNLEPIVPVVVQIAHKHVS-LGVLPEHYPIVGQYLLAAIKEVLGDEIIEAWGKAYGVIADIFIS.. 135
76 1.000e-37UniRef50_UPI000557B650 hypothetical protein n=1 Tax=Dongia sp. URHE0060 TaxID=1380391 RepID=UPI000557B650  ali  15  1....MTPRQIEIVKLSFARIMPFKDQA------AELFYCRLFELDPSLRLMFRS---------DMNEQKQKLMVAIALVVTNLDRMDNFLPAVRELGQRHKT-YGVRNRQYEIVGAALIWTLETGWNAELEEAWKNAYGCVAAAMIEG. 132
77 1.000e-37UniRef50_UPI000B9B7971 hypothetical protein n=1 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=UPI000B9B7971  ali  20  5.........IEIIEQTFAQIKPNAEK------FAASFYVNLFREYPELKPLF--------VNTDMEKQQKKLLDALILVVENLRHGEVLKGVIEALGARHVN-YGVLQQHYPAVGKALLETLKEYWNSEVKAAWVSAYRGIAKLMLKG. 132
78 1.000e-37UniRef50_S7X5W1 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=3 Tax=Cytophagales TaxID=768507 RepID=S7X5W  ali  12  1....MNNSQREIITATVPILRE------HGVALTTHFYKRMFSHHPDLKNIFNMGNQKTG------KQQQALAMAVLAYAEHIANPGVLLPELHRIGHKHVS-LEIRPEHYPIVGNHLIASIKEVLGEEILEAWEIAYNQLADLMM... 133
79 2.000e-37UniRef50_K9WM86 Family 3 adenylate cyclase n=4 Tax=Cyanobacteria TaxID=1117 RepID=K9WM86_9CYAN  ali  19  724....LAPTQVELVQSSFEKVKPIADRT------AELFYQRLFELSPSVRHLFK---------GEMKEQERKLMHTLALAVEGLRQPENIIPAVQDLGRRHAG-YGVKTEYYDILSDALLWTLAQVLGVEVRKAWEEAYTFLSEIMKEA. 855
80 2.000e-37UniRef50_UPI000CF3C16C NO-inducible flavohemoprotein n=1 Tax=Deinococcus sp. NW-56 TaxID=2080419 RepID=UPI000CF3C16C  ali  17  2....LTPEQTAIIKATVPALEA------HGETITRTFYASMFAAHPELLNIFNPANQKTGR------QARSLAASVLAYAAHIDHPERLGGMVGRIAHKHVS-LEVLPEHYPIVGEHLLGAIASVLGPEILDAWAAAYGQLAKIMI... 134
81 2.000e-37UniRef50_A0A0H2LWB1 Flavohemoprotein n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A0H2LWB1_VARPD  ali  16  1....MTPQTIAIVKATVPALQA------HGEAITSHFYRIMFETHPEVKAFFNEAHQAAGS------QARALAGAVLAYATHIDRLDEIAGALPRIIQKHAA-LGVLPEHYPVVGGCLLQAIKDVLGDEIIAAWGEAYQSLAALLIAA. 135
82 2.000e-37UniRef50_S9QGF4 Putative bacterial hemoglobin n=2 Tax=Salipiger mucosus TaxID=263378 RepID=S9QGF4_9RHOB  ali  18  2....LTQGEIKAIRASWLLVAAN------RAELGERFYKNLFRAAPEVRPMFTNGP---------RVQGRKLMETLAIVVDSLDDLAPLLPTIRQLGASHAA-LGVRPEHFDLVGRILLQTLVEAAGEEMTDAWTKAYQAVASAMINE. 133
83 2.000e-37UniRef50_A0A2A4VZ60 Methyl-accepting chemotaxis protein n=23 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4VZ60_9GAMM  ali  21  1....MTPKQITLVQESWQKVLPIAPQA------AENFYNTLFELDPSLKPLFKS---------NIVDQGNKLMTMLDTAVKLLNSPDKLIPAVQKLGARHLD-YGVKTQHYDTVGKALLNTLETGLGDEVKRAWTAIYKVLSKTMIDA. 132
84 2.000e-37UniRef50_A0A1Y2RB33 Hemoglobin n=1 Tax=Chitinophagaceae bacterium IBVUCB2 TaxID=1985174 RepID=A0A1Y2RB33_9BACT  ali  20  2....MTTEQTILVKTSWRMIRDI-----DPAIVGDTFYSKLFCDTPALRKMFPK---------NMDEQYRKLMDMLSTVAARLDNLNDLTEDILSMAQRHVQ-YGVRPAHYKLVGKALLWTLQQGWTEEVKVAWTTCYSTLADTMIAA. 134
85 2.000e-37UniRef50_F2Q9W9 Globin n=3 Tax=Branchiostoma TaxID=7737 RepID=F2Q9W9_BRAFL  ali  20  25HGGPLTQEQVHGIKETWAILAQDP------VERGVGLFMKIFEEDPDLKKLFYFADDGRELSRDVRSHGERVMEAVGGAVDSQGDLTAVVPVLTELGALHH-KYGVQPSYFDTVGAALIYILEDKLTPSIRQGWVLVYGIVGATMKKGM 173
86 2.000e-37UniRef50_UPI0004949DD7 hemin receptor n=1 Tax=Bosea sp. 117 TaxID=1125973 RepID=UPI0004949DD7  ali  19  1....MTPDQIVLLRRSIDGLRPHSEQA------AALFYGRLFEMLPEVRPLFT---------EDMVEQGRKLMRTLVAVMNGIDDMRSLRPAVERLGQRHLQ-YGVRQEHYEPVGVALIWALEDAFTPDTRSAWLKAYDVLTQIMLDA. 132
87 3.000e-37UniRef50_A0A090T2N7 Flavohemoprotein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A090T2N7_9VIBR  ali  14  2....LSNQHIEIIKSTIPLLE------SAGPALTQHFYQRMFAHNPELKDIFNMTHQKSGR------QSVALFEAVAAYAKNIENLAALSAAVERIAHKHTSFH-IKAEHYQIVGHHLIETLREAFTPAVEEAWTEAYLFLAQIFID.. 135
88 3.000e-37UniRef50_A5DQY8 Uncharacterized protein n=2 Tax=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324  ali  17  12..QQLSPEQVNIVKASVPILKA------SGQELTKNFYQKMLSSYPEVKPFFNESDQKSLRQPKI------LAFALLKYAENIENLEPLTGFVQQIVTKHVG-LQVKPEHYPIVGTCLLNTMENMLGPEFLQAWATAYGNLARLLINA. 148
89 3.000e-37UniRef50_UPI00078047DE NO-inducible flavohemoprotein n=1 Tax=Pseudoalteromonas arabiensis TaxID=874454 RepID=UPI00078047DE  ali  16  2....LSEKTIEIVKSTVPLLAEAGPQ------VTEYFYDRMFSYNPELKNIFNMSHQQSG------HQQFALFNALAAYAANIDNLAVLKDALARINHKHTS-YHILPEHYPIVGGHLIATLKEQFTPEVEYAWREAYALLADVITEEM 138
90 4.000e-37UniRef50_A0A2K9UYP1 Globin-like protein n=3 Tax=Actiniaria TaxID=6103 RepID=A0A2K9UYP1_ACTTE  ali  22  46.ETKLDPASIKLIRESWSEVEK-----GDLQETGLVVFRRLFEIAPYLRDLFPF--GYNPDGKDLKAHALGVMSTVGVAVRGLDDLESLKPKLVELGALHKGFE-ITDKEFKHVGEAIIWTLGDQFTPEVKAAWVEAYGLITTTMKEGL 189
91 4.000e-37UniRef50_A0A0N7LZA9 Nitric oxide dioxygenase n=142 Tax=cellular organisms TaxID=131567 RepID=A0A0N7LZA9_9RHOB  ali  17  1....MHESEIQLVQASFAKVAPIADQA------AGIFYDRLFEIAPHVKPYFK---------GDMKVQGAKLMTTLGVVVKGLRDLDKIVPVAQQLAIGHVA-YGVTPEDYAPVGEALIYALKDDFTPDTANAWIRAYETLSSAMIEA. 132
92 4.000e-37UniRef50_W7B9N7 Flavohemoprotein n=1 Tax=Listeria grandensis FSL F6-0971 TaxID=1265819 RepID=W7B9N7_9LIST  ali  21  5.....TEEQKQIVKSTAPILKE------HGKEITAIFYKKMFAAHPELLNYFNMTNQEIGTQP------LALANTVYLAAENIEQLEILLPQVKTIAHKHRS-LTIKAEHYPIVGEYLLKGIAEYLGPEILDAWGAAYGIIADIFIE.. 137
93 5.000e-37UniRef50_UPI00084ADFC8 uncharacterized protein LOC108680782 n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084ADFC8  ali  21  354....LTQEQKIIIKETWAIVKQNVE------RVGVIMFTNLFETHPDVQEVFGMEKNALLDNKKLRNHALRVMGFVEKAVGRLEEPAQLQALLETCGRNHCG-YGAALHHIDLVGPQLLEALEDRWSPEISTAWTLLMDNIAYAMKAAM 499
94 5.000e-37UniRef50_Q8ZCR0 Flavohemoprotein n=995 Tax=root TaxID=1 RepID=HMP_YERPE  ali  15  2....LDTQTIAIVKSTIPLL------AATGPKLTAHFYERMFKHHPELKNIFNMSNQSSGD------QREALFNAICAYATNIENLAALLPTVERIAQKHTS-LNIQPEHYPIVGEHLIATLDELFSPAVLDAWAKAYGVLADVFIQ.. 133
95 5.000e-37UniRef50_K0RES8 Vesicle transport protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RES8_THAOC  ali  23  152......ARRKGAIQTTWVAV-----GDSLGIEATRLFYERLFDQHPEVKPMFSDPDD-------MEEQAAKLLKTISVAVESLSDIATLVPILQDLGKKHAEKWNVQRNHYDAVGECLIWTLKDSWTEDVADAWSWVYGVIAKTMGDA. 285
96 5.000e-37UniRef50_A0A1W1HMZ7 Globin-coupled methyl-accepting chemotaxis protein (Modular protein) n=2 Tax=Nitrospira sp. ND1 TaxID=1658518 RepID=A0A1W1HMZ7_9B  ali  22  5.........VELLESSFKLV------APKGDALVTRFYERLFKKYPSVKPLFKK--------TSIKEQKKKLLASLVLVIQNLRRPDKLTSVLQDMGARHVG-YGVKPAHYDAVGENLLAVLGEVWTPQVKQAWTEAYGAIKTIMLAG. 132
97 5.000e-37UniRef50_A0A210PFB5 Cytoglobin-2 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PFB5_MIZYE  ali  18  54.....TDRQRELVVQTWGIIQEDM------TRVGVVMFMRLFETHPDVQDVFMPFKGQSKESSQLKAHALRVMNTVEKCLGQMNEPAKLQEMLHDLGTRHV-MYSAKVDYIDLIGPQFIWAIQDQWTPEVEQAWSDLFKLISHYMKAAM 198
98 5.000e-37UniRef50_A0A086D0Q4 Uncharacterized protein n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A086D0Q4_9GAMM  ali  20  2....LSPDQIATVKQTIPVLEA------HGDTLTRHFYTRMFAHNPEVKPYFNPAHQREG------AQQRALAGAILAYARHIDDTAALAPAVEVIAHKHAS-LTIRPEHYPIVGENLIASIQEVLGPEIVDAWKAAYAQLAAVFI... 134
99 6.000e-37UniRef50_A0A128F1V6 Flavohemoprotein n=47 Tax=root TaxID=1 RepID=A0A128F1V6_9GAMM  ali  20  1..MSLTQQQITLIQTSFSKVEPISLKA------AEIFYDTLFSYDPTLKPLFKS---------DMKLQGRKLMAMLSAAVNGLNDLDSLVPVLHQLAERH-EGYGVKKSHFTPVGNALLHTLKDEYTPEVRAAWVALLHIVADTMKSKM 135
100 6.000e-37UniRef50_A0A2C5XD19 Uncharacterized protein n=4 Tax=Hypocreales TaxID=5125 RepID=A0A2C5XD19_9HYPO  ali  18  3....LTAHQVALVKSTAPVIKE------HGKTITSYFYKTLLAEHPELKNMFSLRHQQVG------AQQQALADAVFGYAAYIDDLDKLSAAVERIAHKHASLY-VRPEHYPIVGEYLVRAFEQVLGPEIKEAWVAAYGQLADVFI... 135
101 6.000e-37UniRef50_M7CUM7 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=M7CUM7_9ALTE  ali  19  2....LSPESRSIIDATLPAVEA------HANDITDVFYPLMFERYPEVKAYFNQTHQAEGT------QRRALANAVVAYARNLDRLEALGDAVSLIVNKHVS-LNIQPEHYPIVGECLLAAVKQVLGDEVLAAWGEAYQQLADILISA. 136
102 6.000e-37UniRef50_Q7UIY1 Flavohemoprotein n=14 Tax=Bacteria TaxID=2 RepID=HMP_RHOBA  ali  17  2....LSEKTIRIVKEITPLVAANAE------TITRRFYERMFEANPEVKAFFNQAHQHSGG------QQKALAGAICAYFTHIDNPAVLMPAVELIAQKHVS-LGIKPEHYPIVGSNLLAAIGDVMGPEIVEAVSEAYGFLADIFI... 134
103 6.000e-37UniRef50_A0A1M7FB72 Nitric oxide dioxygenase n=4 Tax=Burkholderiales Genera incertae sedis TaxID=224471 RepID=A0A1M7FB72_9BURK  ali  20  1....MTPHDIHLIRHSFNLVQPHAADT------AQRFYENLFAADPGLRELFR---------TDIRHQGERLMTMLAAAIRVLDDPFTLHAALRLLGRRHAG-YGVHAEHYATVGAALIRTLREAFTPEVHDAWVAMYGIVSRTMIEA. 132
104 6.000e-37UniRef50_I2GB73 Hemoglobin n=9 Tax=Cytophagaceae TaxID=89373 RepID=I2GB73_9BACT  ali  21  1....MTIQEINIVKRTWKLLRD-----VDPQLLGDVFYRRLFLTYPSVRPMFR---------EPMTTQYHKFVDMLSLIVSRIDRPEEVMSEIAQLAQRH-ERYGVKPEHYPVVGETLLWTLEQQWNNDVKQAWEACYQTLVQAMLE.. 132
105 7.000e-37UniRef50_A0A2R8AQT8 Bacterial hemoglobin n=23 Tax=Bacteria TaxID=2 RepID=A0A2R8AQT8_9RHOB  ali  14  1....MDDKQITLIQESFAKVVPIKDAA------AEIFYADLFETAPAVKPYF--------ANADMKDQGSKLMATLAVVVNGLRDLDKIVPVAQQLAVKHVD-YGVKAQDYDSVGASLLRTLEDDFTPEVKEAWTVAYTTLAGVMKGA. 133
106 7.000e-37UniRef50_A0A2I1C704 Flavohemo protein n=1 Tax=Aspergillus novofumigatus IBT 16806 TaxID=1392255 RepID=A0A2I1C704_9EURO  ali  16  1..MPLTPEQVQIIKATVPVL------TEHGTTITTVFYKNMLTAHPELNNVFNTAHQVSGHQP------RALAGALFAYASNIDNLGALGPAVELICHKHASLY-IKPDDYKIVGKFLLEALGDALTPEILDAWATAYWQLADLMI... 135
107 7.000e-37UniRef50_A0A2B4SPY0 Cytoglobin-2 n=3 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SPY0_STYPI  ali  19  20...PLTTAQKYLVRETWETIE------IHKNSVGKKTFIKFFEKNPEYQRLFPEFKDELEKTNALYGHAKRVMKAVENAVSALDDSESFSAYLEELGRRHKTRA-LKPMYLDSMQEALMFVLQDSWTEETADAWNKLFRFVTEHMTYGL 166
108 7.000e-37UniRef50_UPI00040E3AFA NO-inducible flavohemoprotein n=1 Tax=Bacillus aurantiacus TaxID=254410 RepID=UPI00040E3AFA  ali  20  6....LSTQSKEIVKASAPILQE------HGEKVTQTFYHNLFQAHPELLNIFNETHQKKGKQP------MALANTLYAAAVNIERLEELLPAVKQIAHKHRS-LNVLPEHYPIVGKYLLEAMREVLGEEVIQAWAEAYGIIADIFI... 139
109 7.000e-37UniRef50_B0CEY8 Globin domain protein n=9 Tax=Cyanobacteria TaxID=1117 RepID=B0CEY8_ACAM1  ali  20  154........QVELLETSFAQVK------PVANEFADRFYENLFTDYPAAQPLF--------ANTDIKQQSKKLLQSLVLVVENLRKPDALGDALTGLGARHV-KYGALPEHYPLVGNTLLKTFEEAWTDDVKQAWVDAYGAISTIMLDG. 282
110 8.000e-37UniRef50_A6CH06 HMP (Fragment) n=1 Tax=Gimesia maris DSM 8797 TaxID=344747 RepID=A6CH06_9PLAN  ali  18  2....LSAKTIQIVKEITPTVAANAE------TVTRVFYKRMFQENPEVQAYFNQAHQHSGG------QQKALAGAICAYFLHIDDLAALTPAVELIAQKHCS-LGIQPEHYPIVGKHLLAAIKEVMGDEVLAAVGEAYQLLADVCI... 134
111 8.000e-37UniRef50_D3SCW1 Flavohemoprotein n=28 Tax=Proteobacteria TaxID=1224 RepID=D3SCW1_THISK  ali  20  2....LSDDHKAIIQKTVPILE------SGGEDLTRHFYSIMFRDYPEVRPLFNQAHQASGQ------QARALANAVLQYARHIDEMEALGPLVGQIVNKHVS-LQVQPEHYPIVGECLLRAMRELLGEEVLEAWGAAYQQLADILIAA. 137
112 8.000e-37UniRef50_C9SVM3 Bacterial hemoglobin n=1 Tax=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) TaxID=526221 RepID=C9SVM3_VERA1  ali  17  3....MTEAQTAIVKSTAPILKE------HGLTITTVFYKSMLGAHPELHNVFNLSNQRSG------AQQKSLANAVLAYATHIDELQKLGPAVERIAQKHVS-LGITPDQYAIVGEHLIKALGDGLTPEVADAWVAAYGQLADIFIK.. 136
113 9.000e-37UniRef50_UPI00042825D3 hemin receptor n=2 Tax=Bacteria TaxID=2 RepID=UPI00042825D3  ali  22  1....MTPEQIDAVQASFRQVAAVREDA------AAQFYDRLFTLDPGLRPLFK---------GDMAEQQRKLMATLGLAVGSLKAPEALAGPLRELGARHRD-YGVQDEHYATVAEALLWTLERAFTDDVRGAWVALYGMVAEGMRR.. 131
114 9.000e-37UniRef50_A0A1I6RIH7 Flavohemoprotein n=1 Tax=Marininema halotolerans TaxID=1155944 RepID=A0A1I6RIH7_9BACL  ali  18  2....LDERTIQIIKSTAPIIKE------HGEEITRCFYQRLFHRHPELLNYFNQANQRQGR------QQQALANAVWAVAENIDQLEKVLPMVEGIAHKHRA-LGVKAEQYPIVGENLLIAIQKVLGDEIMKAWEQAYGVIAEVFI... 134
115 9.000e-37UniRef50_A0A239ZQU0 Putative flavohemoprotein n=1 Tax=Staphylococcus stepanovicii TaxID=643214 RepID=A0A239ZQU0_9STAP  ali  18  2....LSEKTREIVKETVPVLEQ------YGTEITKVFYERMFEAHPELLNIFNKSNQKQG------KQQTALAQTVLAAAKHIDHLEAIVPNVNQIAHKHRA-LQVKEEHYPIVGEFLLKAIKEVLGDEIMNAWEEAYGEIASVFIA.. 135
116 9.000e-37UniRef50_A0A1G7TWS7 Nitric oxide dioxygenase n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1G7TWS7_9FLAO  ali  13  1....MTSKQKRSIKDTIPTLKTN------GIDLTKHFYKRMFFHNPELKNVFNMGNQANG------KQQNALAGAVLAYAEHIENPGILIGTLETIGNKHVS-LNITPEQYDIVGTHLLASIKEVLTDDIIEAWTQAYNELAAIMIS.. 134
117 1.000e-36UniRef50_A0A2G7DQ60 Hemoglobin-like flavoprotein n=9 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2G7DQ60_9ACTN  ali  18  28...........LIKTSFAVVE------PHGSEVTAYFYTHLFEHNPDVRKLF---------AEHMNEQQDRLWAAIGTLVNKLEDTDTVVNVLQGLGRRHAG-YGALPEHFPAVGASLLASLADAWTPEIEAAWTALYGVVTDVMSAAL 153
118 1.000e-36UniRef50_D8PFN9 Globin-coupled methyl-accepting chemotaxis protein (Modular protein) n=4 Tax=Nitrospira TaxID=203693 RepID=D8PFN9_9BACT  ali  20  4........HIELLESSFKLV------APQGDALVTRFYERLFEKYPAVKPLFK--------NASISEQKKKLLASLVLVIQNLRHPEKLTPVLQDMGARHVG-YGAKPAYYDAVGENLLAVLGEAWTPEVKQAWTDAYAAIKTIMLEG. 132
119 1.000e-36UniRef50_A0A0B3BTQ4 Flavohemoprotein n=669 Tax=root TaxID=1 RepID=A0A0B3BTQ4_9PSED  ali  17  2....LSQDTKDLIKATAPVL------AEQGSTIIRRFYQRLFEAHPDLRNLFNMTHQQRGQ------QQEALARAVYAYAANIEQPETLAAVLENIAHKHAS-LGVRPDQYPIVGEHLLGAIKDVLSQDILDAWAQAYGQLAD-LLTGM 136
120 1.000e-36UniRef50_E1X5F5 Putative flavohemoprotein n=3 Tax=Halobacteriovorax marinus TaxID=97084 RepID=E1X5F5_HALMS  ali  19  19......SKTIEIIKSTAPILEE------HGVLLTKHFYKKLFEKNPEVMPYFNRAHQE------MGTQQEALAGAICAYAKNIDNLSALSGAVSLIANKH-SSLKIKPEHYPIVGVNLLESIKEVLGDDIISAWKKAYFFLADILIEA. 151
121 1.000e-36UniRef50_A0A225NHY4 Uncharacterized protein n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A225NHY4_9RHOB  ali  20  2....LTQTEIAAIRSSWLAVVADRDRA------GELFYDNLFRTAPETKSMF---------NASARVQGRKLMETLAIVVEGLDQFDALLPTLRHLGQVHAE-LGVRREHYEIVGTTLIKTLGDKLDPQQEAAWRKAYWTVADIMKAA. 133
122 1.000e-36UniRef50_A0A033V6X9 Uncharacterized protein n=22 Tax=cellular organisms TaxID=131567 RepID=A0A033V6X9_STAAU  ali  18  2....LSEQTKEIVKQTVPVLEQ------YGNEITKVFYQRMFEAHPELLNIFNKSNQKQG------KQQTALAQTVLAAAKHIDHLEAIVPNVNQIAHKHRA-LQVKEEHYPIVGEFLLKAIKEVLGDAATDAWEEAYGEIAGVFIQ.. 135
123 2.000e-36UniRef50_A0A2W2KUB6 Uncharacterized protein n=1 Tax=Streptomyces sp. NTH33 TaxID=1735453 RepID=A0A2W2KUB6_9ACTN  ali  15  38....MTA-DLSLIRSSFAAVQ------PHGSQVTAYFYDHLFAHHPGVRPLF---------ATHLDEQRDRLWAALGALVVNLENTDTLTGMLQNLGRRHAG-YGALAEHYPAVGASLIATLRDAWTPAAEESWAAVYDVISSTMIEA. 168
124 2.000e-36UniRef50_Q2U124 Uncharacterized protein n=154 Tax=cellular organisms TaxID=131567 RepID=Q2U124_ASPOR  ali  16  1..MPLSPEQIQLIKATVPVLQQ------HGTTITTVFYNNMLTAHPELNAVFNNANKVNGHQP------RALAGALFAYASHIDDLGALGPAVELICNKHASLY-IQPEQYQIVGKFLLEAMGEVLGPEILDAWATAYWQLADLMI... 135
125 2.000e-36UniRef50_UPI000C80DFBC hypothetical protein n=1 Tax=Defluviimonas sp. MS2-2 TaxID=2056283 RepID=UPI000C80DFBC  ali  15  55....LSAREVQVIRDNFRAVQDRIVPAS------LEFYEALFRRRPDLRPMFR---------EDLTGQGMKFMSTLEAVVDSLESPEAIADRMEELGHSHAA-LGVKAEHFVPMGEALIETLREGWTAEADAAWRKAYDEVAGRMLAG. 186
126 2.000e-36UniRef50_A0A0Q9YP91 Flavohemoprotein n=37 Tax=root TaxID=1 RepID=A0A0Q9YP91_9COXI  ali  17  2....LDEYTIRIIKSTVPILEKHAEQ------LTYHFYKRMFSHNPEVIPLFNSAHQSTG------HQQKALAGAICSYAANIDNLEALGSSIELIAQKHAS-LQIKPKHYPIVGQNLLASIQEILGDEVIQAWAQAYDFLANILI... 134
127 2.000e-36UniRef50_A0A1A9NPZ4 Hemin receptor n=3 Tax=Methylophilaceae TaxID=32011 RepID=A0A1A9NPZ4_9PROT  ali  17  1....MTPQQISVVKKTWALAE------PLGDTVTVLFYGRLFELDPSLRSLFRK---------DMQEQGRSLRTMIGMVVGGLDDPDKLAGALAASGRRHVT-YRVENRHYDTVREALLWTLREIYTAEVRDAWIATYNMMADTMKAA. 132
128 2.000e-36UniRef50_UPI000933B364 flavohemoprotein n=2 Tax=Cyanobacteria TaxID=1117 RepID=UPI000933B364  ali  20  4........QVECLEQSFEKVKPNAD------AFVTSFYDNLTTMYPEAAPLFS--------STDMAAQKKKLLASLVLVVENLRNPDALTDALHGLGARHV-KYGALPEHYPLVGNALLKTLQDDWTAEVKQAWVDAYGAIAELMLAG. 132
129 2.000e-36UniRef50_A0A0P1ILU2 Nitric oxide dioxygenase n=13 Tax=Bacteria TaxID=2 RepID=A0A0P1ILU2_9RHOB  ali  14  1....MDENAIQLVQDSFSKVVPIKDAA------AEIFYADLFETAPRVKPYF--------VNSDMKEQGSKLMASLATVVSGLRDLDKIVPVAEQMAVRHVD-YGVKPEDYDAVGASLLRTLEEEFTPSVKDAWTGAYTTLAGVMKAA. 133
130 2.000e-36UniRef50_W1DIL4 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=3 Tax=Enterobacterales TaxID=91347 RepID=W1  ali  13  2....LDAQTIATVKATIPLL------VETGPKLTAHFYDRMFAHNPELKEIFNMSNQRNGD------QREALFNAIAAYASNIDNLPALLPAVEKIAQKHTSF-QIKPEQYNIVGSHLLATLDEMFSPEVLDAWGKAYGVLANVFI... 132
131 2.000e-36UniRef50_A0A1H7KTF8 Hemoglobin-like flavoprotein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1H7KTF8_9BRAD  ali  25  1....MTPQDIALVRSSFAQLHR------RKIETACLFYERLFTTTPGARALFK---------TDIETQAAKLMETLMVALATLNDPGGLKVLLNRLGERHQG-YGVQPEHYDAVGSALLWTLETSLGPDTRAAWTELYELMAKTMLSA. 132
132 2.000e-36UniRef50_A0A258BJQ5 Flavohemoprotein n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A258BJQ5_9CAUL  ali  17  5...PLSPETIAIVKATASVL------NEHGETLTRHFYQRMFRENPEVLPLFNPSNQHSGG------QQKALAGAICAYAANIDNLEVLGGAVELIAQKHASLL-IAPEHYPIVGANLLAAIREVLGDAVIGAWAEAYGFLAEILM... 138
133 2.000e-36UniRef50_A0A239GBZ1 Ferredoxin-NADP reductase n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A239GBZ1_9ACTN  ali  21  4........DIELIRRSWSLVEPAAAK------VAAHFYGKLFADHPGVRELFP---------PAMGDQRDRLLGALTRVVLNLEAGPGLVDYLGQLARDHR-KYGVRPEHYPAVGACLIAAMRASWRPEYSEAWAEAYQTIADVMIKA. 131
134 2.000e-36UniRef50_A0A2K9UYR2 Globin-like protein n=5 Tax=Actiniaria TaxID=6103 RepID=A0A2K9UYR2_ACTTE  ali  19  22...PLSKAQKYLVRETWETVE------LYKNNVGKQTFLRFFENNPEFQKLFPEFKEELQKANALHGHAKRVMKAVENAVSAMDDAVSFSAYLEELGRRHVARS-LKPSYLDAMQAALMQTLQSEWTDETAIAWNKLFRFIADTMITGL 168
135 3.000e-36UniRef50_A0A0L0N5X4 Flavohemoprotein n=1 Tax=Tolypocladium ophioglossoides CBS 100239 TaxID=1163406 RepID=A0A0L0N5X4_9HYPO  ali  16  3....LTAKQIAIVKSTAPVVKE------HGQTITRLFYKDMLAAHPELKNYFSLRNQQIG------AQQAALADAVFAYATHIDDLPRLGAAVERIAQKHASLF-IKPEQYPIVGKFLIGAFAKVLGPEIKDAWVAAYGQLADVFIQ.. 136
136 3.000e-36UniRef50_UPI000C047112 uncharacterized protein LOC111298175 isoform X5 n=1 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C047112  ali  18  209.....TEEQEALVVKSWNSMKKNA------GELGLKFFLRIFEIAPSAKKLFTFLRDSLEQNPKLKPHAMTVFVMTCESAIQLRKTGKVESSLKDLGATH-FKYGVVDEHFEVTKFALLETIKEMWSPEVKNAWGEAYDQLAAAIKSEM 355
137 3.000e-36UniRef50_UPI0007EE5E86 hemin receptor n=1 Tax=Rhizobium TaxID=379 RepID=UPI0007EE5E86  ali  20  1....MNPHNISLVQQSFKKLVPTADQ------VGLMFYGRLFETFPEVRPLF---------AEDIGPQSKKLVQMLALVVGGLDKLDAILPAVKDLARRHKG-YGVVEGHYEAVGLTLIWTLRDAFTPEVEGAWSEAFGALSGVMIAA. 132
138 3.000e-36UniRef50_UPI000852A369 hypothetical protein n=2 Tax=Thermogemmatispora TaxID=768669 RepID=UPI000852A369  ali  18  5...........LLKESFGLI------APQKEAFARQFYERLFATYPQTRPLF--------ANTDMRRQESALMATLAAVVAGVERGENLVPVLHKLGERHY-RYGVQPEHYPLVGQALIATLGPRFTPAMQDAWVQAFEVISSQMIAA. 130
139 3.000e-36UniRef50_F8ELZ1 Globin n=3 Tax=Runella TaxID=105 RepID=F8ELZ1_RUNSL  ali  18  1....MDDQQKKLVQTSFARVVPKAEYA------AQLFYKRFFELAPEVESLFNS---------ELKTQGIKLFQVISFTVCSLDNMDELLPLLQDLGRQHV-KYGAEEHHYGYVGEALLWTLKEDFTPEIQQAWTDVFRVMSDTMIEA. 132
140 3.000e-36UniRef50_M7XWG2 Uncharacterized protein n=6 Tax=Methylobacterium TaxID=407 RepID=M7XWG2_9RHIZ  ali  23  705.....SATQVERVQASFAKVRPIADTA------ADLFYERLFAIAPQVRPLFP---------ADMTVQKRKLMAMLALAVANLDKPEALVSAVTDLGLRHRG-YGTHEAHYEAVGAALLWTLEQGLGPEIREAWAETYGVVAGLMRSA. 835
141 3.000e-36UniRef50_A7RJ19 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7RJ19_NEMVE  ali  16  35NRPRLTERQIKLVQDTWRLL------IPSQKKTAMIFYLKLFTLDPIFKEVFSFHEGQLEQDERFLFQSRKFMEMINSAVDRLNDISLLVMILKSLGEVHWTKFKIKPEYYEPVGKALIYSISKGLGDEIGEAWQAMYDLMSGAMISG. 183
142 4.000e-36UniRef50_A0A1W1UB38 Nitric oxide dioxygenase n=4 Tax=Deinococcus TaxID=1298 RepID=A0A1W1UB38_9DEIO  ali  20  6..PSLTPQQMALVQGSLAR------ALPEASEVAGLFYDRLFALDPSLRALF---------LGDMAAQGRKLVDTLDVFAGDLTRLPALRPAMRRLGQRHAD-YGVRPEHYATVSEALLWALEEGFTPEVRGAWEAAYAVIAREMLSG. 139
143 4.000e-36UniRef50_P39662 Flavohemoprotein n=98 Tax=cellular organisms TaxID=131567 RepID=HMP_CUPNH  ali  17  2....LTQKTKDIVKATAPVL------AEHGYDIIKCFYQRMFEAHPELKNVFNMAHQEQGQQQ------QALARAVYAYAENIEDPNSLMAVLKNIANKHAS-LGVKPEQYPIVGEHLLAAIKEVLGDDIISAWAQAYGNLADVLM-GM 136
144 4.000e-36UniRef50_A0A2W4SAM4 Hemin receptor n=2 Tax=Rhizobiales TaxID=356 RepID=A0A2W4SAM4_9RHIZ  ali  24  27..DAMTDEDITLVRESFAQLHR------RRNETSELFYARLFEIAPDVRPLFK---------ADLAAQRVNLMEFLAVAMATLRDPKGLTVLLKKLGRNHRG-YGVQERHYDQVGAALIWTLRTSLGPELERAWTSLYGEMANTMIAA. 160
145 4.000e-36UniRef50_A0A1H5FDF8 NAD(P)H-flavin reductase n=4 Tax=Streptomyces TaxID=1883 RepID=A0A1H5FDF8_9ACTN  ali  21  59........DAVLVRRTMAEVAPVADK------VTSYFYALLFVRHPELRSLFP---------AAMDTQRDRLLKALLTAAEHIDNTEVLVAYLQNLGRGHR-KYGTRPEHYPAVGECLIGALSDVWDAETEAAWVRAYTTISQVMIDA. 186
146 5.000e-36UniRef50_J7L7S1 Globin family protein n=2 Tax=Nocardiopsis TaxID=2013 RepID=J7L7S1_NOCAA  ali  19  142.........IDLVRRS------CADVPEGSTRLAKCFYDNLFAMVPEVRDMFPS---------DIRPQQQRMADALLAVVRHLDSPDEIAEYLRRLGRQHHRELGVRPEHYPHVGRALVRAVSEVWTSSMSSAWVLVYQWITAHMMAG. 268
147 5.000e-36UniRef50_S3D2U5 Globin-like protein n=1 Tax=Glarea lozoyensis (strain ATCC 20868 / MF5171) TaxID=1116229 RepID=S3D2U5_GLAL2  ali  16  4....LTKSQIQTIKATVPVLAQ------HGETITTKFYADLLVAHPELKNVFNSTHQATGR------QARALGASLHAYASNIDDLGRLSPALELICHKHASLY-IQPESYDVVGYHLLKAMKEVLGPEILDAWETAYWQLANIMMS.. 137
148 5.000e-36UniRef50_A0A1K2FKH4 Bacterial hemoglobin n=25 Tax=Streptomycetaceae TaxID=2062 RepID=A0A1K2FKH4_9ACTN  ali  15  1....MTA-DIALIRSSFAAVQ------PHGSQVTEYFYDHLFTHHPGVRPLF---------AAHLDEQRDRLWAALGALVANLENTDTLMGMLQNLGRRHAG-YGALAEHYPAVGASLIAALRDAWTPAVEESWTAVYGVISSTMVAA. 131
149 5.000e-36UniRef50_UPI0004B49BE6 hemin receptor n=1 Tax=Solimonas soli TaxID=413479 RepID=UPI0004B49BE6  ali  20  1....MNPSQIAMVQASWQQV------LPMRRQAAALFYGRLFSLHPHLRALF---------HSPIAEQGEKLINMIDAAIGNLDRLDQLMPVIHALGARHQG-YGVQPDHYVAVGGALLWTLEQAFTAELCEAWTEVYSALAAAMLDG. 132
150 5.000e-36UniRef50_A0A2G3JEF9 Hemin receptor n=1 Tax=Iodobacter sp. BJB302 TaxID=1506510 RepID=A0A2G3JEF9_9NEIS  ali  18  1..MPLSDKDISLVKETLALVLPIADTA------AEMFYQHLFEIAPEVKPLFK---------GDIKKQGAMLMTSIKLAVDNINKPEILLPAIQKLGERHA-HYHVQEEHYTTVGQALLWTLEDAFTSDVKSAWAATYTTLACEMIKA. 134
151 5.000e-36UniRef50_A0A1I3T1A6 Hemoglobin-like flavoprotein n=3 Tax=Rhizobiales TaxID=356 RepID=A0A1I3T1A6_9BRAD  ali  23  4......DDDVQRIRESFAHLHRRKAET------GEIFYNRLFEIAPEVRPLFK---------GDMKAQSVKLMEMLTVAIATLNDREGLAILLRKLGREHKG-YGVKDSHYDRVGEALIWTLRDAFTPRLEQAWTQLYTDIADVMIAA. 133
152 5.000e-36UniRef50_A0A078M590 Flavohemoprotein n=9 Tax=Bacillaceae TaxID=186817 RepID=A0A078M590_9BACI  ali  16  2....LQQQTMDIIKATAPVLE------VHGVTITKTFYQNMFDNHPELLNIFNHTNQARGR------QQTALANTVYAAAVHIENLEAILPVVVQIAHKHVS-LGVLPAHYPIVGKYLLAAIKEVLGPEILQAWEQAYGVIADIFIQ.. 135
153 5.000e-36UniRef50_UPI000D335C23 hemin receptor n=1 Tax=Mangrovicoccus ximenensis TaxID=1911570 RepID=UPI000D335C23  ali  19  10...PLTPEQISTVKQSFARI------FPIKAKLAYDFYERLFEIAPDLRPLF---------SEDISIQREKLADTLAWAVRNLDSPAVLAEVVQGLARRHVT-YGALPEHYPVVGAALIHALQGGLSEAETGAWTAAFETLSDIMIDA. 142
154 5.000e-36UniRef50_UPI0009DE34DE hypothetical protein n=1 Tax=Thermogemmatispora carboxidivorans TaxID=1382306 RepID=UPI0009DE34DE  ali  18  44...........LLKESFGLI------APQKEAFARQFYERLFATYPQTRPLF--------ANTDMRRQEGALMATLAAVVAGVERGENLGPVLHKLGERHY-RYGVQPEHYPLVGQALIATLGPRFTPAMQDAWVQAFEVISSQMIAA. 169
155 5.000e-36UniRef50_A0A1H5ZWH9 Nitric oxide dioxygenase n=6 Tax=Bosea TaxID=169215 RepID=A0A1H5ZWH9_9BRAD  ali  25  1....MTPHQTQLIRESFAHLHRRQAES------AELFYGRLFEIAPETRALFK---------TDIRSQGVKLMESLTVAIASLNDRPGLTAFLKKLGRNHRN-YGVEAKHYASVGEALIWTLQKEFTDETRLAWEILYGDISGVMIKA. 132
156 6.000e-36UniRef50_UPI000BB031AD neuroglobin-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BB031AD  ali  22  38..DVMSESEKRIVKKTWKYLARDM------TYYGTRVFLRIFELKPDLKDLFPFHNEALVNDQNFIGHASRFMQAVGAAIDNINNLHLFGPLLVGLGRQHVEFGGFKPEYWDVFTEAMIFVWEKELGDRCKIAWRKIFEFIMEQLKDG. 185
157 6.000e-36UniRef50_UPI000BA7EB78 cytoglobin-2-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA7EB78  ali  17  41....LTRNQRAILTNTSKLLVENI------SRVGVITFMNLFETHPDVQEVFMPFKGDLRYSRELRAHAFRVMGVVQKVITRLNEEEKLDQLLTDLGKKHA-RYGAKPQYIDLIGPQFVHALEDHWTTEMEEAWCQLFRYIAWVMKAAM 186
158 6.000e-36UniRef50_A0A0Q1CSX6 Uncharacterized protein n=17 Tax=Burkholderiales TaxID=80840 RepID=A0A0Q1CSX6_9BURK  ali  24  1....MSPEQIHLVRQSFAQVAPVAAKA------GALFYAKLFARDPAISGLF--------ASSDMNEQARKLLDMIGSAVRMLGQPEQLDAALRALGKRHAG-YGVEAAHYDTVGAALLDTLAEALGPATREAWGALYAHVGTTMRAG. 133
159 6.000e-36UniRef50_A7SFV0 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7SFV0_NEMVE  ali  19  16..MPLSEAQKYLVRETWETIE------PQKQTVGKKAFLRFFDMNPDYQNLFPEFKEELQKANALHGHAKRVMKAVENAVMSIDDVMSFSAYLEELGRRHKTRA-LKPSYLEAMHGALMDTLRSQWTEETAEAWNKLFSFISTTMVRGL 163
160 6.000e-36UniRef50_A0A0X8GKV9 Uncharacterized protein n=1 Tax=Janthinobacterium sp. B9-8 TaxID=1236179 RepID=A0A0X8GKV9_9BURK  ali  18  3....LTDKDIALVRETLALVLPIADAA------AEMFYQHLFEIAPEVRPLFK---------GDIKKQGAMLMSSIKLAVDNINKPEVLLPTIQKLGERHA-KYAVQEEHYTTVGHALLWTLEDAFTDDVKKAWAATYTTLACEMIKA. 134
161 6.000e-36UniRef50_A0A1V5NS93 Flavohemoprotein n=1 Tax=Bacteroidetes bacterium ADurb.Bin397 TaxID=1852812 RepID=A0A1V5NS93_9BACT  ali  18  2....LTAKQIELVQNTWSTI------TPVSQQMGESFYSRLFQNHPELKPMFKS---------DPKDQAMKLMFMISYLVHRLGSFDDLKDEIIKLASRHTG-YGTKKEHYGAVGDALLATLKESWTPETEAAWTDTYMLIAGLMQQA. 133
162 7.000e-36UniRef50_A0A0L1HFZ0 Flavohemoprotein n=26 Tax=leotiomyceta TaxID=716546 RepID=A0A0L1HFZ0_9PLEO  ali  15  4....LTPSQVQIIKATVPVL------AEHGATITTKFYHDLLEAHPQLKNVFNNTHQATG------HQAKALAGSLYAYAANIDDLGKLSPALELICHKHASLF-IRPDQHAIVGKHLLETMKTVLGPEILEAWGAAYWQLANVMI... 136
163 7.000e-36UniRef50_A0A1Y5ESK5 Nitric oxide dioxygenase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y5ESK5_9GAMM  ali  14  2....LDSNTINTIKATLPAVQAHAEQ------ITACFYPLMFEQYPEVKSFFNQTNQANGT------QSKALANAVIAYAANIDQLGNLSEAISKIVQKHCS-LGIQPEQYPIVGDCLLQAIKQVLGDEVIAAWGKAYQQLADILIAA. 136
164 8.000e-36UniRef50_A5EIC9 Putative globin-like protein n=6 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A5EIC9_BRASB  ali  19  2....LTAEEIACVRSSFDMVFANA------TDMTTTFYQRLFELAPECRSMFPDNMDVLKRD---------FIATLAVLVGSLDRMTGLLSSTDILGRNHA-RYGVRPEHYPLVGEALLWSLAKGLGPEVEQAWRKVYEIISQRMIA.. 132
165 8.000e-36UniRef50_A0A146VJ71 Cytoglobin (Fragment) n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146VJ71_FUNHE  ali  16  120...PLTDKERVMIQDSWAKVYQNCEEA------GVAILVRLFVNFPSSKLYFSQFKDELVHSSQLRKHAQRVMNAINTLVGNIDNSEKVASVLKLIGKGHALKHKVDPVYFKILSGVILEVLGEVMTPEVGAAWTKLFATVCAGIKA.. 266
166 9.000e-36UniRef50_A0A1M5K8Q5 Hemoglobin-like flavoprotein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1M5K8Q5_9GAMM  ali  23  1....MNEQLIQDVQGSWVAVEGIAPQA------AALFYRNLFEADPALQALFK---------GDMVAQGARLMQMIGVAVSKLRDIDALVPVLQALGRRHVT-YGVQDAHYAVVGAALLKTLGQAFTPQVQASWTAVYGAISDVMIEA. 132
167 9.000e-36UniRef50_A0A1E3H4Z3 Bacterial hemoglobin n=1 Tax=Methylobrevis pamukkalensis TaxID=1439726 RepID=A0A1E3H4Z3_9RHIZ  ali  15  1....MTPEEIRLVQDSFREIQ------PSVGVVANVFYAHLFSMTPALRPLFPH---------DMSGQKIKLMKMIEAAVDNLHHFDLMRPTIRSLGARHVG-YGVRDEHYDLVGAALLHTLGDGWTTDIEDAWLEVYGRVAGEMKDA. 132
168 9.000e-36UniRef50_UPI00024838DF globin domain-containing protein n=1 Tax=Acaryochloris sp. CCMEE 5410 TaxID=310037 RepID=UPI00024838DF  ali  20  154........QVELLETSFAQVK------PVANEFADRFYENLFTDYPAAQPLF--------ANTDIKQQSKKLLQSLVLVVENLRKPDALGDALTGLGARHVQ-YGALPEHYPLVGNTLLKTFGQAWTDEVQQAWVDAYGAISTIMLDG. 282
169 1.000e-35UniRef50_M4AD09 Cytoglobin n=40 Tax=Osteoglossocephalai TaxID=1489341 RepID=M4AD09_XIPMA  ali  18  16...PLTDKERVMIQDSWAKVYQNCEEA------GVAMLVRLFVNFPSSKLYFSQFKEELEHSPQLRKHAQRVMNALNTLVENIDDSEKVASVLKLVGKAHALKHKVDPVYFKILSGVIVEVLGEEYTPEVGAAWTKFLATVCSGLKA.. 162
170 1.000e-35UniRef50_UPI000719D0AA neuroglobin-like n=3 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719D0AA  ali  22  19....LTEREKALIRRSWKLLCEDS-----MTMIGGEIFLKIFELNNEVKALFPFRDEALKHDPDFKGHASRFMQALGAAVDNLDNLHSLEPLLSALGKTHTRYRGFTPAFFDEFTASILHVWRERLGPEVRAAWLAMVSFIATAMKDG. 167
171 1.000e-35UniRef50_K1R7G1 Neuroglobin-1 n=8 Tax=Mollusca TaxID=6447 RepID=K1R7G1_CRAGI  ali  14  51..PLLTERQKELIMQSWQKIQEDM------SKVGVVMFMRLFETHPDVQDVFMPFKDDLRHSSQLREHALRVMGTVEKCLARINEPKKMEEMLHDLGTRHV-MYSAKVDYVDLIGPQFIWALEDQWNTELEEAWSDLFKMMTHVMKNAM 198
172 1.000e-35UniRef50_M2THC1 Uncharacterized protein n=6 Tax=Bipolaris TaxID=33194 RepID=M2THC1_COCSN  ali  13  4....LTPTQVQIIKSTVPVL------AEHGTAITSRFYHDMLQAHPELKNIFNNTHQATG------HQAQALAGSLYAYAANIDNLGKLSPAVELICHKHASLF-IRADQYDIVGKHLLSTMSSVLGPEILDAWGAAYWQLANIMI... 136
173 1.000e-35UniRef50_B4WU25 Globin domain protein n=1 Tax=Synechococcus sp. (strain ATCC 29403 / PCC 7335) TaxID=91464 RepID=B4WU25_SYNS7  ali  17  716.......RQVELVQRSFAKVEPISEQ------VGKLFYEHLFETRPDFKPLFS--------STDMETQQRKLMMTLATAVEGLRHPEEIISKVQALGRSHQG-YGVKAEDYEAIGATLLWTLKEKLGPEVKRAWEVAFQFLSKIMINA. 845
174 1.000e-35UniRef50_UPI0003F065FF neuroglobin-1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F065FF  ali  22  23..DIFTERQRRIVRKTWRPLANDMTGN------GTKVFLHIFEMNPKVKQLFPKTGEELLKDLNFKGHASRFMQSVGAAVDNLDNLETLAPLLMNLGKSHNHFSGFELNYFDSFTGAMLHVLQDRFTPEVMEAWKLVFDYMMGKMKDG. 170
175 1.000e-35UniRef50_K9Y083 Nitric oxide dioxygenase n=19 Tax=Cyanobacteria TaxID=1117 RepID=K9Y083_STAC7  ali  18  117.....SQKTIDIVKSTAPVIKQ------HGKTITTRMYEIMFDTHPEVKSQFDMAAQANGT------QHAKLATAVYSYATHIDDLESLKAMVDKIAHRHVATH-VLPEQYPIVGECLLKAIKDVLGDEVMTAWAEAYQALAGVFI... 248
176 1.000e-35UniRef50_A0A1F7ZZ88 Flavohemoprotein n=6 Tax=leotiomyceta TaxID=716546 RepID=A0A1F7ZZ88_9EURO  ali  16  1..MPLSPEQIQLIKATVPVLQQ------HGTNITTVFYSNMLTAHPELNAVFNNANKTNGHQP------RALAGALFAYASHIDDLGALGPAVELICNKHASLY-IQPDQYQIVGKFLLEALGDALTPEILDAWATAYWQLADLMI... 135
177 1.000e-35UniRef50_M7NY13 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=1 Tax=Methylophaga lonarensis MPL TaxID=1286106 RepID=M7NY13_9GA  ali  18  1....MNSSQIEIIKQTVPVLQE------HGETLTRRFYENMFRNNPEVKDFFNPAHQQAGT------QQRALAGAICAYAANIDNLSALSGAVDLIAHKHVS-LGIKPEHYPIVGQNLILTIQEVLGEAIIEAWTVAYQELARIF.... 132
178 1.000e-35UniRef50_A0A128FGE6 Flavohemoprotein n=25 Tax=Bacteria TaxID=2 RepID=A0A128FGE6_9GAMM  ali  20  1..MSLKQQQITLIQTSFNKVEPISVKA------AEIFYDTLFSYDPTLKSLFK---------GDMKQQGRKLMAMLSAAVKGLNDLESLFPVLHELAQRH-EGYGVKKSHFTPVGNALLHTLKDDFTPEVRAAWVTLLHIVADTMKSKM 135
179 1.000e-35UniRef50_A0A1P8FQ56 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium GR16-43 TaxID=1904640 RepID=A0A1P8FQ56_9PROT  ali  15  1....MTPEQIALVQNSWKKIVPFKDMA------AVLFYGRLFELNPSLKPLFGKP---------MDLQGRKLMAMIGTAVGCLGRMHELSPGMDGIGQRHA-VYCLKDEHYETVAQAFLWTLEQTLDTEVREAWTVAYTTLANVMKDA. 132
180 1.000e-35UniRef50_A0A1B8C2M8 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. WSF 3629 TaxID=1622147 RepID=A0A1B8C2M8_9PEZI  ali  15  3.ENQMTPEQINIILQTVPLVQERA------YDITTIFYQNMLSAHPELNSIFNTTSQRT------EHQARALAGALCAYAANINKLDALGPMLELICHKHASLL-IEPKQYSIVGKYLIEAMEQVLGEAIQAAWTTAYWQLAKIMIE.. 139
181 1.000e-35UniRef50_UPI000568E4F5 hypothetical protein n=1 Tax=Sporocytophaga myxococcoides TaxID=153721 RepID=UPI000568E4F5  ali  18  3.....NDTQISLVKKSWESAYKIQDVA------GPLFYNRLFEIAPEVRYMF--------AQTNLQEQSKKLFQMLNYIIQRLHNLDDIIDEVASLAGRHV-KYGVKERHYQIVGEALLWTLEELWNSETKESWVKTYTILSSAMIGA. 134
182 1.000e-35UniRef50_UPI000833C1D2 hypothetical protein n=1 Tax=Rhizobiales bacterium CCH3-A5 TaxID=1768796 RepID=UPI000833C1D2  ali  25  1....MTENDIALIRETFAHLHR------RKTETARIFYDRLFEIAPEVRPLFK---------GDIKAQGAKLMETLLVAIATLNDRPGLTILLEKLGRGHRD-YHVEPRHYDNVGAALIWTLQDGFTPAVERAWTSLYADIAATMIGA. 132
183 1.000e-35UniRef50_A0A2A4N209 Nitric oxide dioxygenase (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A4N209_9GAMM  ali  17  2....LSQQTIETVQSTIPLL------AEHGQTITQNFYEKLFVAHPELKNVFNLNNQQDGN------QARALADAVFAYANNLTNLEALIPAVQRIANKHVS-LGIKPEQYPIVGQYLLAAIQDVLSPDALTAWAEAYAVLADVFIEGL 140
184 1.000e-35UniRef50_A0A1M3HDM8 Uncharacterized protein n=2 Tax=Sphingobacteriales bacterium 50-39 TaxID=1895841 RepID=A0A1M3HDM8_9SPHI  ali  25  1....MTLRQIELVRYSWARVTAIDE-----VTFGIGFYNRLFEIAPEIEPMFKRP---------ILEQSRKLTTILDHVIEKLDALDDIVENIVKLAHRH-ENYGVKPEHYTLVGEALLWTLEDLWNDELKFAWTMCYVGISTAMLQAM 134
185 1.000e-35UniRef50_A0A2P8VSJ7 Globin n=1 Tax=filamentous cyanobacterium CCP5 TaxID=2107701 RepID=A0A2P8VSJ7_9CYAN  ali  18  167.........IALLEQSFEKVK------PQANEFVGSFYENLFTDYPAAKPLFTHTN--------MKEQGNKLLMSLVFVIDNLRKPGELTNALKGLGARHV-KYGALPDHYPLVGNSLLKTFEQYWTPETKAAWVDAYGLITEVMLDG. 294
186 1.000e-35UniRef50_UPI00068661E2 hypothetical protein n=2 Tax=Planktothrix TaxID=54304 RepID=UPI00068661E2  ali  20  180.....TTAQIELVETSFEKIK------PRAVEFVSSFYQNLFETYPETQRLFGK--------TDMDKQGKKLLNSLILLVEGLRTPEALIPVLKDLGARHKG-YGTITEYYPLVGEILLKTLQEDWTPDVAQAWLEIYTNTSNLMLEG. 311
187 2.000e-35UniRef50_A0A2G7GNZ9 Uncharacterized protein n=1 Tax=Chroococcales cyanobacterium IPPAS B-1203 TaxID=2049454 RepID=A0A2G7GNZ9_9CHRO  ali  17  4........QVEVLEQSFERVK------PHANEFAASFYNNLLTDYPQLQHLFAK--------TDMEQQHQKLIMSLILVIGNLRNPEYLKITLKNLGERHVG-YGTLQQHYPMVGAALLKTLGTDWTPEVKQAWADAYGVLAEMMLEG. 132
188 2.000e-35UniRef50_Q6CB74 YALI0C21362p n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=Q6CB74_YARLI  ali  15  2....LTDAQIKIIKDSAPFLAEN------GTDFAAKMYKYMFATYPEVIRFFNQSDQKNLAQPKILAH------ALVAYASNIDNLGVLSDFVEQIVVKHVG-LQIQPEQYPIVAASIIHTLKEMLGPEFIEAWTVAYTQLANILIDA. 136
189 2.000e-35UniRef50_A0A0C1N7H3 Flavohemoprotein n=27 Tax=Cyanobacteria TaxID=1117 RepID=A0A0C1N7H3_9CYAN  ali  21  5.........VELLEQSFAQIKPRAED------FVASFYENLFASHPEAKPLF--------ANTNMVEQRQHLLAALVLVVQNLRKPEVLEEALKKLGAKHIS-YGTAPEHYPLVGQALLTTLQQDWTSEVEQAWTDAFGAITALMLKG. 132
190 2.000e-35UniRef50_H2MRF9 X globin n=51 Tax=Gnathostomata TaxID=35060 RepID=H2MRF9_ORYLA  ali  17  25..EHPNEEQIQMIKDSWKVIRDDIAK------VGIIMFVRLFETHPECKDVFFLFRDRLRTNRELRAHGLRVMSFIEKSVARLDQPERLEALAVELGKSHY-HYNAPPKYYNYVGAEFICALKEQWTTELEKAWQTLFQFVTALMKQG. 172
191 2.000e-35UniRef50_A0A2A3I599 Hemoglobin-like flavoprotein n=1 Tax=Streptomyces sp. TLI_235 TaxID=1938860 RepID=A0A2A3I599_9ACTN  ali  18  7...........LVKSSFAAVE------PHGTEVTAWFYRHLFEHHPAVRPLF---------AEHLDEQQDRLFAALGALVANLEDTDTLVGVLTGLGRRHAG-YGALPEHFPAVGVSLIATLRDAWSPQAEAAWAAVYGVVADTMGRAL 132
192 2.000e-35UniRef50_A0A0U3MPE4 Hemin receptor n=3 Tax=Pannonibacter TaxID=227873 RepID=A0A0U3MPE4_9RHOB  ali  21  1....MTPEQIQLVQASFDRLR------PQGTAVISGFYGRLFELSPSLRPLFR---------TSLPAQEQRLLEALSAVVSMLSNLQMLLPELEALAKRHVT-YGVSAAHYQAAGDALLWTLEEAFTPEVRSAWMAAYATLSDIMIA.. 131
193 2.000e-35UniRef50_UPI000361A298 NO-inducible flavohemoprotein n=1 Tax=Algicola sagamiensis TaxID=163869 RepID=UPI000361A298  ali  14  2....LSQQTMTIIQSTAPVL------AEHGVAITDRFYHLLFSAHPALKHIFNMSNQSEGT------QKKALAQAVYSYAQHIDRLADLLPLVERIAHKHAS-LGILPEHYPIVGKYLIEAIQDVFTDEIKAAWVEGYQMLADILIA.. 135
194 2.000e-35UniRef50_A0A2U3DXL3 Uncharacterized protein n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3DXL3_9HYPO  ali  17  857....LTAEQIAIVKSTAPVVKQ------HGRTITTTFYASMLGAHPELLNIFSVRNQHTG------AQQAALADAVFAYAAHIDDLAALRGAVERIAHKHASLF-VKPEQYAIVGEHLVGALGDALTDDVKDAWIAAYGQLADVFIQ.. 990
195 2.000e-35UniRef50_UPI000837A761 NO-inducible flavohemoprotein n=1 Tax=Alteromonadaceae bacterium XY-R5 TaxID=1737567 RepID=UPI000837A761  ali  13  5...PLDDRTRELVKATAPILLE------HGETITRCFYNRMLSKHPELKRYFNQTHQQSG------AQAKALAYSVFCYANHINELDKLGGLVEQIVTKHVS-LDILPEHYPIVGEAIIEVLGDAFTPELQDAWVKAYGFLADLLI... 138
196 2.000e-35UniRef50_A0A2P9F1U1 Naphthalene 1,2-dioxygenase system ferredoxin-NAD(+) reductase component n=27 Tax=Streptomyces TaxID=1883 RepID=A0A2P9F1U1_9ACTN  ali  22  115........DAVLIRRTMAEVGPVADK------VTSYFYALLFVQHPDLRSLFP---------PAMDAQRDRLLKALLTAAEHIDNTPVLVDYLQNLGRGHR-KYGTQPEHYPAVGECLIGSLSRTWDDETEAAWVRTYTTISQVMIDA. 242
197 2.000e-35UniRef50_UPI000C04D831 non-symbiotic hemoglobin 1-like isoform X6 n=3 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C04D831  ali  18  87.....TEEQEALVVKSWNSMKKNA------GELGLKFFLRIFEIAPSAKKLFTFLRDSLEQNPKLKPHAMTVFVMTCESAIQLRKTGKVESSLKDLGATH-FKYGVVDEHFEVTKFALLETIKEMWSPEVKNAWGEAYDQLAAAIKSEM 233
198 2.000e-35UniRef50_A0A2K9UYP9 Globin-like protein n=4 Tax=Hexacorallia TaxID=6102 RepID=A0A2K9UYP9_EXAPA  ali  17  19...PLSTAQKYLVRETWETIEQ------HKNPVGKKTFLRFFDMNPDFQKLFPEFREELEKANALHGHAKRVMKAVENAVTAMDDAESFTAYLEGLGQRHVNRA-LKPSYLDAMQVALMDTLKDQWTQETCDAWNILFRFIADTMKRGL 165
199 2.000e-35UniRef50_A0A1H3U9P0 Nitric oxide dioxygenase n=2 Tax=Jannaschia faecimaris TaxID=1244108 RepID=A0A1H3U9P0_9RHOB  ali  18  14....LTPRQIFLIRDSFSSV------APMRKTAATLFHAHLFEMAPSVRPLF---------SRDVSDQGDMLMAALARIVRALDRMEDVAPDLEALARRH-PGYGAREEHYPAVGEALIWALEERFTDEVRKAWVDAYAEISHIMIAA. 145
200 2.000e-35UniRef50_A0A1U7IDG3 Bacitracin resistance protein BacA n=8 Tax=root TaxID=1 RepID=A0A1U7IDG3_9NOSO  ali  19  3.....SQQTIDIVKSTAPVLKKN------GQQITSRMYEIMFQNHPEIREQFNMSDQADGSQPA------RLATAVYSYANQIDNLAALKSMVEKIAHRHVQTH-VTPEQYPIVGESLLQAMKDVLTDEVMAAWTEAYQALSEVFI... 134
201 2.000e-35UniRef50_W7D677 Flavohemoprotein n=11 Tax=Listeriaceae TaxID=186820 RepID=W7D677_9LIST  ali  22  5.....TEEQKQIVKSTAPILKE------HGKEITSIFYKKMFADHPELLNYFNLTNQEIGTQP------LALANTVYLAAENIERLEVLLPQVKTIAHKHRS-LTIKAEHYPIVGEYLLKGIAEYLGPEILDAWGAAYSIIANIFIE.. 137
202 2.000e-35UniRef50_Q9BHK1 Extracellular globin n=1 Tax=Sabella spallanzanii TaxID=85702 RepID=Q9BHK1_SABSP  ali  30  17....CNILQRLKVKNQWQEAFGYADD---RTSXGTALWRSIIMQKPESVDFFKRVNGKDISSPAFQAHIQRVFGGFDMCISMLDDSDVLASQLAHLHAQHVER-GISAEYFDVFAESLMLAVESTISCFDKDAWSQCTKVISSGIGSGV 159
203 3.000e-35UniRef50_W7ATG7 Flavohemoprotein n=3 Tax=Listeria TaxID=1637 RepID=W7ATG7_9LIST  ali  17  2....LDEKTREIVKST------IPFLQDKGTEITGIFYQNMFKAHPELLNIFNQNNQREGT------QSKALANTVLAAAMNIDDLSVLKPHVIQIGYKHRA-LQVKPEHYPIVGHHLIEAIGIVLGDEIIDAWTAAYGEIAQVFIDA. 136
204 3.000e-35UniRef50_F8I6Y7 Nitric oxide dioxygenase n=1 Tax=Sulfobacillus acidophilus (strain TPY) TaxID=1051632 RepID=F8I6Y7_SULAT  ali  19  27......QNTIDKVKATVPLLKGRAE------ELGTRFYRHLFAEYPELQNVFNHAHQATLKQP------RALAESVLGAAENLDNATYLRDAIQTIAHKHRS-LEVKPDHYPIVGRVLLQTLAESLGPDTITAWATAYEFIADVFIQA. 159
205 3.000e-35UniRef50_D3V8J6 Flavohemoprotein n=37 Tax=Gammaproteobacteria TaxID=1236 RepID=D3V8J6_XENBS  ali  18  2....LDSQVIATVKSTIPLI------VSTGPKLTAHFYERMFKHNPELKDIFNMSNQLNG------AQREALFNALCAYASNIDNLQALLPAVEKIAHKHTS-LNIQPEHYQIVGTHLLATLDEMFGDEVLNAWGKAYEVLADVFI... 132
206 3.000e-35UniRef50_A0A177W3W1 Flavohemoprotein n=4 Tax=Piscirickettsiaceae TaxID=135616 RepID=A0A177W3W1_9GAMM  ali  17  2....LSEHTKTIVKATAPVMKE------HGLTITLRMYDIMFARYPKTKTLFNQTHQENKQQP------RALANSIYAYAANIDNLDALGDAVELIAHKHAS-LNILPEHYDIVAECLIQAVKDILTTEIITAWTEAYTFLANVFI... 134
207 3.000e-35UniRef50_A0A2K9UYQ6 Globin-like protein n=2 Tax=Exaiptasia pallida TaxID=1720309 RepID=A0A2K9UYQ6_EXAPA  ali  24  19...LLTEEKKTLLRKTWAIASQPSVQA------GNKLFKTLFQIAPSASTYFSSTDIDA---DDFQRHIQLVMGTLGTAIDNLDDLSVIVPGLQGLGATHDS-LGVRIEYFKYVKQALLQTLQDAFTDDCREAWTLAFDVIVGAMISGM 158
208 3.000e-35UniRef50_A0A2J5PGG5 NO-inducible flavohemoprotein (Fragment) n=4 Tax=Enterobacteriaceae TaxID=543 RepID=A0A2J5PGG5_KLEPN  ali  14  2....LDAQTIATVKATIPLL------VETGPKLTAHFYDRMFAHNPELKEIFNMSNQRNGD------QREALFNAIAAYASNIDNLPALLPAVEKIAQKHTSF-QIKPEQYNIVGSHLLATLDEMLGQEVLDAWGKAYGVLANVFI... 132
209 3.000e-35UniRef50_W0RNE9 Globin n=1 Tax=Gemmatirosa kalamazoonesis TaxID=861299 RepID=W0RNE9_9BACT  ali  20  1....MTPEHAQLVRSTW------PAVAADVDALASRFYRHLFELDGAAAGLFATV--------DMTAQRAKLARTLGVIVATLDDPDALLPVIGALGKRHVG-YGVEQRHYDTVGDALLWALRDTLGPEVHDAWAEAYTLVASVMRRAL 134
210 3.000e-35UniRef50_I3KRJ1 Uncharacterized protein n=11 Tax=Percomorphaceae TaxID=1489872 RepID=I3KRJ1_ORENI  ali  18  26...SLSAESREAIRSSWKEIQEDI------SRVGVIMFVRLFETHPECKDAFFAFRDALRASKELKAHGLRIMYIIEKTVARIDQDDRLDQLILDLGRKHYQ-YKALPKYYDLMGEEFIQALQERWTSDLEEAWKTLFLYITRTMKKG. 172
211 3.000e-35UniRef50_U3TZQ7 Globin n=1 Tax=Plautia stali symbiont TaxID=891974 RepID=U3TZQ7_9ENTR  ali  14  4......AQTIATVKSTLPAIAQ------LGPQLTGHFYQRMLTQHPELKNVFNMNNQRSGN------QREALFNAICAYGSNLENLAVLLPAVEKIAQKHAS-LNIQPAQYAIVGENLLATIKELLGDEVLAAWGKAYGVLAEVFIQ.. 133
212 4.000e-35UniRef50_A0A076P2E8 Flavohemoprotein n=66 Tax=Bacteroidetes TaxID=976 RepID=A0A076P2E8_FLAPS  ali  14  10....MTSTQKDLIKATIPILKSNGED------LVKYFYNRMFIHNPELKNLFNMGNQSSG------KQQSALTGAVLAYAENIDNPTVLINTLKLIGNKHVS-LQVTAKQYDIVGNHLIASIKEVLGAETATAWTIAYTQLAQIMIEGM 149
213 4.000e-35UniRef50_UPI000B794C43 non-symbiotic hemoglobin 1-like isoform X1 n=1 Tax=Hevea brasiliensis TaxID=3981 RepID=UPI000B794C43  ali  18  90.....TEEQEALVVKSWNSMKKNS------GELGLKFFIKIFEIAPSAKKLFSFLNDSLEQNPKLKPHAVTVFVMTCESAVQLRKAGKVESSLKDLGATH-FKYGVVDEHFEVTKYALLETIKEMWSPEMKNAWAEAYDQLAAAIKIEM 236
214 4.000e-35UniRef50_UPI0006B09B77 neuroglobin-like n=2 Tax=Chelicerata TaxID=6843 RepID=UPI0006B09B77  ali  15  37..PELTSNQIALLTNTWKLLVENI------SRVGVIAFMNLFETHPDVQEVFLPFKGELRYNKELRAHALRVMGFVQKVMARLNEEEKMDQLLADLGRKHI-YYGAKPEYIDWIGPQFVNALEAHWTAEIEEAWCQLFRYVAWVMKTAM 184
215 4.000e-35UniRef50_A0A2U1VPX2 Uncharacterized protein n=1 Tax=Azospirillum sp. TSO22-1 TaxID=716789 RepID=A0A2U1VPX2_9PROT  ali  20  1....MSPDDMETVRRSFCKV------AMLNARVGLQFYERLFALDPDLRALFG---------EDVHPQAEKLVATLASAVRHLSNPAALEGSLRAMGERHRG-YGVRDEHYATVGEALLSTLETNLGPEVRGAWLALYGMVARMMR... 130
216 4.000e-35UniRef50_A0A0B4EVF2 Flavohemoglobin (Fragment) n=24 Tax=Hypocreales TaxID=5125 RepID=A0A0B4EVF2_METAN  ali  19  6.....TAEQIAIVKSTAPIIKQ------HGRAITDAFYTNLLSVHPELKNYFSLRNQQTG------AQQLALANAVFAYAAYIDDLAKLSEAVERIAQKHASLF-IQPEHYPIVGKFLVEAFVQILGEEIKDAWIAAYQQLADIFIQ.. 138
217 4.000e-35UniRef50_K8YWN8 Nitric oxide dioxygenase n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=K8YWN8_NANGC  ali  19  27....LSPHIVSVVKSTAPVL------AAQGPRITQVFYPLLFSRYPAVQELFNKRNQAPEPDGTPARQPQALANAVWAYAANIDNLSALSAAVSLIAHKHAS-LHVLPEHYPMVGECLLAAIAQVLGPEVAKAWEQAYGFLAAVFVQ.. 167
218 4.000e-35UniRef50_A0A2N6NCZ4 Flavohemoprotein n=11 Tax=Sordariomycetes TaxID=147550 RepID=A0A2N6NCZ4_BEABA  ali  20  42.....TQSQIDIVKSTAAILK------DQGDRITRIFYVNMLTAHPELKNYFSLRNQATG------AQQAALGASVLAYASYIDDLPRLTSAVERIAHKHASLF-VRPEQYAIVGEHLVEVLGDALTPEVADAWKAAYAQLADVFI... 173
219 4.000e-35UniRef50_UPI0008326626 hemin receptor n=1 Tax=Pseudoruegeria sabulilitoris TaxID=1510458 RepID=UPI0008326626  ali  22  1....MNQSQITLIQQSYAKL------VPSKQQAGEIFYAKLFEIAPEVRPLFK---------ENVTEQAGKLMTMLGTVVNGLRDLHKVTPIARKMAVEHVG-YGVKPAHYEPVGAALIATLEAGLGEETREAWVEAYSILSTAMIDA. 132
220 4.000e-35UniRef50_A0A090IE55 Flavohemoprotein n=19 Tax=Proteobacteria TaxID=1224 RepID=A0A090IE55_9GAMM  ali  15  2....LTQHTIDIIKATVPAVS------VHANDITAHFYPLMFREYPEVKRFFNQSNQSGN------AQPKALANALVAYAGNIENLSVLEAAVNRIINKHVS-LNIQPEQYEIVGECLLKSIKAVLGDEVIDAWGLAYWQLADLLIAA. 136
221 5.000e-35UniRef50_A0A1H0HXP3 Nitric oxide dioxygenase n=2 Tax=Bacillus TaxID=55087 RepID=A0A1H0HXP3_9BACI  ali  19  2....LTQDQISTIKATIPVLEE------HGVTVTTHFYKTLFEDYPQLLNLFNHVNQDTG------AQPKALAYSLYQAAVHIDRLEAILPVVHQIAHKHRSI-GVKEEHYPIVGEYLLKAMQEKLDDPIIEAWGATYEIVADVFIQ.. 135
222 5.000e-35UniRef50_V4PJ00 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=V4PJ00_9CAUL  ali  20  1....MTPAQIRLVQAS------HAEVVTLGATAAEVFYTHLFVLDPSLKPMFRS---------DLAAQGKKLLQALNFVATQLHQPERILPAVRELGLRHVA-YGVQPEHYVTVGAALIATLAQALGEATRQAWTEAYGLLSSTMIDA. 132
223 5.000e-35UniRef50_A0A2J0YT24 Nitric oxide dioxygenase (Fragment) n=1 Tax=Rhizobium meliloti TaxID=382 RepID=A0A2J0YT24_RHIML  ali  20  1...................................HFYKRMFQAHPELKNIFNMAHQERGE------QQQALARAVYAYAANIENPESLSAVLKDIAHKHAS-LGVRPEQYPIVGEHLLASIKEVLGDEIISAWAQAYGNLAD-ILAGM 110
224 5.000e-35UniRef50_A0A2D1U1Z3 NO-inducible flavohemoprotein n=1 Tax=Pedobacter ginsengisoli TaxID=363852 RepID=A0A2D1U1Z3_9SPHI  ali  13  1....MNIKQEQLISATVPVLRENGVL------LTTHFYNRMFTHNPELKNMFNMGNQESG------KQQTALAMAVLAYAENIANPGVLMPVVDRIGHKHVS-LDIRPEHYQIVGRHLIASIQEVLGPDILEAWTVAYQQLATLM.... 132
225 5.000e-35UniRef50_A0A0S7DZ55 Flavohemoprotein n=17 Tax=Aspergillus TaxID=5052 RepID=A0A0S7DZ55_9EURO  ali  16  166.......DTIQIIKATVPVL------TEHGTTITTVFYKNMLTAHPELNNVFNTAHQVSG------HQARALAGALFAYASNIDNLGALGPAVELICHKHASLY-IKPDDYKIVGKFLLEALGDALTPEILDAWATAYWQLADLMI... 295
226 5.000e-35UniRef50_K9SG59 Globin n=2 Tax=Cyanobacteria TaxID=1117 RepID=K9SG59_9CYAN  ali  17  5.........VKLLEDSFDRIK------PKARAFSASFYHNLFEMYPVAKPLF--------ANTDMIAQREKLIKSLVLVTSNLRSPDVLTETLAGLGSRHVE-YGALPEHYPLVGNALLATFEEAWTEEVKQAWVEAYAAITELMLEG. 132
227 5.000e-35UniRef50_D4XB67 Flavohemoprotein n=45 Tax=cellular organisms TaxID=131567 RepID=D4XB67_9BURK  ali  17  2....LSPEVRALVKATAPVLK------THGVALTRHFYARMFEHNPELKHVFNQGHQGGGQQQ------HALAGAVTAYAEHIDDPSVLAPVVTRIVHKHVS-LGIRAEHYAIVGKHLLASIREVLGDELVDAWAAAYGQLADLLIAE. 136
228 5.000e-35UniRef50_UPI000DAC7A24 hemin receptor n=1 Tax=Rhodobacteraceae bacterium DSL-40 TaxID=2219044 RepID=UPI000DAC7A24  ali  24  1....MTPDQIGLVKQSYYLI------APVSHQAAGLFYGRLFSVAPEVRPLFDRAN--------MFTQADKLWATLGKIVDVLDRPEALEPAAAKLAVSHL-HYGVMPEHYAPVGDALVWALEQGLGPEVRDAWTAAYDHISQAMISA. 133
229 5.000e-35UniRef50_A0A244CTZ1 Hemin receptor n=1 Tax=Pseudoalteromonas ulvae TaxID=107327 RepID=A0A244CTZ1_9GAMM  ali  16  1....MTPVQVELVQSSWEKVVPIAKQA------ADLFYGRLFELNPQLKRLFK---------DDIDEQGKKLMQILTTVVRGLKQFDRLEMAVWQLGRRH-QVYRIAPEDFNTVAEALLWTLEQAFTPDVKQAWVEAHTIVASVMQAGM 133
230 5.000e-35UniRef50_A0A2G1WCW5 Flavohemoprotein n=1 Tax=Rhodopirellula bahusiensis TaxID=2014065 RepID=A0A2G1WCW5_9PLAN  ali  17  2....LSENTIRVVKEITPVVAANAE------TITRRFYERMFEVNPEVKVFFNQSHQHTGG------QQKALAGAICAYFTHIDNPAVLLPAVELIAQKHCS-LGIKAEHYPIVGANLLAAIQDVMGDEIMDAVEEAYGFLADIFI... 134
231 6.000e-35UniRef50_A0A2G3K510 Hemin receptor n=1 Tax=Chitinimonas sp. BJB300 TaxID=1559339 RepID=A0A2G3K510_9BURK  ali  18  1....MNAETIKLTQESWKKVAAIAPQAA------ALFYENLFTADASLKPMFK---------GNMEEQGQKLMQMIGAAVSKLNNQETLIPILQALAKRHAG-YGVKPSHYQTVGAALIQTLEQGLGPAVKAAWVEVYGAMVGVMVSA. 132
232 6.000e-35UniRef50_A0A210PPW3 Neuroglobin n=3 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PPW3_MIZYE  ali  22  68...LLTNKQRYIIKKTWKVMCSNI------TGHGIKVFLRIFQLHPHVKQLFPCRDEDLLRDSNFKGHASRFMQAVGAAVENIDDIEALTPLLTGLGKQHIQFTGFKNEYFDAFTEAMMYALKGQFSGETSLAWATVFEFIMHKLKEG. 214
233 6.000e-35UniRef50_A0A139X0Z2 Globin domain protein n=1 Tax=Scytonema hofmannii PCC 7110 TaxID=128403 RepID=A0A139X0Z2_9CYAN  ali  19  683....MSMSKVDLVQSTFAKVQPIAD------TVAELFYQRLFELSPSLRPLFK---------GSMEDQQRKLMSTLAIAVEGLRQPQAIIKAVQQLGKRHAD-YGVMAQYYDVVGEALLWTLEEAFTPQVRRAWEEAYKFLSEIMKDA. 814
234 7.000e-35UniRef50_A0A0Q0CYB3 Flavohemoprotein n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0Q0CYB3_PSESS  ali  15  2....LSTAHRDIIKATVPILE------TGGEALTTHFYRIMLDEYPQVRPLFNQANQASG------AQPRALANAVLMYARNIDRLENLGPLAAQIVNKHVA-LQILPEHYPVVGACLLRAIREVLGDAVIDAWAAAYQQLADMLINA. 137
235 7.000e-35UniRef50_UPI000DCD8962 hemin receptor n=1 Tax=Chryseolinea sp. SDU1-6 TaxID=2059302 RepID=UPI000DCD8962  ali  19  1....MTERQILLVKNSWSYVIVKSEEA------GQLFYHRLFEIAPELKSLFKSEP---------KGQSRKLINMVTLMVSKLQKLDEIQGEIKSLATRHH-KYGVDPAYYRIVGAAFLWTLKDKWNEELEEAWVDMYAVISNAMIK.. 131
236 7.000e-35UniRef50_A0A235HP54 Globin n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A235HP54_9NOSO  ali  18  5.........VELLEQSFEKVKPRAD------EFAASFYNNLFQAHPEMKPLFAK--------TDMKNQEKKLLSSLVLVVENLRNPEALEPVLKALGARHVG-YGAIPKYYGLVVEALLVTLEQYWTPEVKKAWLDAFRAITGLMLKG. 132
237 7.000e-35UniRef50_Q575S8 Cytoglobin-2 n=7 Tax=Clupeocephala TaxID=186625 RepID=CYGB2_DANRE  ali  15  17..EPLTDVERGIIKDTWARVYASCED------VGVTILIRFFVNFPSAKQYFSQFQDEMEKSSQLRKHARRVMNAINTVVENLHDPEKVSSVLVLVGKAHAFKYKVEPIYFKILSGVILEILAEEFGPEVQTSWSKLMAALYWHITGA. 165
238 8.000e-35UniRef50_A0A1I6PAG7 Methyl-accepting chemotaxis protein n=73 Tax=Bacteria TaxID=2 RepID=A0A1I6PAG7_9RHIZ  ali  27  690.....SAAQVAIVQRSFATVQALGDTA------AELFYGRLFDIAPQVRSLFP---------DDMTAQKRKLVAMLALAVANLDKPEALVAAVRDLGDRHVG-YGALQAHFEAVGAALLWTLEQGLGPEVREAWTETYRVIAGLMT... 818
239 8.000e-35UniRef50_A0A2C6DL71 Flavohemoprotein n=349 Tax=cellular organisms TaxID=131567 RepID=A0A2C6DL71_9GAMM  ali  13  2....LDSQTIAIVKST------IPVLVETGPKLTGYFYERMFKHNPELKDIFNLSHQQSG------AQREALFGAICAYASNIENLSAILPAVERIAQKHASF-NIQPEQYNIVGHHLLATIDELLGTEVIEAWGKAYQVLANVFIQ.. 133
240 8.000e-35UniRef50_M2X487 Nitric oxide dioxygenase n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2X487_GALSU  ali  25  4..QTLNFEEIQIVQQSWNKLE------DRQYLIGEAFYHSLFETYPSVKPLFRS---------DMEKQKRLLIHMINKGVKLLNDIDKLESALSSLGKRHI-KYGVKEEHFPCVGETLLKVLKQFLGDEFDEAWESVYQYWAVFMLDGM 138
241 8.000e-35UniRef50_I0JWG1 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain n=1 Tax=Methylacidiphilum fumariolicum (strain SolV) TaxID=1156937 RepID=I  ali  21  1....MTQERIKLIQKSWLYVMDKADEA------GRLFYKRLFEVEPNVRSLFK---------ENIEKQGKKLIDVINWIVLNLQDIDTVFGGAKELARRHV-RYGVQVEHYPLVGHTLIWTLGKEWTKELEQAWTEAYEALSQVMIEE. 132
242 8.000e-35UniRef50_W0LFP8 Hemin receptor n=1 Tax=Chania multitudinisentens RB-25 TaxID=1441930 RepID=W0LFP8_9GAMM  ali  18  1....MSADRIKLIQESWKKVGPIADSA------AQIFYEKLFTLDPSLRSLFR---------TEAYVQRKKLIDILTLGVKGLENIERLIPTLQSLSLRHVN-YGVKEEYYDTVGAALIYTLKEEFTEEIKQAWVEFYALLSGVMKSA. 132
243 8.000e-35UniRef50_A0A022RUM2 Uncharacterized protein n=4 Tax=Erythranthe guttata TaxID=4155 RepID=A0A022RUM2_ERYGU  ali  18  68.....TEEQEALVTKSWNIMKKNA------SELGLKFFLRIFEIAPSAKKLFSFLNDSLELNPKLKPHAITVFVMTCESAVQLRKAGKVDSTLRDLGTTH-FKYGVADEHFEVTKYALLETIKEMWSPEMKCAWADAYDQLVAAIKLEM 214
244 9.000e-35UniRef50_UPI0003776242 hypothetical protein n=1 Tax=Methyloferula stellata TaxID=876270 RepID=UPI0003776242  ali  16  1....MTPAEVDMVKTTFVQILPQAD------EFGPKFYERLFSLDPTLKEMFK---------EDMAVQSKKLVRMLATLVAGLQSLETVVPTLEALAIRHVG-YGVRDEHYNVIGQSLIWTLEEAFTPEVRNAWIATYVLIAETMKAA. 132
245 9.000e-35UniRef50_A0A061DX38 Hemoglobin 1, GLB1,NSHB1,ATGLB1,HB1 n=4 Tax=malvids TaxID=91836 RepID=A0A061DX38_THECC  ali  18  87.....TEEQEALVVKSWNSMKKNA------GELGLKFFLRIFEIAPSAKKLFKFLRDSLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVESNLKDLGATH-FKYGVVDEHFEVTKFALLETIKEMWSTEMKNAWGEAYDQLAAAIKNEM 233
246 9.000e-35UniRef50_A0A177QZV1 Hemin receptor n=1 Tax=Betaproteobacteria bacterium SCGC AG-212-J23 TaxID=1799662 RepID=A0A177QZV1_9PROT  ali  21  1....MTPEQIDLVQRTWRAVLPVGDTA------AELFYGKLFSLDPEVRRLFKN---------DMVDQGRNLTAMISVAVGALAKPERIRLAVRQLGERHAA-YGVERRHFELVGVALIWTLEEAFTPDVKDAWRATYVFLTEAMLIG. 132
247 9.000e-35UniRef50_D3B1S6 Flavohemoglobin n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3B1S6_POLPP  ali  12  4....LDAKTIEIVKST------IPALAGTGSKLTQHFYARMLGNNPELKNVFNEANQRSN------AQSEALFGAVCAYAQNIDNLAPLLPAVEKIAQKHCS-LNIKPEQYSIVGENLLATIDELLAPEVIDAWAAAYGVLADIFIQ.. 135
248 9.000e-35UniRef50_V4A5G6 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4A5G6_LOTGI  ali  19  22....LTEKDKELVKSSWAKFNEGDVIAD-----GAHIYYKLFEKAPEAKEKFGFAKDGSLENKQFKAHVRKVLDVFESVVREIDQLEGLLPVLNDLGARHKS-YGVPLKYYEILGSCIMYAWDRKLDADTKKAWGKLYGVVQTEMKKG. 163
249 1.000e-34UniRef50_A0A0F4K3A3 Flavohemoprotein (Fragment) n=1 Tax=Streptomyces sp. NRRL S-444 TaxID=1609134 RepID=A0A0F4K3A3_9ACTN  ali  20  2........DARILKSSFAVVERRAEHAV------KYFYSHLFWHNPGIRELFPSSGE------DMERQRDRLFAALTHVVAHLDD-EGLLPYLHHLGRDHRKFL-ARPEHYAAVGSSLLAALAEAWTPGVEKAWSEAYQVIADAMMEG. 131
250 1.000e-34UniRef50_UPI000585BBB2 flavoprotein n=1 Tax=Nocardia cerradoensis TaxID=85688 RepID=UPI000585BBB2  ali  17  1....MDSRTVALIRTTFKAV---AAEDGGPEQLARSFYALLFTEYPQLRDFFP---------AALEVQRDRLVKAIGYAVDRLEEPEQLLPFLAQLGRDHR-KYGVVAEHYAAVGNSLKSALRELWTDEVEQAWDAGLGLISETMIGA. 136
251 1.000e-34UniRef50_UPI0009E48129 neuroglobin-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E48129  ali  27  8..DGLTDLQIEMIRSSWEKV------TPNKKHHGQLLFHKLFEIAPEMTDLFPFGDDFTK--PQFTTHALNIMNALDHAIQNLDNPDVLIPKLRELGQMHAGFLTIKE--FQHVGEALIWVLADDFTPQLRTAWGDVYAIITDVMLGAI 149
252 1.000e-34UniRef50_A0A0B6ANF3 Flavohemoprotein n=38 Tax=Bacillales TaxID=1385 RepID=A0A0B6ANF3_BACMB  ali  16  2....LDSKTIEIVQSTVPVLKE------HSKQIGKRFYELLFEKAPDLYNMFNQTNQKRGI------QQEALGYAVYAAGEHITNLEAIKPVIERISQKHRAI-GVKAEQYPVVGETLLQAVKDVLGDEIIEAWGKAYGYIANAFIE.. 135
253 1.000e-34UniRef50_L0G369 Hemoglobin-like flavoprotein n=1 Tax=Echinicola vietnamensis (strain DSM 17526 / LMG 23754 / KMM 6221) TaxID=926556 RepID=L0G369_ECHV  ali  18  3.....SKSTIEIVKSTAPVLKE------YGEQITKVFYKKLFETHPDLRNLFNMTNQVKGTQPKV------LANAIIQYATYIETPEVLLQAVNSIAHKH-SSLSITPEMYPIVGETLLWAIKEVLGPDIIGAWAEAYGELAEIFIA.. 135
254 1.000e-34UniRef50_UPI000B795192 plastid division protein PDV2-like isoform X2 n=1 Tax=Hevea brasiliensis TaxID=3981 RepID=UPI000B795192  ali  18  384.....TEEQEALVVKSWNSMKKNS------GELGLKFFIKIFEIAPSAKKLFSFLNDSLEQNPKLKPHAVTVFVMTCESAVQLRKAGKVESSLKDLGATH-FKYGVVDEHFEVTKYALLETIKEMWSPEMKNAWAEAYDQLAAAIKIEM 530
255 1.000e-34UniRef50_A0A1Z4ISC4 Uncharacterized protein n=4 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4ISC4_9CYAN  ali  18  1....MSSLNVKLLEKSFAGIK------PYATQFASRFYYNLFTDNPQLEPLF--------ANTNMQEQDKKLMMTLVLVIYNLRNFAYLKTILRDLGERHV-RYATIEEHYPMVGTALLKTLGTDWTPEVKQAWTDAYAEIVNIMLEG. 133
256 1.000e-34UniRef50_A0A1C3SHN7 Flavohemoprotein n=35 Tax=Bacilli TaxID=91061 RepID=A0A1C3SHN7_9BACI  ali  20  2....LDKETIQIVKSTAPILKE------HSQEIGKRFYELLFSKVPELHNMFNQTNQKRGI------QQEALAYAVYAAGENIDHLEALEPVIKRITEKHRAI-GVKPEQYPIVGETLLAAVKDVLGDEVLEAWKKAYGEIAKAFI... 134
257 1.000e-34UniRef50_Q7NSD8 Flavohemoprotein n=59 Tax=Bacteria TaxID=2 RepID=HMP_CHRVO  ali  17  2....LSEQTRSLVKATVPVLQQ------HGVALTSHFYRRMFEHNPELKNVFNQGHQHSGQQQ------QALAMAVLAYARHIDDPSPLLPVLTRVAHKHVS-LGIRAEHYPIVGKHLLASIRELLGDDLIQAWAEAYGLLADTLI... 134
258 1.000e-34UniRef50_D2AQM5 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductase-like protein n=4 Tax=Streptosporangium TaxID=2000 RepID=D2AQM5_S  ali  19  4........DIGLIRRSWSLVEPVADQ------VTQHFYGRLFANYPHIREMFP---------PAMDLQRDRLLHALTQVVLNLEDGAGLNDYLGQLARDHR-KYGVQPEHYPAVGSCLVAAMRGAWLPAYDEAWMTAYNYIAEVMIQA. 131
259 1.000e-34UniRef50_P04252 Bacterial hemoglobin n=146 Tax=Bacteria TaxID=2 RepID=BAHG_VITST  ali  22  2....LDQQTINIIKATVPVLKE------HGVTITTTFYKNLFAKHPEVRPLFDMGRQESLEQPK------ALAMTVLAAAQNIENLPAILPAVKKIAVKHCQA-GVAAAHYPIVGQELLGAIKEVLGDDILDAWGKAYGVIADVFIQ.. 135
260 2.000e-34UniRef50_A0A0N0MML0 Nitric oxide dioxygenase n=28 Tax=Actinobacteria TaxID=201174 RepID=A0A0N0MML0_9ACTN  ali  18  30...........LIRRTLEEIGPVAD------RVTSYFYALVFTGHPEVRGMFP---------AAMDAQRDRLLKALLTAAEHIDNPDVLVPYLRRLGSGHR-KYGTMAGHYPVVGEALISALARYWGPETQAAWVRAYTAMSQIMIDA. 154
261 2.000e-34UniRef50_UPI000CF1EB88 hypothetical protein n=3 Tax=Streptomycetaceae TaxID=2062 RepID=UPI000CF1EB88  ali  18  72...........LIKSSYGVVE------PHGTEVTAWFYRHLFEHNPGVRSLF---------AAHLDEQQDRLWAAIGALVTHLEDPDALLPLLRGLGERHAA-YGALPAHLPAVGASLLATLAHAWTPETERAWTAVYGVAAETIGAAM 197
262 2.000e-34UniRef50_V4SH90 Uncharacterized protein n=6 Tax=Spermatophyta TaxID=58024 RepID=V4SH90_9ROSI  ali  15  72.....TEEQEALVVKSWNAMKKNS------GELALKFFLRIFEIAPSAKKLFTFLKDSDEQNPKLKPHATTVFVMTCESAVQLRKAGKVESNLKDLGATH-FKYGVLDEHFEVTKYALLETIKEMWSPEMKNSWAEAYDQLAAAIKTEM 218
263 2.000e-34UniRef50_A9AW41 Globin n=1 Tax=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) TaxID=316274 RepID=A9AW41_HERA2  ali  21  2.............QQTFAEVGRNPQQ------LVEAFYGQLFMLAPDFRPLFP---------EDMSEQKKKLLQSLVLVVNNLKKPEAVLPAVQELGRRHVD-YGVKPEHYQTVGAALIWALGEQWNDEVQAAWVAAYTLVANVMVEA. 124
264 2.000e-34UniRef50_H8Z1I5 Hemoglobin-like flavoprotein n=2 Tax=Chromatiaceae TaxID=1046 RepID=H8Z1I5_9GAMM  ali  20  1....MTSDDIALVRTSWAQLQPQAEQ------VGAALYQRMFNDHPELRRLFK---------GEMDEQAHKLMRMVNRTVDTLDDLTSLNRVIIMMGARH-SGYGVEDEDYPKMRNALVATLGSEFTPETRSAWISVYGELAELMMEG. 132
265 2.000e-34UniRef50_UPI000B3EFDEE non-symbiotic hemoglobin 1-like n=1 Tax=Herrania umbratica TaxID=108875 RepID=UPI000B3EFDEE  ali  18  87.....TEEQEALVVKSWNSMKKNA------GELGLKFFLRIFEIAPSAKKLFKFLRDSLEQNPKLKPHAVTVFVMTCESAVQLRKAGKVESNLKDLGATH-FKYGVVDEHFEVTKFALLETIKEMWSTEMKNAWGEAYDQLAAAIKNEM 233
266 2.000e-34UniRef50_A0A1Z4RR64 Putative globin-like protein n=1 Tax=Chondrocystis sp. NIES-4102 TaxID=2005460 RepID=A0A1Z4RR64_9CHRO  ali  19  113.KQQISHQSVEIVKSTAPVLKQ------HGKTITTRMYEIMFNQYPEVKTQFDQSAQANGSQPA------KLANAVYSYATHIDDLEALKAMVDKIAHRHVDSH-VLPQQYPIVGECLLQAIKDVLTPEVMQAWTEAYQLLAEVFI... 248
267 2.000e-34UniRef50_I3CJ89 Hemoglobin-like flavoprotein n=2 Tax=Beggiatoa TaxID=1021 RepID=I3CJ89_9GAMM  ali  20  2....LKASDIQLVCRSWEKLSPNI---PEGIILGQKFYKNLFTLDPSLKTLFK---------GDLTEQSIHFMHIMDTIVNAIDKVDDLSDVVARLGVRHVG-YGVQEADYAVFGKALLQTLADAFTPELKQAWENTYNTLAELMKKG. 136
268 2.000e-34UniRef50_UPI000C6D695A neuroglobin-like n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6D695A  ali  23  46....LTPQQIQLVRSTWSIVSQDM------VGVGTIVFQRFLTRHPELCKMFRKFMTLDWDLEELQRHALLVMQALEAAIDNLDDSRVLAGILYDLGRRHA-RYNVQEQMFDKLWEALEKSLQNRMTREVNQAWFAVFKYISWQVIKGM 193
269 2.000e-34UniRef50_A0A0H4KKN4 Flavohemoprotein n=21 Tax=Bacteria TaxID=2 RepID=A0A0H4KKN4_9BACI  ali  16  2....LDPKTIEIVQSTVPVLKE------HSKEIGKRFYELLFAKEPDLYNMFNQTNQKRGI------QQEALGYAVYAAGEHITNLEAIKPVIERISQKHRAI-GVKAEQYPVVGETLLQAVKDVLGDEIIEAWGKAYGYIADAFI... 134
270 2.000e-34UniRef50_R7QRC5 Uncharacterized protein n=2 Tax=Rhodymeniophycidae TaxID=2045261 RepID=R7QRC5_CHOCR  ali  17  7.....TPETIAIVKSTVPILRENL------TEVITRFYENLFSTYPELKKQFNMDRHRGGTVKEIPKQVAALGGAVISYAKNIDRVEALLPVVERISHKHVSR-GVSAAQYDKIGECLLRAMKDILTEDIHNAWAEAYGFLASVFI... 147
271 2.000e-34UniRef50_G8SE21 Flavohemoprotein n=146 Tax=Actinobacteria TaxID=201174 RepID=G8SE21_ACTS5  ali  18  6..........RLLKESWSLVEE------HQDKVAGYFYARMFLSYPDLRDLFPV---------QMDVQRTRLLHAIVTAVQTLEDPERFEDYLRSLGRDHR-KFHVLPEHYEVVGGALIESMREQWGVEYDQAWADAYAVIAAKMLAG. 131
272 2.000e-34UniRef50_I3K2H7 X globin n=36 Tax=Percomorphaceae TaxID=1489872 RepID=I3K2H7_ORENI  ali  16  30.....NEDQIQMIKDSWKVIRDDIAK------VGIIMFVRLFETHPECKDVFFLFRDRLRTSRELRAHGLRVMSFIEKSVARLDQLDRLEALALELGKSHY-HYNAPPKYYSYVGAEFICALKERWTAELEEAWKTMFQFVTSLMNQG. 174
273 2.000e-34UniRef50_A0A0A1Z321 Flavohemoprotein n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A0A1Z321_PSEFL  ali  17  3.....TSQQRALVKATVPLLE------TGGEALTRHFYAMMLSEYPEVRPLFNQAHQASGD------QQRALANGILMYAKHLDHLEALGPLAGKIVNKHVS-LQILPEHYPIVGTCLLRAIREVLGDEVLEAWGVAYGILADLLINA. 137
274 2.000e-34UniRef50_B3DUZ1 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain n=3 Tax=Methylacidiphilum TaxID=511745 RepID=B3DUZ1_METI4  ali  20  1....MTREEIKMIQKSWLRVIDKMDEA------GLLFYRRLFDVEPKVRPLFKI---------DIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHV-KYGVKAEHYPVVGHTLIWTLRKMWTKQLEQLWTQAYEALAQVMIEE. 132
275 2.000e-34UniRef50_K1QF07 Neuroglobin n=5 Tax=Crassostrea TaxID=6564 RepID=K1QF07_CRAGI  ali  22  7.....SEDEKRLVKDSWNLFVSRGDFSDT----GSHMYKVLLQDNPHLKTLFSFVNGAPFDSPMFKSHVRNVFTVIGDAVNHIDDLDSLSPILKDLGVKHQG-YGAKKEYLEPVGNALLCTLEDDFTQEVHSAWRTFFAVMSYSFAQGL 151
276 2.000e-34UniRef50_Q760Q2 Extracellular globin n=2 Tax=Hirudiniformes TaxID=6416 RepID=Q760Q2_MACDE  ali  37  21....CQDLHAIKVQTQWKDAYGESSD---RVALAQAVYRTLFKLAPESAAFFHRVNGEHPDSSEFVAFSLRVLNGLDIVITLLDQKEALHAQLEHLHHQHIDRH-VPPKYAAAFVESLHHVLPAVIGCYDEVAWTKCLGNIAKKILA.. 160
277 3.000e-34UniRef50_A0A0H5C9N6 Uncharacterized protein n=2 Tax=Cyberlindnera jadinii TaxID=4903 RepID=A0A0H5C9N6_CYBJA  ali  19  35...HFTAQEIEMVRSSWKEMKEGNQSSFASSLFCIQFYSNLMAMEPELEKMFPS----------IKHQAMSFSGVLSTAIINLDHLDKLDDYLNNLGKRHARILGIDPPHFELMGAAFLKTVQDRFGHSLTLAWARLYTYLANSILQG. 179
278 3.000e-34UniRef50_A0A1W6B9V0 Nitric oxide dioxygenase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1W6B9V0_9GAMM  ali  19  2....LSERQKELVKATVPVLKENGE------ALTDYFYKRMLKNNPHLKETFNMGHQRSG------AQAKALAGAVLAYAENIDDPSVLMPVVELICHKHVS-LNIQAPDYNIVGENLLHSISEVLDDELIAAWGVAYQQLADIFIA.. 135
279 3.000e-34UniRef50_I8IYL2 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=2 Tax=Fictibacillus TaxID=1329200 RepID=I8IYL2_9BACI  ali  15  2....LTQETMKVIKATAPVLQE------HGVAITTVFYEELFREHPELRNVFNQSNQAQGR------QQVALAQILYQAALHIEQLETLLPAVRQVGEKHRS-LGVVPEHYPIVGKHLLAVLKEAATDEILEAWETAYEVIASLFIE.. 135
280 3.000e-34UniRef50_UPI0009FE0A5D hypothetical protein n=1 Tax=Algiphilus aromaticivorans TaxID=382454 RepID=UPI0009FE0A5D  ali  17  28.....TPRETRLIRESWRNIARDRD------AIVVTFYDLLFRWKPELRGYF---------SEDMSEQRRMMAVTLNLAVSHIDRIETIRESVRDLGRRHA-RYGARASYYDLVVEALVRAISQHFGPRVEAAWRRAFALIAEEMLAG. 159
281 3.000e-34UniRef50_A0A164IVT5 Flavoprotein n=17 Tax=Nocardiaceae TaxID=85025 RepID=A0A164IVT5_9NOCA  ali  16  1....MDSRTVALIRTTFKAV---AAEDGGPEKLARSFYAILFTEHPFVRDFFP---------AALDSQRDRLVKAIAYVVDRLEEPDQLLPFLAQLGRDHR-KYGVSTEHYAAVGKSLHAALRELWTDEVERAWNEAIGVIAETMMRA. 136
282 3.000e-34UniRef50_A0A100JLH0 Ferredoxin--NAD(P) (+) reductase (Naphthalene dioxygenase ferredoxin-specific) n=43 Tax=Streptomycetaceae TaxID=2062 RepID=A0A100  ali  20  116........DAVLIRRTMAEVGPVADK------VTSYFYALLFVQHPDLRSMFP---------PAMDAQRDRLLKALLTAAEHIDNTLVLVDYLQNLGRGHR-KYGTQADHYPAVGECLIGALKASWNDETEAAWVRTYTTISQVMIDA. 243
283 3.000e-34UniRef50_A0A0X7JRV9 Uncharacterized protein (Fragment) n=113 Tax=Actinobacteria TaxID=201174 RepID=A0A0X7JRV9_9ACTN  ali  20  42......SADAVIIRRTLDEIEPMADK------VTSYFYALLFVRHPDLRALFP---------AAMDTQRDRLFKALLTSVKNVDDTAYLTEYLSHLGRGHR-KYGTLPEHYPAVGECLITALARTWGPESEAAWVRAYTKISQIMIDA. 171
284 3.000e-34UniRef50_P24232 Flavohemoprotein n=2080 Tax=root TaxID=1 RepID=HMP_ECOLI  ali  13  2....LDAQTIATVKATIPLL------VETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGD------QREALFNAIAAYASNIENLPALLPAVEKIAQKHTSF-QIKPEQYNIVGEHLLATLDEMFSPEVLDAWGKAYGVLANVFI... 132
285 3.000e-34UniRef50_UPI00034B7A69 hypothetical protein n=1 Tax=Prochlorothrix hollandica TaxID=1223 RepID=UPI00034B7A69  ali  20  4........QVELLEQSFEKVK------PQATEFVDRFYENLFADYPAAKPLF--------EHTNMAKQKTMLLNSLVLVVDNLRSPDVLSDALKGMGARHVN-YGALPAHYPLVGNSLIKTLGDGWTSDYEAAWAGAYDVITDLMLQG. 132
286 3.000e-34UniRef50_F1A2R8 Uncharacterized protein n=6 Tax=cellular organisms TaxID=131567 RepID=F1A2R8_DICPU  ali  17  2....LSPKTVQVIKSTVPVLEQ------YGVQITSTFYKNMFAAHPELLNIFNHSNQREG------KQQTALANTVYAAALHIDKLPEILPAVKQIAHKHRA-LGIVPAQYDIVGANLLGAIKQVLGDEIIGAWAEAYGVIAKVFID.. 135
287 3.000e-34UniRef50_A0A2E0L7P3 Hemin receptor n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0L7P3_9CHLR  ali  19  4.....TQIQIRLVRRSF------GRAATKKRLIAALFYDRLFELDPALRPMFK---------GDMEEQGRKFMRMLALIVSHLDNPDQLKTKLQSSNQRHTTI-GVRPEHYETVGAALLWALEKEFTPAMREAWLTAYEIIAQL..... 130
288 3.000e-34UniRef50_A0A285EXK6 Ferredoxin-NADP reductase n=4 Tax=Micromonosporaceae TaxID=28056 RepID=A0A285EXK6_9ACTN  ali  20  1...........MLKESWSLIEE------HQEKVAGYFYARMFLSHPELRDLFPV---------HMDMQRSRLLGAIVTAVQTLEDPEKFDSYLRGLGRDHR-KFHVEPEHYEVVGGALIEAMRESWSVEYDQAWADAYAVIASKMLSG. 125
289 3.000e-34UniRef50_A0A060T0W4 ARAD1C11660p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T0W4_BLAAD  ali  18  1..MSLTKDQVDIIKATVPVLE------TRGEEITKYFYSKMLSENPDVSNFFNKTHQASFAQPRALAH------SLLAYAHNIDNLDALSGLVERVAQKHCS-LMVQPEHYPIVGKYLLIALSDVLGEAVLEAWGAAYQALANILIEA. 138
290 4.000e-34UniRef50_A0A254TKT7 Sugar (And other) transporter family protein n=1 Tax=Aspergillus niger TaxID=5061 RepID=A0A254TKT7_ASPNG  ali  17  45...PLTPEQIKIIKATVPVLQE------YGTKITTAFYKNMLTAHPELNAVFNTANQVNG------HQARALAGALFAYASHIDDLGALGPAVELICNKHASLY-IQADEYKIVGKYLLEAMKEVLGDDILDAWGAAYWALADIMI... 178
291 4.000e-34UniRef50_UPI000D55BCBB hemin receptor n=3 Tax=Sphingorhabdus TaxID=1434046 RepID=UPI000D55BCBB  ali  22  8.ENFLTVAEIDIVRRSF------LNLGDENARAGELFYQQLFDDKPELKSLF---------LSDISVQSEKLTNMLGMIVSQIHNMPELLPMLADLARRHLG-YGVEAEHYRDVGDALISTIRDVFGPDVEAAWTKAYEGIALTMIQ.. 141
292 4.000e-34UniRef50_A0A285U7Z8 Nitric oxide dioxygenase n=1 Tax=Salinicoccus kekensis TaxID=714307 RepID=A0A285U7Z8_9STAP  ali  19  3......PHKKEIIKATVPALEE------HGTTITTVFYQNMFKKHPDLLNMFNQTNQKVGDQPK------ALAFTVLQAARHIDDLEAIVPAVIGIAHKHRA-LNVKPEHYPIVGENLLEGIKEVLGPEIMDAWEEYYGEIAQIFID.. 134
293 4.000e-34UniRef50_A0A1L6LXQ4 Putative bacterial hemeoglobin n=1 Tax=Minicystis rosea TaxID=888845 RepID=A0A1L6LXQ4_9DELT  ali  17  20..........ALLRVSFQRLLPMADL------VAELFYGRLFLLDPSLRALFR---------GDMKSQGRKLMSVLQVAVNNVDRVETILPVVQGLGRRHVG-YGVRDEHYETVRSALIWTLQDDLTPATAAAWADMYDMIASVMRGA. 145
294 4.000e-34UniRef50_A0A0L0K1T6 Flavohemoprotein n=26 Tax=Streptomyces TaxID=1883 RepID=A0A0L0K1T6_9ACTN  ali  21  2.......................AAIGEVSDKVTSYFYALLFVRHPDLRPLFP---------PAMDAQRDRLLKALLTAAEHVDNTPVLVEYLQNLGRGHR-KYGTRPEHYPAVGECLIGALAKVWNPETEAAWVRTYTTISQVMIDA. 120
295 4.000e-34UniRef50_A0A1W1USN6 Hemoglobin-like flavoprotein n=6 Tax=Bacteria TaxID=2 RepID=A0A1W1USN6_9DEIO  ali  22  1....MTDDQIQLVQHSFTFIETQAEF------VAARFYERLFALDPALKALFR---------GDLAEQGRKLMSALRLVVRGLDHLPPLLPAVRELGARHASF-GVQHTHYALVGTALLGTLNEVLGDETREAWLEAYETLATVM.... 129
296 4.000e-34UniRef50_A0A2T7NZ43 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NZ43_POMCA  ali  16  63NRPKLTEEEKRILTESWEIIVHDVEK------IGVVTFFGLFETHPDVQDIFIPFKGDLWTSTDLKSHVLRVMGTVEKCLARIHEPAKMESILHELGVKHL-LLNIRVEYLDLIGPQFIKAMGDLWTPEVESAWANLFRLITHIMKEAM 212
297 4.000e-34UniRef50_A0A1Z4SE05 Putative globin-like protein n=3 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4SE05_9NOSO  ali  18  3.....SQQTIDIVKSTAPVLKKN------GQQITTRMYEIMFQNHPEVKEQFDMSAQANGSQPA------KLASAVYSYATQIDNLPALKSMVEKIAHRHVDTH-VLPEQYPIVGESLLQAIKDVLGEEVMAAWTEAYQALSEVFI... 134
298 4.000e-34UniRef50_A0A061H6I6 Uncharacterized protein n=1 Tax=Anthracocystis flocculosa PF-1 TaxID=1277687 RepID=A0A061H6I6_9BASI  ali  17  1..MSLTSQQVAIIQATVPVLKQ------HGEHITTTFYRHLLEENPALKNVFGMTNMLTGRQPKALAHG------LLAYASHITEPAVLADFVEKVSHKHAS-LGVEPAQYAVVGKYLLAAMAEVLGPDVHDAWAAAYWILANIMIE.. 137
299 4.000e-34UniRef50_C7PYV8 Oxidoreductase FAD/NAD(P)-binding domain protein n=3 Tax=Catenulisporales TaxID=414714 RepID=C7PYV8_CATAD  ali  18  4..........HLLRTSWAKVAQYGEQVPLF------FYGHLFLSHPEVRAMFP---------PSMAAQRDRLVAALGAVVANVDNLDSAVPFLQGLGRDHR-KFAVEPGHYPAVGASLLATLEQDWTPAVAESWTEAYGIVAKVMTDA. 129
300 4.000e-34UniRef50_K9T9X7 Hemoglobin-like flavoprotein n=2 Tax=Pleurocapsales TaxID=52604 RepID=K9T9X7_9CYAN  ali  17  6..........DVLEKSFNLVE------PRANEFAASFYETLFTDSPEAKPLF--------ANTDMEKQQQKLIMSLVYVVTNLRYPEELTKVLREMGEKHAT-YGAKAEHYPIVGAALLKTLEAYWTPEVKQAWTDAYEEISYLMLEG. 132
301 4.000e-34UniRef50_Q760P9 Extracellular globin n=2 Tax=Hirudiniformes TaxID=6416 RepID=Q760P9_MACDE  ali  42  20.DEECSSADGHKVLEDWTHLWEDSDAS-FKVEFAKSVLLKLIEKHPEAKALFHEVGVEDPSSGEFEAHVLRIFNSLDLLITLLPNREGLKAASEHLGQQHAVRHGVVGTHFKTFLSVLLDSLDHLLDDFHLFAWKSCLKTLTKGI.... 162
302 5.000e-34UniRef50_A0A2H5B1V1 Uncharacterized protein n=2 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2H5B1V1_9ACTN  ali  18  7...........LIKSSYGVVE------PHGTEVTAWFYRHLFEHNPGVRSLF---------AAHLDEQQDRLWAAIGALVTHLEDPDALLPLLRGLGERHAA-YGALPAHLPAVGASLLATLAHAWTPETERAWTAVYGVAAETIGAAM 132
303 5.000e-34UniRef50_UPI0009E63069 neuroglobin-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E63069  ali  20  26NANSLSEETKNVLRESWKLVE------PLKTVAGKKMFERMFGSHPEVIYLFPIFKGEILCSRALHLHVKKVMSALENAVLSLNDAEKLTHYLINLGERHRP-WSVRMEHFDLLKESLLWTLQDMLTPGVSRAWSEMIDLVAEAMMQGL 175
304 5.000e-34UniRef50_I0IMI4 Putative flavohemoprotein n=31 Tax=root TaxID=1 RepID=I0IMI4_LEPFC  ali  16  6..........DLIKASAQLI------APLGSKVTEYFYNTMFTDHPEVRKMFP---------AEMGVQAQRLFDSIVYITSNIDKPDALVPYLQRLGSGHI-KFDTRPEHYPIVGNSLMKTLAHAWTKEMAEAWSEAYNLAASVMIEA. 131
305 5.000e-34UniRef50_A0A1L6LK91 Adenylate cyclase n=1 Tax=Minicystis rosea TaxID=888845 RepID=A0A1L6LK91_9DELT  ali  20  351......ADDVREVTASFARIAPRSDD------LAARMYERLFERHPHLRRLFP---------TDMTAQRRKLVGSLVVIVDNLRRSDRLFPLLEDLGRRHAA-YGVKVEHFEAVGQALLGAIAEQLDQKARAAWENAYASIASAMRRGL 480
306 5.000e-34UniRef50_A0A1E3PJ88 Nitric oxide dioxygenase n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PJ88_9ASCO  ali  15  1..MSLTSTQTEIIKSSVPFLEEKGD------ELAKHMYDLMFEKYPEVRPLFNKVHQKNFTQPKI------LAFALLAYAKNIDNISVLGAFVNQIVSKHVG-LQILPEHYPIVAECIIQAIKDLLGDDLIEAWTVAYTDLAGILIGA. 137
307 5.000e-34UniRef50_A0A2T5GUY2 Hemoglobin-like flavoprotein n=4 Tax=Sphingomonas TaxID=13687 RepID=A0A2T5GUY2_9SPHN  ali  17  1....MDSRQINLVQDSFIHVLPIPD------AVAAAFYARLFQLAPDTRPLFR---------GDMVEQGRKLVLTLASVVDSLDRLDELLPVARELAIRHVG-YGVLDRHYAVVGAALLDTLAVQLGDATHDAWAAAYTILADAMIEA. 132
308 5.000e-34UniRef50_A0A2N9BB92 Naphthalene 1,2-dioxygenase system ferredoxin-NAD(+) reductase component n=127 Tax=Actinobacteria TaxID=201174 RepID=A0A2N9BB92_S  ali  20  165....................RAMAEITPVADKVTSYFYALLFVRHPDLRSLFP---------AAMDTQRDRLLRALLTAAEHIDNTDVLVDYLQNLGRGHR-KYGTRAEHYPAVGECLIGALSKVWDAEMEAAWVRTYTTISQVMIDA. 286
309 5.000e-34UniRef50_A0A1V9ZMC5 Nitric oxide dioxygenase (Pi-NOD1) n=5 Tax=Saprolegniaceae TaxID=4764 RepID=A0A1V9ZMC5_9STRA  ali  13  26....LSAKTIDIIKATSPVV------AEHGYAITTTMYGTMLTSDASVRALFNPSHQKVLPGENQARQPSALAHAVSAYAANIDNLGVLTAAVERIAQKHVSLY-ILPEHYDIVGSHLLRAIKTVLGPEIVQAWAEAYGFLAEILIE.. 165
310 5.000e-34UniRef50_A0A1H0PYW0 NAD(P)H-flavin reductase n=6 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A1H0PYW0_9PSEU  ali  17  27.........VRLVRESFAVVE------PHAEEVAQFFYGMLFTIEPSAREMFP---------ANMQVQRSRLLRALVHVVQMVDRPDDLVPFLQQLGRDHR-KFGVVSTHYEAVGMALISSVKKAWTDEVERAWAEAYTIMARSMLDA. 153
311 6.000e-34UniRef50_A0A0F7D450 Flavohemoprotein n=24 Tax=Staphylococcaceae TaxID=90964 RepID=A0A0F7D450_9STAP  ali  18  7.........KQIIKETVPVLEE------HGTEITTVFYKRMFEAHPELLDIFNKTNQKVGDQPK------ALAMTVLAAARHIEDIETIVPAVMGIAHKHRA-LDVKPEHYPIVGKYLLEGIREVLGPEIIDAWGEYYGKIADVFI... 134
312 6.000e-34UniRef50_A0A177HLN4 Flavohemoprotein n=36 Tax=Streptomyces TaxID=1883 RepID=A0A177HLN4_9ACTN  ali  22  2.......................AEVGPVADKVTSYFYALLFVRHPELRSLFP---------AAMDTQRDRLLKALLTAAEHIDNTDVLVAYLQNLGRGHR-KYGTRPEHYPAVGECLIAALTRTWDDETEAAWVRTYTTISQVMIDA. 120
313 6.000e-34UniRef50_A0A1A9HJM4 Dihydropteridine reductase n=2 Tax=Mitsuaria TaxID=65047 RepID=A0A1A9HJM4_9BURK  ali  17  4......PQTIALIQATVPLLKSRGED------ITRHFYRAMLTGHPELKAFFNEAHQAEGT------QARALAGAVLAYASHIDRIHEIAPALPRIIQKHVA-LGVQPEHYPIVGACLLAAIREVLGDEIIAAWAEAYGALAQLLIDA. 137
314 6.000e-34UniRef50_A0A2P9HXX3 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=12 Tax=Actinobacteria TaxID=201174 RepI  ali  20  23..........RLVKESFSVVEPMADKA------TAYFYGRLFAENPHLRGMFP---------PAMDVQRDRLFGALTRIVWSLDSPDSLAAFLGQLGRDHR-KYGVIAEHYTAVGNALLATIRDVWNHEIEAAWVSAYTAAANLMIE.. 147
315 6.000e-34UniRef50_UPI000DD441CC hemin receptor n=1 Tax=Piscinibacter caeni TaxID=1861917 RepID=UPI000DD441CC  ali  21  1....MTPQQTQLIRAS------HARLAPHADRAGQLFYRKLFALAPDLQPLF---------IGDIRQQATRLMQMIGAAVGLLDRPAQLVPVLQHLGARHAG-YGVQARDYHAVGLALLETLAEQLGAETRAAWSAMYALVSATMIAA. 132
316 7.000e-34UniRef50_A0A1I6VYH6 Hemoglobin-like flavoprotein n=1 Tax=Yangia pacifica TaxID=311180 RepID=A0A1I6VYH6_9RHOB  ali  16  3....LTPQNISDIRASWQVLAADAD------GFTADFYAALFRRDPGLRPLFAH--------TDLPAQRKKLVAALALVVRHADDLSPVLGPLEEMGARHVG-YGVKNSDYATVGGALIETMEEAFSSEIREAWTAAYGAVASTMMAG. 135
317 7.000e-34UniRef50_A0A1A8T8H1 Flavohemoprotein n=16 Tax=Bacteria TaxID=2 RepID=A0A1A8T8H1_9GAMM  ali  14  2....LSQTHIDTVKAT------IPVLASAGTAITEHFYNRMFTHNPELKDVFNMSHQATGRQPA------ALFNAIAAYATHIDNLEVLTGAVMRIAHKHTSF-NIQADQYAIVGHHLIETLREAFTPAIEEAWGAAYQQLADIFIK.. 135
318 7.000e-34UniRef50_UPI000C03C159 cytoglobin-2-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C03C159  ali  16  28...PLTDEQIKILKETWGIIE------PTKKEIGVNVYIRFLKMNPDIKSRFTEFKESIEEINKNNGHPRRLMAAIENSICSLYDPETFAGYVLELGRRHV-RLRFKPSHFIDLRKAFISTIKEFLTPEVEESWVLLFDFMAAVMMKG. 172
319 7.000e-34UniRef50_A0A1E3PPV8 Globin-like protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PPV8_9ASCO  ali  23  1....MNAAEIVILKSSWQELYSNSATTL----FIEQFYDNLISQNPDILILFPS----------IRRQSVAFAGVLSLAISSLDNIEVLDDYLVRLGKRHGRIIGVDVSHFEMVGNALLDTLRDKLGDELESAWIRLYSYLANKLLDA. 134
320 7.000e-34UniRef50_A0A2I4BLA0 neuroglobin isoform X1 n=10 Tax=Euteleostomi TaxID=117571 RepID=A0A2I4BLA0_9TELE  ali  24  47..GELSVKDKELIRDSWESLGKN------KVPHGVIMFTRLFELDPELPSLFNYSKQDCLSSPEFLDHVTKVMLVIDAAISHLDDLHSLEEFLVNLGKKHQAV-GVSTQSFAVLGEALLFMLQCSLGQAYRQAWLNMYSIVVATMSRG. 194
321 7.000e-34UniRef50_A0A1R3HY75 Globin n=1 Tax=Corchorus capsularis TaxID=210143 RepID=A0A1R3HY75_COCAP  ali  17  989.....TEEQEALVVKSWNSMKKNSA------ELGLKFFLRIFEIAPSAKKLFTFLKDSDEQNPKLKPHAMTVFVMTCESAIQLRKAGKVESSLKDLGATH-FKYGVVDEHFEVTKFALLETIKEMWSPEMKNAWGEAYDQLAAAIKTEM 1135
322 7.000e-34UniRef50_K9VX73 Globin n=8 Tax=Cyanobacteria TaxID=1117 RepID=K9VX73_9CYAN  ali  21  5.........VELLEQSFEKIK------PHADEFAASFYENLFQLYPEVQPLF--------ANTEMAKQQKKLLNALVLVVENLRSPEALEPVLKVLGERHIG-YGAIANSYPAVGEALITTLQQDWTTEVKQAWIDAYGAITALMLKG. 132
323 7.000e-34UniRef50_F5UFD7 Globin n=6 Tax=Cyanobacteria TaxID=1117 RepID=F5UFD7_9CYAN  ali  20  174.........VEILESSFEKVKPRAD------EFAASFYENLFIAHPEFKPLF--------ANIELEKQQKKLINALVLVVENLRSPEALGPVLNALGGRHIG-YGVIPKYYGPVGDALLQSLQEDWTPEVKLAWTDAYRAITGLMLKG. 301
324 8.000e-34UniRef50_A0A2C9JQU3 Uncharacterized protein n=3 Tax=Euthyneura TaxID=216307 RepID=A0A2C9JQU3_BIOGL  ali  16  49.KPVLTAETREIILASWEIIKKDIE------RVGVVMFMGLLE-DPDVKGTFMDFRDELRASTALRSHVLRVMGAVEKVVARMDSEDKVVTLLHDLGQRHV-VYNARPEFLDLVGPAIQPALGDRWTPEVEQAWADLFRYITHLMKETM 196
325 8.000e-34UniRef50_A0A2T6DZ03 Hemin receptor n=1 Tax=Opitutaceae bacterium EW11 TaxID=2161865 RepID=A0A2T6DZ03_9BACT  ali  18  18..PSLTPEETHLIRTSFDAVLRRPVEA------AAQFYEALFSEAPGVRGLF---------HGDMRTQGQKLIATLSLLVSRLDDLPSLEPALAELGRRHRN-YRVDRDHYSLVRRALLRMLGPEWSPAAECAWGRIYDHVAATMMAA. 151
326 9.000e-34UniRef50_A0A1V3A045 Nitric oxide dioxygenase n=4 Tax=Ectothiorhodospiraceae TaxID=72276 RepID=A0A1V3A045_9GAMM  ali  19  6........TREIVKSTVPVL------AEHGETITRRFYARMFEAHPELRNVFNQAHQAAGEQP----HA--LARAVMAWAEHIDEPQVLEDTVRRIAHKHVS-LRVTADQYAIVGEHLLGAMGEVLGPEIVGAWEQAYWELARILIDA. 136
327 9.000e-34UniRef50_A0A2N3UWU4 NAD(P)H-flavin reductase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3UWU4_9ACTN  ali  19  1....MTEDQLTLIRSSFALLR------DHGDKLAAHFYATLFLHNPQLRELFP---------AAMDVQRDRLFQALAGAVRMLDRPAELTVFLQQLGRDHR-KYGVRSEHYAAVGQALLATLARQWTPAHERAWTIAYHQIAATMSGA. 133
328 9.000e-34UniRef50_A0A210Q3Q0 Neuroglobin n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210Q3Q0_MIZYE  ali  23  20..TYLTPRQIHLVQDTWDIIKDDL------SKLGVIVFLRLFETEPDLKHLFPKIVQMNEQNKMLTKHAVSVMEGLGAAVESLDESEFLNSVLISIGQTHVKRH-VKPQMLKRLWPSLNYGLKQVLNKEVNEAWKKVYFYIVAHMKRGM 171
329 1.000e-33UniRef50_A0A1D2VHK3 Uncharacterized protein n=1 Tax=Ascoidea rubescens DSM 1968 TaxID=1344418 RepID=A0A1D2VHK3_9ASCO  ali  16  255....LTPHEIKLIRSSWNQMLLDPVTALASSLFCRQFYHNLLSMAPELEEMYPS----------IKHQAVAYSGVLSTAITHLENLSLLDDYLIQLGRRHSRLLGIEPPHFELMGEAFLKTFQDRFGVELEDLWSRLYSYLANTILQG. 406
330 1.000e-33UniRef50_A0A2C9U6P7 Uncharacterized protein n=5 Tax=Pentapetalae TaxID=1437201 RepID=A0A2C9U6P7_MANES  ali  17  90.....TEDQEALVVKSWNSMKKNS------GELGLKFFIKIFEIAPSAKKLFSFLKDSDEQNPKLKPHAITVFVMTCESAVQLRKAGKVESSLKDLGATH-FKYGVVDEHFEVTKYALLETIKEMWSPEMKNAWAEAYDQLAAAIKLEM 236
331 1.000e-33UniRef50_A0A2N9N0S6 Uncharacterized protein n=2 Tax=Candidatus Sulfopaludibacter sp. SbA3 TaxID=2043164 RepID=A0A2N9N0S6_9BACT  ali  23  9....LSERQKRLVRESFESIGEYSDS------VVLLFYGRLFELAPQVRGLFKI---------EIREQAVKLLDMLKTVVDALDRFEELRPQLAELGRKHAG-YNVQPAYYQVLVTALMWAFGQALGRETRTAWEALLGAISSVMLEG. 140
332 1.000e-33UniRef50_A0A0M6YRD6 Soluble cytochrome O n=1 Tax=Labrenzia alba TaxID=311410 RepID=A0A0M6YRD6_9RHOB  ali  17  1....MNRREIKIVQETFGKAATLGDKVP------EIFYQELFAIDPTLKKMFR---------GNMKSQGRKLLTALTMVVNNLEHTDVIVPAAEKLAVKHID-YGVTERHYTFVGNALLRTLKDEFTPEVRNAWISAYQLLADVMRAA. 132
333 1.000e-33UniRef50_U7Q638 Uncharacterized protein n=4 Tax=Sporothrix TaxID=29907 RepID=U7Q638_SPOS1  ali  19  31.....TPEQISIVKATAPVLKE------HGVTITTVFYENMLKENPELKNVFSLTSQATG------AQPRALAAAVLGYAMFIDDLPRLHHAVERIAHKHAS-LQIQPDQYDIVGKYLIQAIGQVLGDAATDAWTAAYGVLADVFI... 162
334 1.000e-33UniRef50_UPI0004B39E39 hypothetical protein n=1 Tax=Chania multitudinisentens TaxID=1639108 RepID=UPI0004B39E39  ali  18  590....LSADRIKLIQESWKKVGPIADSA------AQIFYEKLFTLDPSLRSLFR---------TEAYVQRKKLIDILTLGVKGLENIERLIPTLQSLSLRHVN-YGVKEEYYDTVGAALIYTLKEEFTEEIKQAWVEFYALLSGVMKSA. 721
335 1.000e-33UniRef50_A0A1D2MAA6 Cytoglobin-2 n=3 Tax=Entomobryomorpha TaxID=730330 RepID=A0A1D2MAA6_ORCCI  ali  21  2....LTPEEEKSIKDTWAFVSPDLKGN------GIKFFIHFFTGYPEYQKLFRGFADKLSENKRLQAHAFTVLNAINGLVDNLDDPDVLTELLLKTGRNHARR-KLTRGDFENLKTSLLEALKSHWTPEAETSWTKLLSVMVGKISEGL 147
336 1.000e-33UniRef50_A0A1G8ZND7 Nitric oxide dioxygenase n=1 Tax=Bradyrhizobium sp. Rc2d TaxID=1855321 RepID=A0A1G8ZND7_9BRAD  ali  21  1....MNTAQRELVQTTFARLAVMPEVA------GALFYERLLAKNPSFRPLFNN---------NMRIQGLKLMSMLAMVVYNLPEPDQVSTALRDLAVRHVE-YGVKPADYDAMREALLWTLEEDLTPAAREAWTVCYNELAGEMKAA. 132
337 1.000e-33UniRef50_A0A1J5KJN2 Uncharacterized protein n=1 Tax=Bacteriovorax sp. MedPE-SWde TaxID=1860085 RepID=A0A1J5KJN2_9PROT  ali  17  4........DIKIIRDSFAQAKPIADQ------VADKFYEFLFADYPAAQPLF--------ENVNMAKQKKQLMGGLSHIVDSLDKPEELTKYLKSSGQRHV-KYGTKEEHYPLVGNTLIKTFADAWTPELQQQWLWAYEFIANTMIEG. 132
338 1.000e-33UniRef50_B9RZD8 Non-symbiotic hemoglobin, putative n=5 Tax=fabids TaxID=91835 RepID=B9RZD8_RICCO  ali  19  387.....TEEQEALVVKSWNSMKKNA------GELGVKFFLKIFEIAPSAKKLFTFLRDSDEQNPKLKPHAMTVFVMTCESAVQLRKAGKVESNLKDLGATH-FRYGVVDEHFEVTKFALLETIKEMWSPDMKNAWAEAYDQLVTAIKNEM 533
339 1.000e-33UniRef50_A0A1I3GIY1 Nitric oxide dioxygenase n=4 Tax=Bacteria TaxID=2 RepID=A0A1I3GIY1_9RHOB  ali  20  3....LDDEQIAAIRGSWAPVYAARDLA------AGLFYGRLFQIAPESRALF---------SGDPTEQGRKLTETLAYVIEALDRPEALVEPVEALARRHVD-YGVRPEDYAAVGRALIWMLERHLGPQARLAWVAAYDHLARRMIAA. 134
340 1.000e-33UniRef50_UPI000D6FBE35 hemin receptor n=1 Tax=Roseomonas sp. CQN31 TaxID=2184016 RepID=UPI000D6FBE35  ali  21  4....LTEEELDRVRGSFRALAALGEDG------AATFYDRLFATSPGLRALFP---------EDIGPQCTKLMSMLGVIVARLHDHAALQPLLADLARRHVG-YGARPEHYAGVGEALLWTLGQRLGPEFTDAWRRAYAALSATML... 133
341 1.000e-33UniRef50_UPI000DABA6F9 NO-inducible flavohemoprotein n=1 Tax=Thermosporothrix hazakensis TaxID=644383 RepID=UPI000DABA6F9  ali  17  6.......EEIQLVASLVPVLKA------HGSEITTRFYNMMFTAHPELLNIFNHSNQRDGL------QQQALASSVYAAAAHIDNLDAIEPVVQHIAHKHCS-LNVQPEHYPIVGKYLTLALKDVLGPEVERVWLKAYDVIADYFIR.. 136
342 1.000e-33UniRef50_A0A1Y5HRR3 Hemin receptor n=1 Tax=Oleispira antarctica TaxID=188908 RepID=A0A1Y5HRR3_OLEAN  ali  18  1....MNPTTIHNVQSTFDLIAPIADDAA------ALFYSKLFELDPSLKSMFKS---------DMADQRKKLMQILGVAVSSLHNLAAIVPAVQDLGRRHV-KYGVRPQHYNTVAEAILWMLGQTLGPAIKQSWTEVYTVLAETMVAA. 132
343 1.000e-33UniRef50_K0T1L2 Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0T1L2_THAOC  ali  24  88......EKRKTAIQSTWKTV-----GDSLGVEATKLFYKRLFEQYPDVVPMF--------GDANMDEQAEKLLKTVSLAVEYLKDVPALIPILEDLGAKHATDWKVQKEHYDAVGECLLWTLEDAWTGDVAEAWTWVYGVIGSTMSGA. 220
344 1.000e-33UniRef50_P02218 Extracellular globin-2 n=9 Tax=Annelida TaxID=6340 RepID=GLB2_LUMTE  ali  34  12............VKSEWGRAYG---SGHDREAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHAERVLGGLDIAISTLDQPATLKEELDHLQVQHEGRK-IPDNYFDAFKTAILHVVAQLGRCYDREAWDACIDHIEDGIKG.. 143
345 2.000e-33UniRef50_Q7SDB4 Flavohemoglobin n=28 Tax=Sordariomycetes TaxID=147550 RepID=Q7SDB4_NEUCR  ali  15  3....LTYQQSKLVRDTIPALKE------HGERITSIFYKTMLTDHPELNNYFNSVNQKNGRQP------RALTAVILGFASNINHLSELVPKFERMCNKHCS-LGIQPEHYEVVGKYLIQAFGEVLGPEVQTAWTKAYWMLAKMLI... 135
346 2.000e-33UniRef50_A0A251IW93 Uncharacterized protein n=4 Tax=Mesangiospermae TaxID=1437183 RepID=A0A251IW93_MANES  ali  17  12.....TEEQEALVVKSWNVMKKNSA------ELGLKFFLKIFEIAPSAKKLFPFLKDSLHQNSKLKSHAMSVFIMTCESAVQLRKAGKVESSLKKLGAVH-FKYGVVDEHFEVTKFALLETIKEAWTPEMKIAWGEAYDQLVAAIKTEM 158
347 2.000e-33UniRef50_A0A165T7F8 Hemin receptor n=1 Tax=Halioglobus sp. HI00S01 TaxID=1822214 RepID=A0A165T7F8_9GAMM  ali  17  1....MPPEQIHLVKTALAAMTPIAEQA------ADTFYARLFEQNPPYRALFT---------GDMRAQGKMLIAILNTTVMSIDRREAVVPAIQALGKRHVG-YGVTAADYDAVGEALLWTLAEAFTPDTRTAWTTTYSVLADTMNEA. 132
348 2.000e-33UniRef50_A0A1C3EJG9 Flavohemoprotein n=3 Tax=Planctopirus TaxID=1649480 RepID=A0A1C3EJG9_9PLAN  ali  16  2....LSSATLSVVRATAPAL------AEHAQSITKRFYQLMLSEHPELWAYFNPAHQQSGR------QSMALANAIVAYATHIENLGVLLPAVELIAQKHCS-LGVQPEHYPIVGKYLLRAIRDVLGDDVLTAWGEAYQLLADLLIE.. 135
349 2.000e-33UniRef50_A4C946 Probable bacterial hemoglobin n=2 Tax=Pseudoalteromonas TaxID=53246 RepID=A4C946_9GAMM  ali  16  1....MTPHQVELVQASWEKVVPIAKDA------ADLFYGKLFELNPALRPLF---------HGDVEEQGKKLMQILTTVVRGLKQFDKLEMAVWQLGRRHVA-YQISIQDFNTVAEALLWTLQQAFSAEVKQAWVEAYTIVAGVMQAGM 133
350 2.000e-33UniRef50_G2XJ88 Hemoglobin n=2 Tax=Verticillium dahliae TaxID=27337 RepID=G2XJ88_VERDV  ali  18  4.....TEAQTAIVKSTAPILKE------HSLTITTVFYKSMLGAHPELHNIFNISNQRSG------AQQKSLANALLAYATHIDELQKLGPAVERIAQKHVS-LGITPDQYAIVGEHLIKALGDGLTPEVADAWVAAYGQLADIFVK.. 136
351 2.000e-33UniRef50_UPI0009E516CE neuroglobin-like n=2 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E516CE  ali  17  21...PLSTKEKCLVRNSWGLIKMNSTL------VGKTIFLRLFHMKPDLPKLFPELKGQLDASSTVFGHAERVMRAVENAVSALDDAESFTAYLEELGRRHKVRA-LKPDYLEAMHKAFMWTLNDTWNSDTADAWSKLFLFVCDVMIRGL 167
352 2.000e-33UniRef50_A0A1M6D0U9 Nitric oxide dioxygenase n=1 Tax=Rubritalea squalenifaciens DSM 18772 TaxID=1123071 RepID=A0A1M6D0U9_9BACT  ali  16  4....LSKETIETVKATIPFLAENA------TKLTAHFYQRMFRENPEVRAYFNAAHQVSGS------QQGALAASVCAFARNIETPENLATAVSLIANKHAS-LGVQPEHYPIVGKHLLASIDELLNPEILQAWGEAYGFLAEVLIQ.. 136
353 2.000e-33UniRef50_A4XYB2 Flavohemoprotein n=837 Tax=cellular organisms TaxID=131567 RepID=A4XYB2_PSEMY  ali  16  2....LSHAQRDLIKATVPLLE------SGGEALTTHFYRMMLSEYPEVRPLFNQAHQASGDQP------RALANGVLMYARHIDRLEALGPLVAQIVNKHVS-LQILPEHYPIVGTCLLRAIREVLGDAVIEAWAVAYQQLADILIGA. 137
354 2.000e-33UniRef50_A0A1Q7BWH8 Flavohemoprotein n=1 Tax=Actinobacteria bacterium 13_2_20CM_2_71_6 TaxID=1803494 RepID=A0A1Q7BWH8_9ACTN  ali  21  6..........RLLKESWTLVEE------HQDRVAGYFYARVFLSHPQVRDLFPV---------QMDVQRARLLGAIVTAVQTLDDPERFDEYLRSLGRDHR-KFHVNPEHYDVVGAALIESLREHWSIEYDQAWRDAYAVIARKMMAG. 131
355 2.000e-33UniRef50_B4WP36 Globin domain protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=B4WP36_SYNS7  ali  19  4........DVELLEQSFELVKPKADD------FVASFYNNLFTDYPDAKPLF--------EHTNMAAQQQMLKGALVMVVDNLRRPEVLSKSLKGLGARHI-KYGALPEHYPLVGNSLIKTLEQAWNSKLESAWAGAYSAITELMLEG. 132
356 2.000e-33UniRef50_UPI000B910BBC uncharacterized protein LOC110979416 n=1 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B910BBC  ali  18  784.DGPISSREKELVQTSWKIMQKDSVN------LGAAIFARLLDKNPSIRELFPFGKQMLKRNPDLRAHGKGVMETIGSVVAGLDDLGKIVPVLKDLGARHK-IYGAKPGHFKPLMEAFMYSARKAFTSDVQEAWGNTWKVLAGIMNTTM 934
357 3.000e-33UniRef50_N1QXN3 Non-symbiotic hemoglobin n=3 Tax=Poaceae TaxID=4479 RepID=N1QXN3_AEGTA  ali  19  156NQMAFSEAQEELVLRSWKAMKPDSES------IALKFFLRIFEIAPAAKPMFPFLRDALESHPKLKAHAVTVFVMACESATQLRKTGDVEATLRRLGATHV-RAGVADAHFEVVKTALLDTIEEMWTPEMKAAWEEAYDQLAAAIKEEM 309
358 3.000e-33UniRef50_F3MBR1 Flavohemoprotein (Fragment) n=3 Tax=Bacillales TaxID=1385 RepID=F3MBR1_9BACL  ali  18  2....LSQRTIEVVKSTVPVLE------THGTAITSAFYQKLFHHHPELLNIFNHANQREGKQPFALANAV------YAAAAHIDRLEAIVPVVKQIGHKHRA-LNILPEHYPIVGETLLGAMKDVLGPEIIEAWAEAYGVIADVFI... 134
359 3.000e-33UniRef50_A0A0G4MVX5 Uncharacterized protein n=4 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4MVX5_9PEZI  ali  18 1185.....TEAQTAIVKSTAPILKE------HSLTITTVFYKSMLGAHPELHNIFNISNQRSG------AQQKSLANALLAYATHIDELQKLGPAVERIAQKHVS-LGITPDQYAIVGEHLIKALGDGLTPEVADAWVAAYGQLADIFVK.. 1317
360 3.000e-33UniRef50_N6V4P8 Flavohemoprotein n=256 Tax=Bacteria TaxID=2 RepID=N6V4P8_9RHIZ  ali  19  5....LSAATKAIVRATVPAL------AAHGTEITAAMYLLLFKDE-EVRNLFNQSHQGEGG-----GQAKALAQAILAYAQNIDNLAVLGPAVERIAQKHVG-LQIQEHHYPHVANALLAAIKQVLGDEVLAAWGEAYWFLADILI... 137
361 3.000e-33UniRef50_UPI0008350B6C flavohemoprotein n=1 Tax=Actinoplanes sp. TFC3 TaxID=1710355 RepID=UPI0008350B6C  ali  22  6..........RLLKESWSLVEENQDK------VAGYFYARMFLSNPELRELFPVY---------LEAQRTRLLRAIVTAIQTIEDPDRFDSYLHALGRDHR-KFHVEPEHFEVAGGALLEALREQWSIEYDQAWADAYTVISTKMIAG. 131
362 3.000e-33UniRef50_D0MR65 Nitric oxide dioxygenase (Pi-NOD1) n=15 Tax=Peronosporaceae TaxID=4777 RepID=D0MR65_PHYIT  ali  17  21...PMSAKTIAILKATAPVVQE------HGTEITSTMYGTMFSEFPEVQNLFNMSHHRVGAPPGVSRQATALANAVIGFAANCDQLGNLGDAVPRMVHKHVS-LDIRAKHYPIVGGCLLRAIKTVLGDEIIDAWKEAYWFLADLLIQA. 168
363 3.000e-33UniRef50_A0A258C1Q6 Nitric oxide dioxygenase (Fragment) n=1 Tax=Pseudomonadales bacterium 32-61-5 TaxID=1970544 RepID=A0A258C1Q6_9GAMM  ali  15  1....MTAEQTAIIKATVPILE------TGGETLTKHFYGHMLTSHPEVVPFFNKAHQASGDQP------RALANAVLMYAKNIERLGNLGPLVGQIINKHVS-LNINPAHYAVVGACLLKAIRDVLGDAVIDAWAAAYGQLADILIGA. 136
364 3.000e-33UniRef50_A0A0J9XEW3 Similar to Saccharomyces cerevisiae YGR234W YHB1 Nitric oxide oxidoreductase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0  ali  17  1..MPLTPDQISVIKATIPVLKE------GGVTLTTKFYENMLNEKPEVRPFFNPAHQASGMQPKALAH------SLLLYATYIDDLGKLSDLVERIVSKHVTLL-IQPDQYPIVGEYLIRTMKEVLGDEVIGAWTAAYGDLANLLID.. 136
365 3.000e-33UniRef50_A0A0F5W5F7 Flavohemoprotein n=44 Tax=Streptomycetales TaxID=85011 RepID=A0A0F5W5F7_9ACTN  ali  21  2.......................AEVAPVADKVTSYFYALLFVRHPDLRSLFP---------AAMDTQRDRLLKALLTAAEHIDNTPVLVDYLQNLGRGHR-KYGTRAEHYPAVGECLIGALENIWDPELEAAWVRTYTTISQVMIDA. 120
366 3.000e-33UniRef50_A0A076MRI5 Globin n=2 Tax=Amycolatopsis TaxID=1813 RepID=A0A076MRI5_AMYME  ali  18  2........DIPRLRASWATVAERGDEVPLW------FYATLFLLRPSLRDLFPVS---------LASQRTRFVSALGQIVTHVDDLDAAVPYLRRLGRTHREA-GVRPEHYPVVGQALLATLEERWTPELAADWTSAYAVVAEVMTNA. 129
367 3.000e-33UniRef50_Q90YJ2 Neuroglobin n=149 Tax=Euteleostomi TaxID=117571 RepID=NGB_DANRE  ali  24  2..EKLSEKDKGLIRDSWESLGKN------KVPHGIVLFTRLFELDPALLTLFSYSTNECLSSPEFLEHVTKVMLVIDAAVSHLDDLHTLEDFLLNLGRKHQAV-GVNTQSFALVGESLLYMLQSSLGPAYRQAWLTMYSIVVSAMTRG. 149
368 3.000e-33UniRef50_C5BEV3 Oxidoreductase, FAD-binding protein n=1 Tax=Edwardsiella ictaluri (strain 93-146) TaxID=634503 RepID=C5BEV3_EDWI9  ali  18  2....LDTQTIVIVKSTLPLLQQ------YGPGLTAHFYQRMFRHNPELKSLFNMSHQHSGD------QREALFNAICAYAAHIDTPAALSGAVERIAHKHVSV-GIQPQQYAIIGHHLLKTLEELFNPDVLDAWSNAYSTLAQLFIA.. 133
369 3.000e-33UniRef50_A0A1Y1I094 Non-symbiotic hemoglobin n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1I094_KLENI  ali  22  21..GVLTQEKVGLIQSSYAKI----DEKIGALGFGKEFYTVLFEMAPAAQALFKSGRE---------AQSKMFAGMLTTLVKNIDNADKVVPVLQALATRHV-RYGVKEAHFPIVGAGLLATLEKVFTPPVREAWTELYGITQTVMWAKM 157
370 3.000e-33UniRef50_UPI0009DC12DF hypothetical protein n=1 Tax=Planktothrix agardhii TaxID=1160 RepID=UPI0009DC12DF  ali  19  180.....TTAQIELVETSFEKIK------PRAVEFVSSFYQNLFETYPETQRLFGK--------TDMDKQGKKLLNSLILLVEGLRTPEALIPVLKDLGARHKG-YGTITEYYPLVGEILLKTLQEDWTPQVAQSWVEIYTKTSQLMLEG. 311
371 4.000e-33UniRef50_A0A1M5WEL6 Nitric oxide dioxygenase n=3 Tax=Rhizobiales TaxID=356 RepID=A0A1M5WEL6_9BRAD  ali  15  5.......................AADKLTSEAAAVLFYDRLFDIAPQMRAMFP---------DDMIEQRRKLMAMLAGVVKGLGNLEQVLPAAGALAKRHVS-YGAKAEHYPVVGAALLWTLEDGWTPEVADAWGTAYGTLSGYMISE. 123
372 4.000e-33UniRef50_A0A2B4SX20 Neuroglobin-2 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SX20_STYPI  ali  24  26NSPELTDLQTELIRGSWEKVKTN------KKYHGERLFHKLFDVAPHLQELFPF--GSDLTNPMFTMHALNIMNTLDLAVQNLDKLDILVPKLRELGQMHAAFELTEVE-FQYVGESLIWVLEDDFTPKLKRAWCDAFAIISSVMLGAI 169
373 4.000e-33UniRef50_A0A239UBQ6 Putative flavohemoprotein n=188 Tax=Staphylococcaceae TaxID=90964 RepID=A0A239UBQ6_9STAP  ali  15  2....LTEQEKDIIKQTVPVLQ------DKGVEITSFFYNRMFNEHPELRNMFNQTNQKKGL------QSTALAQTVLAAAANIENLGAIMPVVREIAYKHCA-LQVPPAGYEIVGENLIAAIMEVLGDPVIKAWTNAYWEIANVFID.. 135
374 4.000e-33UniRef50_K9YEZ7 Globin n=1 Tax=Halothece sp. (strain PCC 7418) TaxID=65093 RepID=K9YEZ7_HALP7  ali  17  10.........VELLENSYSEIR------PRANEFAISFYQNLFSLYPETQPLFAHV--------DMAKQQQMLISALNLVVKNLRKPNLFKQTLKGLGSRHV-RYGALPEYYPLLKEALLKTLQDRWTAETRQAWTEAFDAITKLMLDG. 137
375 4.000e-33UniRef50_F4CV93 Nitric oxide dioxygenase n=63 Tax=Actinobacteria TaxID=201174 RepID=F4CV93_PSEUX  ali  19  33.........VETIRRSWAAMEDQAD------ALGRHFYATLFHIAPETRDLFPV---------NMEVQRSRLLRALVHVVQMVDQLDDLVPFLQQLGRDHR-KFGVIAGHYDAVGKALLSAIGDGWTPEVEKAWTDAYTLAGQAMSQA. 159
376 4.000e-33UniRef50_A0A2S2QIF8 Globin n=2 Tax=Sipha flava TaxID=143950 RepID=A0A2S2QIF8_9HEMI  ali  24  77....LSPVQISRIRRSWSALAQDP------TELASALVIRMFKENPEYISLFKRLKDELQSNSQFKAHASKVGGALGATIDHLDKPEKLEELLTDIGIKHR-KYGLSPKHFEVIRNVLIAIIAEAIGPELLDLWKSSLTGVMSIIVAG. 220
377 4.000e-33UniRef50_A0A0D9VRM0 Uncharacterized protein n=2 Tax=Leersia perrieri TaxID=77586 RepID=A0A0D9VRM0_9ORYZ  ali  21  10.....TEEQEALVLKSWAIMKNDSAN------IGHRFFLKIFEVAPSARQLFSFLRDSLEKNPKLKTHAMSVFVMTCEAAAQLRKTGTVDTTLKRLGNTH-FKNGVRDAHFEVAKFALLETIKEMWSPEMKGAWGEAYDQLVAAIKQGM 157
378 4.000e-33UniRef50_UPI0004E0AF16 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain n=1 Tax=Methylacidiphilum infernorum (isolate V4) TaxID=481448 RepI  ali  20  1....MTREEIKMIQKSWLRVIDKMDEA------GLLFYRRLFDVEPKVRPLFKI---------DIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHV-KYGVKAEHYPVVGHTLIWTLRKMWTKQLEQLWTQAYEALAQVMIEE. 132
379 5.000e-33UniRef50_UPI000DBEB0C6 NO-inducible flavohemoprotein n=1 Tax=Echinicola strongylocentroti TaxID=1795355 RepID=UPI000DBEB0C6  ali  16  1....MTQKTIDIVKSTAPVLK------SHGEQITRVFYEELFKHHPELKNMFNMTHQATGNQPKV------LAMTIIKYAEHIDQLDMLTDTVNVIVQKH-SSLDVRPEMYPIVGKYLLEAIKTVLGDEILGAWEEAYQLLAQLFI... 134
380 5.000e-33UniRef50_UPI000B912BAA cytoglobin-1-like isoform X1 n=3 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B912BAA  ali  19  43....LTKEQKEHIRKSWAVVC------TMKTKFGVELFAKLFTNYPSSQQHFAQLKDLLKKNPKMRAHGYRVVSAFCSLVENLDTPDIFIELLKNTGYSH-SMRNVPHHYFEELGLVFLEVLGDKFTPKAKEAWGLAYGFMCKVILGAM 189
381 5.000e-33UniRef50_Q81T23 Flavohemoprotein n=521 Tax=Terrabacteria group TaxID=1783272 RepID=HMP_BACAN  ali  18  2....LSEKTIEIVKSTVPLLQE------KGVEITTRFYEILFSEHPELLNIFNHTNQKKGR------QQQALANAVYAAATYIDNLEAIIPVVKQIGHKHRS-LGIKAEHYPIVGTCLLRAIKEVAGDEVLNAWGEAYGVIADAFIS.. 133
382 5.000e-33UniRef50_A0A1Z4S992 Globin domain protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Z4S992_9NOSO  ali  20  5.........VEVLEQSFQQVK------PRASEFVTSFYDNLFIAHPEVKPLF--------ANIDMARQHNMLLNALVLVVENLRKPEVLGQALKGLGARHVG-YGASPQHYGAVGEALLVTFEEYWTPEVKQAWLGAFEVIEAEMLQG. 132
383 5.000e-33UniRef50_A0A2G2M2M7 Methyl-accepting chemotaxis protein n=3 Tax=Methylophaga sp. TaxID=2024840 RepID=A0A2G2M2M7_9GAMM  ali  22  44........EIELLEESFAAL------APQGEALAARFYERLFDKYPEVKPLF--------EGIPIDGQQKKLLASLVLLVQNLHKPEILKDYLYSLGARHVQ-YGVIEAHYPLVAENLLAVMAELWTDEVKQAWQNTLNTVATIMIEA. 172
384 5.000e-33UniRef50_A0A151TG77 Non-symbiotic hemoglobin 1 n=3 Tax=50 kb inversion clade TaxID=2231393 RepID=A0A151TG77_CAJCA  ali  18  9.....TEEQEALVVKSWTVMKKNS------GELGLKFFLKIFEIAPSAQKLFPFLRDSLEQNPKLKPHATSVFVMTCDSAVQLRKAGKVESNLKKLGATH-FKYGVANEHFEVTKFALLETIKEMWSPAMKNAWGEAYAQLVDAIKSEM 155
385 5.000e-33UniRef50_A0A2H5B1T3 Oxidoreductase n=2 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2H5B1T3_9ACTN  ali  19  6..........AVIRASFAIVELRADHA------AKYFYTHLFAHNPELRQLFP---------ADLAEQRDRLFASLTELVLRTDDLDGLTGYLRALGRDHR-KFQAQPEHYPAIGASLIAALRQSWTPEIEKAWTEAYTVISQVMIEG. 131
386 5.000e-33UniRef50_UPI0006B0D012 globin C, coelomic-like n=2 Tax=Limulus polyphemus TaxID=6850 RepID=UPI0006B0D012  ali  22  25....LTPREKQNIRKTWAIVQKNVK------ENGVELFIRFFDAHPDYIKLFKPLRDQLRSSKRLEAHALSVMYAITSLVDSLDDVECLKELLLKTAHNHAHR-GVQGEQFDHLTIIILKFLRDGLGPPVGEAWEKAFNVMNEIIKQGL 170
387 5.000e-33UniRef50_A0A1Y0RKQ8 Globin n=1 Tax=Nostocales cyanobacterium HT-58-2 TaxID=1940762 RepID=A0A1Y0RKQ8_9CYAN  ali  22  189.........VEILVSSFEKVKPRAD------EFAASFYENLFKAHPEVKPLFTK--------TDMKNQEKKLLNSLVLVVENLRNPEALRSVLNALGDRHVG-YGAIPKYYGPVGEALLVTLQQNWTSELKKAWVDAFRAITALMLNG. 316
388 6.000e-33UniRef50_V4ABF4 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4ABF4_LOTGI  ali  17  2..........DLVRETWNIAREDIA------RVGVVAFLSLFEKYPETQNIFLPFRDELQHSARLREHGLRVMLTVEKCIARLDKPEKLQDLLHDLGQKHVEF-NTKVDYIDMVGPQFIQAIKSDWTPEVEDAWEDFFKLLIYFMKEAM 141
389 6.000e-33UniRef50_V4A611 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4A611_LOTGI  ali  20  26.....TETQIDTIRSTWPLLSRNM------VRVGTDVFVRIFTEVPTVKELFSSFNNDLHKMPTFRAHAEMFMQVLHLVVDNLETPSELNHELMVLGARHATFSGFKPEYFKFYVKCLIQVWELELGEEVRDCWKIVFDFLVDNMTEG. 171
390 6.000e-33UniRef50_A0A225VFI1 Nitric oxide dioxygenase (Pi-NOD1) n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225VFI1_9STRA  ali  17  20...PMSAKTISILKATAPVVKE------HGTEITSTMYGMMFSEFPEVQNLFNMSHHRVAGATKVSRQATALANAVIGFAANCDQLGNLGDAVPRMVHKHVS-LDIRAKHYPIVGGCLLRAIKIVLGDEIIDAWKEAYWFLADLLIQA. 167
391 6.000e-33UniRef50_H6RLL7 Flavohemoprotein n=7 Tax=Geodermatophilaceae TaxID=85030 RepID=H6RLL7_BLASD  ali  18  2........DIPAMRANFAKAAATGDEAP------LYFYSHLFLSHPETRQMFPVS---------MAHQRDRFFAALGDVVTRVDDLDALVPILRQLGRDHL-KFGVLPAHYPAAGGSLLATLEHEWTPELAKSWAEAYDVVATVMIQG. 128
392 6.000e-33UniRef50_A0A254W6J0 Uncharacterized protein n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254W6J0_9CYAN  ali  18  5.........VELLESSFAQIKVNS------LEVTKQFYTVLFTDYPEVQPLF--------ANTNMEKQRKQLFQSLVFTVNNLGKPATLSDTLRGLGTRH-TQYGVLPQHYPMVGSSLLKALGTAWTPDVQQAWTEAYEVVTQLMLKG. 132
393 6.000e-33UniRef50_A0A2G2JR25 Flavohemoprotein n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2G2JR25_9PLAN  ali  20  5.........IKLLEDSFELL------APQGDALVERFYDNLFNDYPVVRPLF--------ENVEMQEQRSKLLAGLALVVANLRSPDQLVPALEEMGQRHVE-YGAVEDYYPAVGATLLKSLAEAWNDELEQAWSDAYGEISKIMLAG. 132
394 7.000e-33UniRef50_A0A2W2E3R7 Globin n=2 Tax=Micromonosporaceae TaxID=28056 RepID=A0A2W2E3R7_9ACTN  ali  17  2........DVSRLKQSWSLVAAHGDQVP------LYFYSTLFLAYPETRQMFP---------TNMAGQRDRLVTALGHIVSQVDQLDHLVGYLQDLGADHR-KFAVRAEHYPAVGEALLATLRDQWTDELAQDWTAAYGLVSKVMTEA. 129
395 7.000e-33UniRef50_X7F9A6 Uncharacterized protein n=1 Tax=Roseivivax isoporae LMG 25204 TaxID=1449351 RepID=X7F9A6_9RHOB  ali  18  1....MTPEQLELVTESFRR------TFAGKTPVARAFYDRLFAEHPELRPLFPQ---------KMAAQYEKFTDTLVFVVRHLARRATVLVSAEELGQRHRA-YGVRPEHYAIVGQALLAAMAEVLSPAERAAWDAAYALVSDRMRA.. 131
396 7.000e-33UniRef50_UPI00064D999B plastid division protein PDV2-like n=1 Tax=Erythranthe guttata TaxID=4155 RepID=UPI00064D999B  ali  17  322..NLFTEEQEALVVQSWSLMKKNA------GEWGLKFFLKIFEIAPSAQKMFPFLRDSLDQNPKLKPHAKSVFVMTCEAAVQLRKAGKVVSSLKKLGATH-FKYGVADEHFEVTKYALMETIKEMWSAEMKKAWCVAYDHLVAAIKTEM 471
397 7.000e-33UniRef50_UPI0002C33079 plastid division protein PDV2-like n=1 Tax=Fragaria vesca subsp. vesca TaxID=101020 RepID=UPI0002C33079  ali  18  290.....TEEQEALVVKSWAAMKKNSA------ELGLQFFLKVFEIAPSAQKLFSFLKDSLEKNPKLKTHAMSVFVMTCESAVQLRKAGKVDSTLKRLGGVH-FKSGVVDEHYEVVKFALLEIIKEMWSPEMKSAWGEAYDQLVAAIKLEM 436
398 7.000e-33UniRef50_UPI000D6A1249 cytoglobin isoform X1 n=1 Tax=Python bivittatus TaxID=176946 RepID=UPI000D6A1249  ali  16  17..EEMSDAERKVIQETWNRVYANCED------VGVSILIRFFVNFPSAKQYFSQFKHEMERSLQLRKHARRVMGAINSVVENIYDSEKVSSVLALVGKAHAVKHKVDPVYFKILTGVMLEVLKEEFTPEVQRAWTKMRSLIYTHVTAA. 166
399 8.000e-33UniRef50_A0A0E9MYQ4 Putative globin-like protein n=1 Tax=Flavihumibacter petaseus NBRC 106054 TaxID=1220578 RepID=A0A0E9MYQ4_9BACT  ali  21  1....MTKEAIRLVQQTWVTV------IPVSQTLGEAFYRKLFTAEPLVKHLFK---------TDIKEQACKLTQMFTHIISHLDRLEDVRGDLHRLGQRH-NQYKVKPEYYAIVGESLIATLEEKWTGATKAAWIDFLTIVFEAMMQG. 132
400 8.000e-33UniRef50_A0A1D7UZS6 Hemin receptor n=5 Tax=Leptospira TaxID=171 RepID=A0A1D7UZS6_9LEPT  ali  17  6.......EEIELVRASFEKVYTNKD------EVAALFYSKLFELEPSYKSLFK---------GDMNEQGRKLMLMLRTLVSGLGDLANLVPVIQDMGKRHV-KYGVQSKDYDVVGAALLATLQQGLGAELRGLWTDIYQIVAKTAIEG. 134
401 8.000e-33UniRef50_A0A2H1YC60 Flavohemoprotein n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A2H1YC60_9FLAO  ali  16  3.....SKKTIEIVKSTVPVLE------VHGEAITKVFYRLLFENHPELKDIFNMTNQKKGN------QQIALASAVFKYAQHIDKLEMLGGMVNTIAQKHVS-LSIPKEAYPIVGENLLAAIKEVLGPEIIDAWAEAYGDLAAIF.... 133
402 9.000e-33UniRef50_A0A1K0FUM1 Globin H n=7 Tax=Amniota TaxID=32524 RepID=A0A1K0FUM1_MYOLU  ali  21  96..........ELIRQSWQAVSRSP------LEHGTVLFTRLFDLEPDLLPLFQSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLAGLGRKHRAV-GVKLSSFSTVGEALLYMLEKCLGPAVRAAWRQLYGAVVQAMSRG. 236
403 9.000e-33UniRef50_R7URJ5 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7URJ5_CAPTE  ali  17  93..PQLTDRQMTLIEDTWSIVQRDI------STVGLDMFSRMFEAFPGIKESFSMVPEDHRYRKEISEHGVRVLNTVDTILRLRHDPDKTIETLHDLGGKHISF-NAKVDYIDLLGQHFLFALKQHWTPEVEQAWADLFRLMSHVMKEGM 240
404 9.000e-33UniRef50_UPI0007322D17 hypothetical protein n=1 Tax=Thiohalocapsa sp. ML1 TaxID=1431688 RepID=UPI0007322D17  ali  20  1....MTPEHIAAVKASWEQLRPISEQT------AFLFYTRLFEQHPDLHGMFR---------TDSREQGHKLLAMLDTAVASLADLDALEPDIRELGGRHVG-YGVMDGHYPLFEDAMHWALGDGWTADVEAAWRALFGRLSRTMRAG. 132
405 1.000e-32UniRef50_A0A0B4BES3 Uncharacterized protein n=1 Tax=Leisingera sp. ANG-Vp TaxID=1577896 RepID=A0A0B4BES3_9RHOB  ali  20  8......AAEAALVQESFA------AATALGDALTLEFYQRLFEWAPQVRPMFP---------DDISGQAQVLGKTLAFAVNGLKHPEDLAAPLQKLGARHAG-YGVEPAHYAVVADVLIETLKDTWTSAHEKAWRGALDLVAKVMIAG. 137
406 1.000e-32UniRef50_A0A0U5L7X2 Flavohemoprotein n=32 Tax=Bacteria TaxID=2 RepID=A0A0U5L7X2_9GAMM  ali  18  3.....TSEQKDLVKATVPVLREN------GVALTDYFYKRMLKNNPQLKETFNMGHQRSG------AQAKALAGAVLAYAENIDDPSVLAPVVELICHKHVS-LNIQAPDYDIVGENLLHSISEVLNDKLIAAWASAYQQLADLFIA.. 135
407 1.000e-32UniRef50_UPI00031F3E87 NO-inducible flavohemoprotein n=5 Tax=Enterobacterales TaxID=91347 RepID=UPI00031F3E87  ali  18  2....LDTQTIVIVKSTLPLLQQ------YGPGLTAHFYQRMFRHNPELKSLFNMSHQHSGD------QREALFNAICAYAAHIDTPAALSGAVERIAHKHVSV-GIQPQQYAIIGHHLLKTLEELFNPDVLDAWSNAYSTLAQLFIA.. 133
408 1.000e-32UniRef50_A0A2E7E671 Uncharacterized protein n=1 Tax=Oceanospirillaceae bacterium TaxID=1899355 RepID=A0A2E7E671_9GAMM  ali  17  16....LSPATLEIVAATVEVVRAN------GTAITDVFYRNMLSAYPELQRLFNMPNQASGG------QKQALASAVYAYAANQNNPEALEPVLNRIAHKHAS-LGITPAQYTIVGKYLLGAVADVLGPEVAAAWDEVYWQLACDLIA.. 149
409 1.000e-32UniRef50_A0A1Y1LBA0 Uncharacterized protein n=2 Tax=Photinus pyralis TaxID=7054 RepID=A0A1Y1LBA0_PHOPY  ali  20  19.ETGLTRKEKHLVERSWNLVKTNLK------ANGMELFLLLFKECPEAQNYFPFRDDELPNNGKFKAHAVTVMYSIGSIVDNLNENDVLIGLLQKNAESH-SKRGIPEEAYWTLKKCMMQLLKNKLGPEVEEAWDKTLTVAFTVIIK.. 164
410 1.000e-32UniRef50_A0A2J7RQJ1 Uncharacterized protein n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7RQJ1_9NEOP  ali  22  58.QTGLTQRERQAVVSTWAVVKLDAKRT------GVELFMRLFEAHPEYQKRFPSFRGELRGSTKLSAHATNVMYSLTGVVDNLEDPECLTELLRKLGENHR-RHEITEKEFRDLKVVLMDLLKEKLGEQLERAWNKTVDLAYTFIFQGL 206
411 1.000e-32UniRef50_C1MGW9 Predicted protein n=1 Tax=Micromonas pusilla (strain CCMP1545) TaxID=564608 RepID=C1MGW9_MICPC  ali  25  589.................................GVAFFRNVFRIAPEALQLFSFRDVNLYESPQLKAHATKVMSTVGVAVAGLQDIGKLVPVLSMLGKKHLA-YGVLPAHYDVVGQALLETLEEHWTPAAAHAWATVYGTVADVMKS.. 706
412 1.000e-32UniRef50_I1RB58 Uncharacterized protein n=34 Tax=Sordariomycetes TaxID=147550 RepID=I1RB58_GIBZE  ali  15  3....LSYQQTKLIRGT------IPALTDHGERITTIFYRNMLRDHPELNDYFNTVNQANGRQP------RALTAVILSYANNINHITELIPKMERMCHKHCS-LGIKPEHYAIVEKYLIAAFAEVLGPQIREAWTKAYWMLAKMLI... 135
413 1.000e-32UniRef50_I2K714 Nitric oxide dioxygenase n=2 Tax=Proteobacteria TaxID=1224 RepID=I2K714_9PROT  ali  18  1..MSLSQSTITTVKATAGAVSQHAE------AITTKMYEILFSQHPELKELFKDADPD---------QHKKLASAVGAYAANIDNLDVLSKAVEKMAQSHVRTH-VKPEHYPMVGTAILGAIKEVLGDEILDAWKEAYFFLADILIA.. 133
414 1.000e-32UniRef50_O24520 Non-symbiotic hemoglobin 1 n=76 Tax=Mesangiospermae TaxID=1437183 RepID=HBL1_ARATH  ali  18  10.....TEEQEALVVKSWSVMKKNSA------ELGLKLFIKIFEIAPTTKKMFSFLRDSAEQNPKLKPHAMSVFVMCCESAVQLRKTGKVETTLKRLGASH-SKYGVVDEHFEVAKYALLETIKEMWSPEMKVAWGQAYDHLVAAIKAEM 156
415 1.000e-32UniRef50_A0A0Q4KPB2 Uncharacterized protein n=1 Tax=Sphingomonas sp. Leaf33 TaxID=1736215 RepID=A0A0Q4KPB2_9SPHN  ali  19  1....MHARQIEQIRDTFVHVLFDPERA------AGVFYGRLFDLAPETRPLFKS---------DMDEQGRVLIRSLATIITGLSRFDAMVPTLTDLAIRH-DGYGVRRDHYAIVGTAIIDMLEDDFDDSVRAAWIEAYGLIADTMIAA. 132
416 1.000e-32UniRef50_A0A1W2GDV4 Nitric oxide dioxygenase n=2 Tax=Reichenbachiella faecimaris TaxID=692418 RepID=A0A1W2GDV4_9BACT  ali  16  8.....TPYNKKLVRATFWMVEPKADEA------AEIFYTKLFEMSPELRPLFK---------GNMRDQGKRMMEMLSTVVKGLNTLDVLAPLVRSMGRRHVN-YGIKTEHYNMAAAALMYSLKEEWNEEVESAWLEVYQTVSDIMQSA. 138
417 1.000e-32UniRef50_Q9I0H4 Flavohemoprotein n=787 Tax=root TaxID=1 RepID=HMP_PSEAE  ali  16  2....LSNAQRALIKATVPLLE------TGGEALITHFYRTMLGEYPEVRPLFNQAHQASGDQP------RALANGVLMYARHIDQLQELGPLVAKVVNKHVS-LQVLPEHYPIVGTCLLRAIREVLGDEVLEAWGAAYQQLADLLIEA. 137
418 1.000e-32UniRef50_A0A1Y5TN36 Bacterial hemoglobin n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1Y5TN36_9RHOB  ali  18  1..MPLTQRQLELVRESFSVLRDDPIPKS------IDFYTSLFRQAPELKAMFR---------EDLAGQGMRFMATLGAIVDNLHDTKAMADRYADLGRAHRA-LGVRAQDFEPMGKALIETLGDAFTPEMQEAWETAYTEFSRDIIA.. 133
419 1.000e-32UniRef50_UPI0005EDA302 uncharacterized protein LOC100889989 n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=UPI0005EDA302  ali  26  307..GPLRAREQELVQKTWGVLSLDTEQH------GAAMFAKLISAHPAVAQMFPFGENQLVQNPTLRAHGKRVMETIGQTVGSLDDLDILVPILRDLARRHVG-YSVTRQHFEPVGEALMHAIQEGLGEEVERAW............... 439
420 2.000e-32UniRef50_UPI000D75B6E2 hemin receptor n=1 Tax=Sinimarinibacterium flocculans TaxID=985250 RepID=UPI000D75B6E2  ali  24  1....MNAEQIRLVRETWKLI------LPMRAAVAELFYSKLFELEPRLRPLFKS---------DLERQGEKLIAMLDAAVRGLDHPHVLGPALKDLGQRHV-RYGASENDYGTVAVSLLWTLEQSLGADARRAWTEAYATIVAMM.... 129
421 2.000e-32UniRef50_B4WLV9 Globin domain protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=B4WLV9_SYNS7  ali  20  2........DVALLEKSFEQIS------PRAIEFSASFYQNLFHHHPELKPLFAETSQTI--------QEKKLIFSLAAIIENLRNPDILQPALKSLGARHAEV-GTIKSHYPLVGQALIETFAEYWTEQLATAWVEAYDVIASTMIEG. 130
422 2.000e-32UniRef50_A0A250IQZ8 Nitric oxide dioxygenase n=2 Tax=Melittangium TaxID=44 RepID=A0A250IQZ8_9DELT  ali  20  6....LAPRTIEIIQSTVPVLK------VHGEAITTRFYQRLFESHPELRDVFNQARQREG------KQQAALANAVYAAAQNIERLEAILPAVRNIAHKHRA-LGVVPEHYPIVGQHLLAAIKEVLGDEILGAWAEAYQEIASVFIS.. 139
423 2.000e-32UniRef50_A0A2L2XXN4 Globin n=2 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=A0A2L2XXN4_PARTP  ali  23  23....LTPRQRDTVQNTWKIVRSNIK------ENGLTFFVKFFQKYPEYQKLFPFADEKLRDDKKVLAHAMAVMYALNSIVDSLGDVDCLVQILVRIGSGHKPRS-IQPIHFENLASFLVSFLIEALGDSAVEAWRTAFKAANGIIINAL 168
424 2.000e-32UniRef50_UPI00089D11D8 flavohemoprotein n=1 Tax=Micromonospora pattaloongensis TaxID=405436 RepID=UPI00089D11D8  ali  18  6..........RLLKESWTLVEEQQDK------VAGYFYARMFLSNPHLRELFPV---------HMDVQRARLLGAIVTAVQTIDDPERFDEYLRSLGRDHR-KFRVEPEHYNVVRDALLEAFREQWSIEYDQAWIDAYDLIARKMLSG. 131
425 2.000e-32UniRef50_A0A2W1JHN3 Bacterial hemoglobin n=2 Tax=Acaryochloris sp. RCC1774 TaxID=1764569 RepID=A0A2W1JHN3_9CYAN  ali  19  16.....SPMNIELLERSFEQIR------PQAIAFSNHFYETLFRHNPGIKPLFANISQQ--------AQGKKLIFSLAAIIENLRSPEVLEPALKSLGARHFEV-GTLEEHYPLVGQALFETLGSDWTPATMDAWQEAYEAIATIMLEG. 147
426 2.000e-32UniRef50_A0A2K9UYQ4 Globin-like protein n=3 Tax=Exaiptasia pallida TaxID=1720309 RepID=A0A2K9UYQ4_EXAPA  ali  18  28....LTYDQKYLVRETWKCLE------VSKREIGVSVYKRFLTMHPELKKHFSEFRSIDISEINGRHHPRRLLMAIDNAVTAMGDSESYSAYLIELGRRHRERFTITPAHFDDLRKCFLSVIMEIWNSEVEKAWCCLFTSISTMMLKGL 174
427 2.000e-32UniRef50_UPI000D146B18 hypothetical protein n=1 Tax=Streptomyces sp. NRRL F-5123 TaxID=1463856 RepID=UPI000D146B18  ali  18  7..........QALKDSFALVGKSGDEVP------RYFYSYLFLIAPEVRPMFPV---------NMGVQRDRLVNALGQIVSDVDDPDTLVPFLQQLGRDHR-RFQVVAQHYDAVGRALLATLGEAWTPELEKGWTEAYTVVAGAMVQA. 132
428 2.000e-32UniRef50_Q5DVM4 Putative haemoglobin n=2 Tax=Opisthokonta TaxID=33154 RepID=Q5DVM4_ASPNG  ali  17  1..MPLTPEQIKIIKATVPVLQE------YGTKITTAXYMNMSTVHPELNAVFNTANQVKG------HQARALAGALFAYASHIDDLGALGPAVELICNKHASLY-IQADEYKIVGKYLLEAMKEVLGDDILDAWGAAYWALADIMI... 135
429 2.000e-32UniRef50_A0A173KSS9 Nitric oxide dioxygenase n=104 Tax=Bacteria TaxID=2 RepID=A0A173KSS9_9SPHN  ali  21  3...QLSAETIAIVKATAPALR------SHGVEITTAMYKRLFQ-DPSIKDMFDQGAQDSGEQPK------RLAAAILGYAENIDKLQALQGAVARMVQRHVET-GVKAEHYPKVAEALLPAIRDVLGEEVANAWGKAYWFLAEILI... 136
430 2.000e-32UniRef50_UPI0009E50D0A globin C, coelomic-like isoform X1 n=3 Tax=Scleractinia TaxID=6125 RepID=UPI0009E50D0A  ali  17  22....LTDDQKNVIKKTWITIEEN------RTKIGKQTFIRVFELNPQIKKMMPEFMEELNSSRKLFGHSKTLMTCLENAVKSLDDNERFVAYLVELGRRHQVRP-LKAPYFEVIHEALMFSLKDVWTTETSESWSALFRYMSEAMIIGL 168
431 2.000e-32UniRef50_H1V620 Globin n=17 Tax=Sordariomycetes TaxID=147550 RepID=H1V620_COLHI  ali  16  3....LTYKQSQLVKGTIPALRE------HGETITSIFYANMLRAHPELHDHFNKVNQANGRQP------RALTGVILAFAANLNHISELIPKLERMCNKHCS-LGIQPEHYDIVGKYLIQAFGQVLGPEIREAWTKAYWLLAKMLI... 135
432 2.000e-32UniRef50_A0A132MU45 Nitric oxide dioxygenase n=4 Tax=Streptomyces thermoautotrophicus TaxID=1469144 RepID=A0A132MU45_9ACTN  ali  18  11.......EQARLIRESFQVIAQ------HGDRVALHFFAELFLRHPELRDLFPVAMSELRGG---------LFDAITTIVQRIVSTGTLVPFLQQLGRDHR-KYDIRTEHFAYVGEALMITLEEAWTPQVAEAWRSTYDLAAKVMLQAM 140
433 2.000e-32UniRef50_K0KJ85 Flavohemoprotein n=5 Tax=Phaffomycetaceae TaxID=115784 RepID=K0KJ85_WICCF  ali  14  1..MPLTDKQKEIITASIPFLESN------GVELTANFYAYMLETYPEVRPFFNKTHQKTKSQPKI------LAFALVNYAKNINDLTPLLGFVRQIVEKHVG-LQVTPEQYDIVGTCLLKTLSEMLGEEFIEAWKVAYFDLANILI... 135
434 2.000e-32UniRef50_UPI0009DC99C5 hypothetical protein n=1 Tax=Myxosarcina sp. GI1 TaxID=1541065 RepID=UPI0009DC99C5  ali  20  1........................................MFTAYPEAQPLF--------ANTNMAKQKKMLVSSLVLVVENLRNPDVLTSSLKGLGARHV-KYGALPAHYPLVGNALLTTFEDKWTPDVKQAWVDAYGAITEIMLDG. 103
435 2.000e-32UniRef50_UPI0008247F59 NO-inducible flavohemoprotein n=2 Tax=Bacillaceae TaxID=186817 RepID=UPI0008247F59  ali  17  18....LDPEKLEIVKATLPVVLE------HGEAITTRFYERLFENHPELKNVFNLTHQKTGHQPKALANAV------YAAAANIEDMSAIMPALERIGQKHRS-LQIKPEQYPIVGENLLGAIKEILGPEIIDAWADAYTIIADVFIK.. 151
436 2.000e-32UniRef50_A0A1X6PD63 Uncharacterized protein n=1 Tax=Porphyra umbilicalis TaxID=2786 RepID=A0A1X6PD63_PORUM  ali  18  4....LSDDTVRIVKSTAPVLK------VHGGAIVDGFYALLFEQHPAAAAYFNVVPTXXXXXXXXKAQIQRLSMAVLLYAESIDQLDTLGPVLERISAKHASR-GIPAEFYPAVGACLLQSIGRVLGPEIVGAWGEAYGFLADALMA.. 149
437 2.000e-32UniRef50_A0A2C6Y0J1 NO-inducible flavohemoprotein (Fragment) n=1 Tax=Roseomonas rhizosphaerae TaxID=1335062 RepID=A0A2C6Y0J1_9PROT  ali  14  4...PLSEQTIAVVKATVPALE------VHGLALTRRMYERLFQNA-SIRDLFNQSHHGETGS-----QPKALAGAVLAYAQNIDNLGVLAGAVERIAQKHVG-LNILPEHYPHVADALLGAIRDTLGPEILAAWGEAYWFLADLLI... 137
438 2.000e-32UniRef50_UPI000BBD572A neuroglobin-like n=5 Tax=Euteleostomi TaxID=117571 RepID=UPI000BBD572A  ali  17  23...HLSKEQKELIKDSWSKIQQDVTKA------GIIMFVRLFENHPECKDFFSFRNVEDPRSRELRAHGLRVMSFLEKSMARIDKPERLEKLVLELGRKHY-HYHSNPKYYMYLGLEFINVLKDSWTSELEEAWKTLFLYLTQMMRLG. 168
439 2.000e-32UniRef50_A0A143PM95 Nitric oxide dioxygenase n=1 Tax=Luteitalea pratensis TaxID=1855912 RepID=A0A143PM95_9BACT  ali  21  13.....TRTQRDLVRQSLDRLTVDA------VPVTLLLYGKLFELDPSARRLF---------HNDLAVQGRKLMDTLDAVASSLDNLESLRPRLLQLGRRHAD-YGVGPADYDRLITALLWAFAQALGPDTREAWRVALSAVAAVMQEG. 143
440 2.000e-32UniRef50_A0A1H8K2Y1 Nitric oxide dioxygenase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1H8K2Y1_9BURK  ali  17  2....LSVEQKAIITATVPILEQ------GGETLTRHFYLTLFRDFPHVKPFFNQANQQDGN------QQRALANAVLMYAKNIDRLEQLGPLVSTIVNKHVS-LQIQREHYPLVGASLLKAIREVLGDAVIDAWAAAYGQLADILAGA. 137
441 2.000e-32UniRef50_A0A0J9V4N9 CMGC/CDK/CDC2 protein kinase n=1 Tax=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) Ta  ali  21  30......PEQIKVVQSTIPALEK------HGLEITTLFYRQLLNKHPELKNIFNTAHQDTGEQPAALAH------AVWAYAANIENPEAMKAAISRIGHKHAS-LGVTADQYPIVGQGLLSAIKQILGDEVLDAWDAAYYQLAEYFI... 160
442 2.000e-32UniRef50_A7ICZ3 Globin n=17 Tax=Rhizobiales TaxID=356 RepID=A7ICZ3_XANP2  ali  18  1....MHDDQIGLLETSFAELSTDRDAA------AALFYERLFVLDPALKRLF--------GDTDMAGQGQKLFAALDLVVASLRHLDKVVPVLEQLAVRHV-HYGVRDAHYATVGAALIETLSLYFGPELRRAWSDAYEVVAGVMIAA. 133
443 2.000e-32UniRef50_A0A0B6YLQ8 Uncharacterized protein (Fragment) n=4 Tax=Gastropoda TaxID=6448 RepID=A0A0B6YLQ8_9EUPU  ali  18  2................................VGVVMFIKLFETHPEVQNVFVPFKGQSKENTQLKSHALRVMGTVEKCVTRFQDPERIRQMLHELGARHV-MYNAKVDYMDLIGPQFIWAIEDRWTPEVEQAWSDLFKYISYIMKDAM 125
444 2.000e-32UniRef50_UPI000B5A9DAB hemin receptor n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A9DAB  ali  18  3......PHQHHLVRESWKKLSPIRDTA------AELFYQRLFSVYPELAPMFK---------GDMKVQGEKLMQMLDKAVDSLENMESSIEPLKQAGRAHRS-YGVNEEDYEKFANCLFWTMKEGLGKATREAWANTYATLSSIMIEG. 132
445 3.000e-32UniRef50_UPI00076FDDE3 hemoglobin-2 n=1 Tax=Neodiprion lecontei TaxID=441921 RepID=UPI00076FDDE3  ali  23  23....LTGKQKRLVTETWGIMRQDP------MKLGIAVMMRLFTKHPEYRSQFHAFKDDLPKNKRFQAHASAIANALSTIIDSLKDPGLLEAILISLGEKHHKR-GQTVEQFNNLKLVLLVVFKERWTPEVNNAWSKALDFVYSIIFK.. 166
446 3.000e-32UniRef50_A0A1N6R640 Nitric oxide dioxygenase n=1 Tax=Chryseobacterium sp. RU37D TaxID=1907397 RepID=A0A1N6R640_9FLAO  ali  12  1....MNTNQKNLIKATIPFLKTN------GTDLTKHFYATMLSENPELNNLFNISNQASGR------QQNVLANTVLAYAENIEKPTVLINILKGIGNKHVS-LNIHPEQYKIVGHYLISSIKAILGDEIIEAWTEAYNELAQIMIDGM 139
447 3.000e-32UniRef50_UPI0009B12FDE hypothetical protein n=1 Tax=Spirosoma rigui TaxID=564064 RepID=UPI0009B12FDE  ali  16  29...SMTPMQLAAIKSSWAL------AVPHADAVGKAFYANLFTIDATLRPMF---------ADDINGQSGKFVAMVTRLVNHLDDADTVTREITGLAQRH-THYGVRPAHYTTAGQALVQTLGEHWTPPVQEAWGALYQTIASAMIS.. 160
448 3.000e-32UniRef50_E9EJD6 Flavohemoprotein n=1 Tax=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) TaxID=655844 RepID=E9EJD6_METRA  ali  22  74....LTSEQMKIVQST------IPALEQHGMAITSLLHKRLLDSHPELKNVFNTTHQVTGEQPAALAH------AVWAYASNIDNPAALQTTLSRIGHKHAS-LGITPEQYPILGEGLLAAIKTVLGDQVLDAWGAAYEKLAEYCIR.. 207
449 3.000e-32UniRef50_A0A1W2DDC8 NAD(P)H-flavin reductase n=30 Tax=Actinobacteria TaxID=201174 RepID=A0A1W2DDC8_KIBAR  ali  18  35.........VRLIRESFAVVEPKAD------EVAKFFYGMLFSLSPNAREMFP---------ANMEVQRSRLLRALVHIVQLVDRPDDLNPFLRQLGRDHR-KFGVISAHYEAVGTALIAAVKKSWTDEIERAWAEAYTIMARAMLD.. 160
450 3.000e-32UniRef50_A0A0F8BJQ4 Cytoglobin-2 n=1 Tax=Larimichthys crocea TaxID=215358 RepID=A0A0F8BJQ4_LARCR  ali  16  149..EPLSDAEREIIQDTWGQVYKNCED------VGVSVLIRFFVNFPSAKQYFSQFPDEMERSSQLRHHARRVMNAINTVVENLHDPEKVSSVLALVGKAHALKHKVEPMYFKILSGVMLEVLSEDFTAEVQMVWTKLMGAVYWHVTGA. 297
451 3.000e-32UniRef50_Q6N3I5 Globin-like protein n=11 Tax=Rhizobiales TaxID=356 RepID=Q6N3I5_RHOPA  ali  22  7....LSPADIHRVRTSFDLMW------PRSTEMADQFYARLFEIAPDSRTLFRS---------DMTRMKDKFIQTLAVLVGSLDNLTGLYAVAGKLAVDHV-RYGVRPDHYAPVGEALLWSLGQQWNDDVEQAWRRVYAVISARMIGA. 138
452 3.000e-32UniRef50_A0A1K2FMD5 Flavohemoprotein n=84 Tax=Actinobacteria TaxID=201174 RepID=A0A1K2FMD5_9ACTN  ali  18  1....MSDSQ--ALRDSFALVGKSGDEVP------RYFYSYLFLIAPEVRPMFPV---------AMGAQRDRLVAALGRIVAEADDPDRLIPFLQQLGRDHR-RFQVVAQHYEAVGQALLATLADAWTPELQRGWTEAYSLVARTMIQA. 130
453 3.000e-32UniRef50_A0A2V1H1D9 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium Hp12 TaxID=2171752 RepID=A0A2V1H1D9_9FLAO  ali  18  1....MNNQQKSLIAYSWHHASKDPEK------LGRQFYNKLFLRHPELAPLFPK---------DLEAQQRKLMESISMLILGLDELDNMLEQIQELGERHHLVYQAKPEYYTLFGQVLIETIAQHWSDEIENAWQIIYQLVTNSML... 131
454 3.000e-32UniRef50_A0A2A8HZX9 Uncharacterized protein n=1 Tax=Novosphingobium sp. PC22D TaxID=1962403 RepID=A0A2A8HZX9_9SPHN  ali  18  4...PLSAKTIATIKASAPALQQ------HGVAITTRMYERLF-INPEIEAMFDRAAQESGEQP------RRLAGAILAYAQNADKLENLGGAVERMAARHVEA-GVRAEHYPLVAQALLPAIRDVLGDEASEAWGEAYWYLAEILINA. 138
455 3.000e-32UniRef50_UPI000CF4EDC8 hypothetical protein n=1 Tax=Rubritalea profundi TaxID=1658618 RepID=UPI000CF4EDC8  ali  13  5....LSTTMIETVKATIPFLQQN------GQALTEHFYKRMFAGNPEVKEFFNQANQKTGN------QQQALGAAICAFAQNIETPENLAEAVSRISNKHAS-LGIKPEHYPIVGEHQLDSIDDLLNPEILDAWAEAYGFLAGVLTGA. 138
456 3.000e-32UniRef50_UPI0006B0D619 non-symbiotic hemoglobin 2-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI0006B0D619  ali  21  21..ENLTPRQVELVRETWTLLSVDM------TATGIFIFNRFLTDYPELCDLFPFVSIAIWDDQGLERHALGVMQALEGAVNNLENTQLLSTILFDLGQKHA-RYNVEESMLDKLWRSLREALQEKMTDEVEHAWFCVFRFVARQMIDGM 169
457 3.000e-32UniRef50_Q5FSL1 Flavohemoprotein n=30 Tax=Gluconobacter TaxID=441 RepID=Q5FSL1_GLUOX  ali  12  6.DRSLTPETIAIIKAT------IPALEAHGVTITSEMYRRLLA-DPAIAEMFDPTHQSTGTQP------RALAMAVLAYAKNIDNLGVMGSAVERIAQKHAS-LEIQPEHYPHVATALLGAISSVLGPEILDAWGKAYWALADILI... 140
458 3.000e-32UniRef50_A0A2R8B772 Bacterial hemoglobin n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2R8B772_9RHOB  ali  19  4.....SARQSQLIRDSFAKLSDRLQPAS------MTFYEALFRRAPELREMFR---------DDLAGQGMKFMTTLGIVIENIDQTEKLGDRFAELGRVHALI-GVKAAHFEPMGEALIDTLREELGDEMEAAWRAAYAVLAERVIR.. 134
459 3.000e-32UniRef50_A0A0P6B1R4 Neuroglobin n=5 Tax=Daphnia magna TaxID=35525 RepID=A0A0P6B1R4_9CRUS  ali  18  89....LTDLQKTLLQQSWKRLEMDIAQ------VGIIVFINLFESHPDMQSVFLPFTDDLKKSKLLSEHALRVMGAVQRAVHRLEEPEKLHAFLSDLGRRH-DKNGAKLEYIDYIGPQFLSAIRPIWTAETEKAWTLLLGYMIATMKQAL 234
460 3.000e-32UniRef50_E0VN13 Globin D, coelomic, putative n=6 Tax=Hexapoda TaxID=6960 RepID=E0VN13_PEDHC  ali  19  38..PELTTREKELLIETWKELEENIAK------VGVITFVSLFETHPDVQESFMSFSGDLKHSKQLRAHALRVMAFVQKAVARLHEPEKLETLLKELGRKHVG-YGAKQKYVELVGPQFILALEKQWDEELDDAWTHLFKIIEFVMVSSM 185
461 4.000e-32UniRef50_A0A087UB53 Globin (Fragment) n=1 Tax=Stegodyphus mimosarum TaxID=407821 RepID=A0A087UB53_9ARAC  ali  22  27....LTPRQKDIVRNTWKSIRADTRNN------GIKLFLKFFEAYPEYQLLFKSFANDLPRNGRLLGHVTSVMYALNSVVDNLEDPECLIEILQKTGISHRPR-NVNRQHFNNLKVVLIKLLVEILGESAVEAWEKTLDVANSIIIKSL 173
462 4.000e-32UniRef50_A0A1Y0D3Y9 Flavohemoprotein n=14 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y0D3Y9_9GAMM  ali  15  2....LDSRTREIVKSTVPLLEAA------NTALTEHFYKRMFRDNPELKDVFNLSNQASGRQPA------ALFNAVLAYAKNIDNPAVLASAVERIAQKHTGFA-ITPSQYDIVGHHLLETIKEAATPEVIDAWAQAYGALAGLFI... 134
463 4.000e-32UniRef50_A0A2K9UYQ8 Globin-like protein n=1 Tax=Exaiptasia pallida TaxID=1720309 RepID=A0A2K9UYQ8_EXAPA  ali  18  20NEDSLTIDEKAILKKTWPHIQQ------HTTTVGLEVFSRFFKDHPDYQQLFPEFRNELSESKPLLGHSRRIMKAIDTAVVSIDNFETYEVYLLDLGCRHRER-QLKEIHLEHMRLAFVDTLQHRWNQETSLAWNKLFYLVSQTMLRGL 169
464 4.000e-32UniRef50_A0A239P0B9 Methyl-accepting chemotaxis protein n=2 Tax=Asanoa hainanensis TaxID=560556 RepID=A0A239P0B9_9ACTN  ali  17  10......QADAKLLTASLEVVADRAD------ALIASFYDRLFTEYPAVRPMFP---------ASMDAQHDKLLGAIVALVTNYEDPEALRPTLLALGAKH-DGWGVQPAHYTAVAGCLLATLREAFTPEVEGAWVRAYTFAAGTMMQG. 139
465 4.000e-32UniRef50_K2HBC4 Flavohemoprotein n=14 Tax=Bacteria TaxID=2 RepID=K2HBC4_9BACI  ali  20  9....LDERTREIVKATVPVL------AEHGEAITTHFYKRMLTERPELKNYFNMTHQKDGKQPRALANAV------YAAASHIDDLSAIAPAAETIAEKHVS-LNIRPEHYPIIGEYLLKAIKEVLGDEVIDAWELAYGEIADLFIS.. 142
466 4.000e-32UniRef50_A0A2W4IVZ0 Flavohemoprotein (Fragment) n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2W4IVZ0_9ACTN  ali  19  6..........RLLKESWALVE------DQQEEVAGYFYARLFLSNPELRDLFPV---------QMNVQRARLLKAIVRSIQTIDSPEQFDDYLRSLGRDHRKFL-VEPRHYDLVRDALLEALREHWSLAYEQAWRDAYDMIAARMQAG. 131
467 4.000e-32UniRef50_H3KC31 Nitric oxide dioxygenase n=8 Tax=Proteobacteria TaxID=1224 RepID=H3KC31_9BURK  ali  15  2....LTPNQISLVKATIPVLRE------HGVALTAHFYARMLKGNPELRQVFNQGHQRAGR------QQEALAAAVLAYAEHIENPAALLPAVEHIAGKHVSV-GIRAEHYPIVGRHLLASIQEVLGPELIEAWGAAYGQLAGILIE.. 135
468 4.000e-32UniRef50_A0A293MVL4 Uncharacterized protein (Fragment) n=2 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293MVL4_ORNER  ali  20  15.KTGLTPREKNLVRDTWALVRKDVKSN------AVAIFLMLFERHPSYQKLFSGFADQLASNPRLAAHAMSVAYALTALVDNLDDADCLVELVRKTAVNHTRRP-VTLQHFENTVVVIVDTLKERLGPAATAAWQKTLRLVVSV..... 158
469 4.000e-32UniRef50_A0A2A5HE23 Flavohemoprotein n=1 Tax=Alteromonadaceae bacterium TaxID=1916082 RepID=A0A2A5HE23_9ALTE  ali  15  4.............KESLPYIKASPVLREHGLTITTLFYKNMFAAHPELKHLFSRSSQAGG------AQQQALAGAVYAYADNIEKPEFLSSVLNRIAHKHAS-LGIKPAQYTIVGKYLLGAIAQTLGPELLDAWDEAYWLLAGELIA.. 135
470 5.000e-32UniRef50_Q87F90 Flavohemoprotein n=49 Tax=Proteobacteria TaxID=1224 RepID=HMP_XYLFT  ali  15  6.....SPHTITLIKSTVPLL------AEHGTTIIEAMYHRLFE-DPQIEALFNQANQKNGT------QIHALAGAILAYARNIDNPGVLASAIERISQKHVG-YAIHPEHYPHVATALLGAIKQVLGDEVLEAWGEAYWFIANLLKD.. 137
471 5.000e-32UniRef50_UPI00041900BD flavohemoprotein n=2 Tax=Pseudonocardiaceae TaxID=2070 RepID=UPI00041900BD  ali  21  26..........ELTRRSWAVVEPRAD------EVGSQFYAILFHIAPEVRDLFPV---------NLEVHRSRLIRALVHVAHQTDDMDELLPFLHQLGRDHR-KFGVRPEHYDAVTTALVGGIREAWTPEVEDAWRETLALAATAMRTA. 151
472 5.000e-32UniRef50_UPI00037A7EB7 flavohemoprotein n=2 Tax=Thiotrichales TaxID=72273 RepID=UPI00037A7EB7  ali  20  3.....TAESLAIVQATVGVVRE------YGADITRKFYSTLFAAHPELTNLFNMSNQASGE------QQQALASAVYAYAANIQNPTALEPILSRIAHKHAS-LGIKPAQYTLVGKHLLAAIKSVLGPEILAAWDEAYWLLA....... 130
473 5.000e-32UniRef50_A0A0L0FSV3 Uncharacterized protein n=1 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0FSV3_9EUKA  ali  17  46..PPLSQKTIDIVKSCAPVLE------VHGYDIAANMYKRMFANHPEVAELFNPSHQVPNKDGK-AMQPWGLSCAVHAYALYIDDLGMLAEAVERIAQKHVS-LDVLPEHYGIVGENLLWSIKDTLGPEIMAAWEEAYGFLAWVFIQ.. 186
474 5.000e-32UniRef50_UPI000DCA02CA globin-like isoform X1 n=1 Tax=Sipha flava TaxID=143950 RepID=UPI000DCA02CA  ali  24  3....LSPVQISRIRRSWSALAQDP------TELASALVIRMFKENPEYISLFKRLKDELQSNSQFKAHASKVGGALGATIDHLDKPEKLEELLTDIGIKHR-KYGLSPKHFEVIRNVLIAIIAEAIGPELLDLWKSSLTGVMSIIVAG. 146
475 5.000e-32UniRef50_V8QYU3 Dihydropteridine reductase n=33 Tax=Proteobacteria TaxID=1224 RepID=V8QYU3_9BURK  ali  15  7..TSLSPETVAIVKATVPALQ------THGSAITAKMYDRLFRDE-HIRSLFNHANQANG------KQINALAGAILAYASNIDNLGALLPAVERIAQKHVGFH-ILPEHYPYVATALLGAIGDVLGEAATEAWGEAYWFLAGIL.... 139
476 5.000e-32UniRef50_A0A0P5J1V4 Neuroglobin n=3 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5J1V4_9CRUS  ali  18  50....LTDLQKTLLQQSWKRLEMDIAQ------VGIIVFINLFESHPDMQSVFLPFTDDLKKSKLLSEHALRVMGAVQRAVHRLEEPEKLHAFLSDLGRRH-DKNGAKLEYIDYIGPQFLSAIRPIWTAETEKAWTLLLGYMIATMKQAL 195
477 5.000e-32UniRef50_A0A1R1EP31 Flavohemoprotein n=5 Tax=Bacillales TaxID=1385 RepID=A0A1R1EP31_9BACL  ali  17  2....LDSKTIEIVQSTAPVLKQHSEQ------IGKKFYELLFAKAPDLYNLFNQTNQKRGL------QQEALGYAVYAAGEHITNLDAIMPVITRVTQKHRAI-GVKPEQYPLVGETLLEAVKEVLGDEIIGAWGKAYEYIAEAFIQ.. 135
478 5.000e-32UniRef50_A0A292Z132 Flavohemoprotein n=16 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A292Z132_9PSEU  ali  19  25......ADTVATISRSWNLIEDRSD------ELGRHFYATLFHNAPETRDLFPV---------NMEVQRSRLLRALVHVVQMVDQLDELVPFLQQLGRDHR-KFGVLTEHYDAVGDALMSAVADSWTPDVEKAWNDAYAIAGTAM.... 151
479 5.000e-32UniRef50_A0A2G8BUM0 Nitric oxide dioxygenase n=1 Tax=Tatumella sp. OPLPL6 TaxID=1928657 RepID=A0A2G8BUM0_9GAMM  ali  14  2....LTTHQKQLIQQTIPVLQAN------GQALTDYFYHRMLSQVPELKETFNMGHQRDG------KQAKALANAVLAYAENIEDPSVLLPVINMICQKHVS-LNIQAPDYAVVGEHLLHSISEVLSDELISAWAIAYHQLADLMIE.. 135
480 5.000e-32UniRef50_A0A117RBN8 Flavohemoprotein n=126 Tax=Actinobacteria TaxID=201174 RepID=A0A117RBN8_9ACTN  ali  23  2.......................AEVGPVADKVTSYFYALLFVRHPGLRPLFP---------PAMDAQRDRLLKALLTAAEHIDNTPVLVEYLQNLGRGHR-KYGTRAEHYPAVGECLIGALNKVWDADTEAAWVRTYTTISQVMIDA. 120
481 6.000e-32UniRef50_A0A2T6AXA3 Nitric oxide dioxygenase n=1 Tax=Roseivivax pacificus TaxID=1267769 RepID=A0A2T6AXA3_9RHOB  ali  19  2....LPEETKTRIRGTIARLTCYPQDLAYG------FYDRLFERAPETRALFK---------DDIGSQADKLMDTLMVVVQSLDKLAGLVTFVEALGRQHA-RHGVTDDMYPVVGDVLIDTVAEDWSDADRAAWYELYNYLSDLMITG. 132
482 6.000e-32UniRef50_A0A168BN42 Flavohemoprotein n=5 Tax=Hypocreales TaxID=5125 RepID=A0A168BN42_9HYPO  ali  18  3....LTPSQVTIVKSTAAVLK------DKGGEITRIFYANMLAAHPELRNLFSLRNQATGAQQAALG------AAVLAYAAYIDDLPRLQSAVERIAHKHASLF-VRPEQYAIVGEHLVEVLGDALTPEVADAWTAAYAQLADVFI... 135
483 6.000e-32UniRef50_A0A1E5P946 Flavohemoprotein n=1 Tax=Streptomyces agglomeratus TaxID=285458 RepID=A0A1E5P946_9ACTN  ali  22  2.......................ADVGEDAGKVTSYFYALLFTRHPELRSLFP---------AAMDTQRDRLLKALLTAAEHIDNKPVLTEYLRNLGRGHR-KYGTQASHYPAVGEALLGALARTWDDEAEAAWIRTYTAISQIMIDA. 120
484 6.000e-32UniRef50_S8BSP3 Uncharacterized protein n=2 Tax=Orbiliaceae TaxID=47021 RepID=S8BSP3_DACHA  ali  18  11.....TPEQAAIVKSTVPVLEQ------YGVTITSTFYQNMHRDIPELHEIFNQANQKNG------HQARALATAVLAYAKYIDNLSVLGEAVELICQKHASLL-IQPGHYDIVGKYLLAAIKEVLGDEIVSAWGACYWQLAYIMID.. 143
485 6.000e-32UniRef50_A0A1I2UKR5 Flavohemoprotein n=5 Tax=Oceanospirillaceae TaxID=135620 RepID=A0A1I2UKR5_9GAMM  ali  17  6.........IEIIKQTVPVIQERGE------EITQHFYHLLFEENPELKDVFNMASQSNGRQPA------SLANAILGYAANIDRLAALGDAVNNIATKHFS-LDIQPEQYPIVGRNLLKAIREVLGDDVINAWAEAYGQLANILIGA. 136
486 6.000e-32UniRef50_A0A2K8PFV7 Ferredoxin--NAD(P)(+) reductase (Naphthalene dioxygenase ferredoxin-specific) n=99 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2K8P  ali  19  27........DAVLIRRTLTEIAPVAD------RVTSYFYALVFTGHPEVRGMFP---------AAMDVQRDRLLKALLTAAEHIDDPAVLTPYLRRLGTGHR-KYGTMAGHYPAVGEALIGALERTWGPETQAAWVRAYTAISQIMI... 152
487 6.000e-32UniRef50_A0A0V1PQ05 Uncharacterized protein (Fragment) n=1 Tax=Debaryomyces fabryi TaxID=58627 RepID=A0A0V1PQ05_9ASCO  ali  16  14....LTTREKELINASLPILEESGEI------LTSQFYTNMLADFPEVRPFFNESDQRTMKQPRI------LAFALLNYAKNIDELAPLTAFVNQIVVKHVG-LQVKPEHYPIVGKCILDTMKSLLGPEFLTAWATAYGNLAQMLINA. 149
488 7.000e-32UniRef50_P13578 Extracellular globin-2B n=6 Tax=Polychaeta TaxID=6341 RepID=GLB3_TYLHE  ali  34  1.DDCCSAADRHEVLDNWKGIWS-AEFTGRRVAIGQAIFQELFALDPNAKGVFGRVNVDKPSEADWKAHVIRVINGLDLAVNLLEDPKALQEELKHLARQHRERSGVKAVYFDEMEKALLKVLPQVSSHFNSGAWDRCFTRIADVIKAEL 147
489 7.000e-32UniRef50_A0A1S6J0W9 Neuroglobin (Fragment) n=4 Tax=Sternopygoidei TaxID=1489621 RepID=A0A1S6J0W9_EIGVI  ali  24  2.......KDKQLIRDSWESLGKN------KVPHGIVMFTRLFELDPALLSLFSYVASDCLSSPEFLEHVTKVMVVIDAAVNHLDDLHSLEDFLLNLGKKHHDV-GVKTQSFAVVGEALLHMLQCSLGAALRQAWLNMYSIVVSAMTRG. 144
490 7.000e-32UniRef50_A0A2A4VU89 Hemin receptor n=1 Tax=Kordiimonadales bacterium TaxID=2030814 RepID=A0A2A4VU89_9PROT  ali  18  1....MTPDDVAKLQYSFGQM------VPKKDEIAKVFYERLFEVAPAVRPLFK---------GSIEEQGQKLVMALRQIVLSLKQPNELTTFLKGLGERHVG-YGAVAAHYDVVGGVLLWTFENVFTPELKELWGGAYGVISAAMQEA. 132
491 7.000e-32UniRef50_A0A0D6MNJ7 Oxidoreductase FAD-binding domain-containing protein n=1 Tax=Tanticharoenia sakaeratensis NBRC 103193 TaxID=1231623 RepID=A0A0D6M  ali  16  4...PLDENTRSIIKA------CIPALEVHGLAITTEMYRRLL-IDPDIRSYFNLSHQADGS------QARALAGAVLAYARHIDDPGVLGAAIERIAEKHVG-LTVQPGHYPLVGTAFLGAIGEVLGPEILEAWGHAYWFLADILIA.. 137
492 7.000e-32UniRef50_Q9FVL0 Non-symbiotic hemoglobin 1 n=44 Tax=Mesangiospermae TaxID=1437183 RepID=HBL1_MEDSA  ali  18  10.....TEEQEALVVKSWNAMKKNSA------ELGLKLFLKIFEIAPSAQKLFSFLKDSLEQNTKLKPHAMSVFLMTCESAVQLRKSGKVESSLKKLGANH-FKYGVVDEHFEVTKFALLETIKEMWSPAMKNAWGEAYDQLVNAIKSEM 156
493 7.000e-32UniRef50_A0A2T7P6M8 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7P6M8_POMCA  ali  22  22.....SENQIDAIRSTWPVLSRD-------VRVGVEVFKRIFREMPSVFELFGQRVEDLHTLPTFREHATKFMGVLASLVDNLEDPHEVDEALLLLGAKHATFNGFHPEYFTSFGKCMLDAWEMELGEEVRESWRLLFDYIMTRMKQG. 167
494 7.000e-32UniRef50_A0A1L7T827 Probable flavohemoglobin n=21 Tax=Fusarium TaxID=5506 RepID=A0A1L7T827_FUSMA  ali  17  1..MSLTTSQVDIVKSTAPVLK------IHGETITSLFYKNLIGTYPELRNIFNLSHQHDG------AQAKALAGAVLAYATYIDKPEFLASTIERIAQRHVS-LKVTEDQYALVGEQLIKAIGEVLGDDIADSWTAAYGQLANIFI... 135
495 7.000e-32UniRef50_A0A0T9LRJ3 Flavohemoprotein n=20 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0T9LRJ3_9GAMM  ali  13  2....LDSQTIATVKSTIPLL------VETGSKLTEHFYDRMFAHNPELKDTFNMSNQFSGD------QREALFNAICTYAANIENLATLLPAVERIAQKHTS-LSIQPADYQIVGKHLIATLDELFSPEVLDAWAKAYGVLADVFIQ.. 133
496 8.000e-32UniRef50_UPI0002B46EBE flavohemoprotein A-like n=1 Tax=Hydra vulgaris TaxID=6087 RepID=UPI0002B46EBE  ali  18  11...CLSESSIRLLKSTSAILS------TEGTKVTSRMYEIMLSNYPIVKNLFNTSHVKNGNSNTVAPQAQALANAVFRFAANADNLTALQDMLKLIAHKHVSF-NILPEHYPIVGNCLLRAIKDVLTNEVMEAWREGYDYLADLFIK.. 152
497 8.000e-32UniRef50_A0A0T6B576 Uncharacterized protein n=2 Tax=Scarabaeidae TaxID=7055 RepID=A0A0T6B576_9SCAR  ali  18  20....LTPREKSLVVSSWNLVKKDPAGN------GVELFRMFFEKKPEYQNYFPFPMDKLVNDPKLKAHAVSVMYAISSVIDNLDNSEVLITLLQKTGDSHRRR-KIPEESFNILHRTMLELLEKGLGSEGLDAWDKTLTVAFKVVKDTL 164
498 8.000e-32UniRef50_A0A0P9TRY3 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=1 Tax=Pseudomonas amygdali pv. dendropanacis TaxID=235272 Re  ali  16  28....LSTAHHDIIKATVPILE------TGGEALTTHFYRIMLNDYPQVRPLFNQANQANG------AQPRALANAVLMYARNIDRLENLGPLAAQIVNKHVA-LQILPEHYPIVGACLLRAIREVLGDAVIDAWAAAYQQLADMLINA. 163
499 9.000e-32UniRef50_A0A2R8A7H0 Bacterial hemoglobin n=4 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2R8A7H0_9RHOB  ali  23  5......DSDIRLVRKGWATAVAAADQT------AQSFYANLFRIAPGTRPLFR---------EDIDVQGRKLVETLDFIVDHLDELDTLLPAARDLAIRHTA-YGVQTEHYDHVGTALITTLQDLLGDEDQAAWTRVYGTLSGQMIAA. 134
500 9.000e-32UniRef50_UPI000A3A41A6 flavohemoprotein n=4 Tax=Streptomycetaceae TaxID=2062 RepID=UPI000A3A41A6  ali  18  74...........LIRRTLAEIEPSADKAV------SYFYALLFLRHPGLRALFP---------AAMDTQRDRLFRALLTAARHVDDTATLTEYLSQLGRGHR-KYGTESAHYPAVGECLIGALRDSWNADAEAAWVRAYTAISQIMIDA. 198
501 1.000e-31UniRef50_A0A0K8RR11 Uncharacterized protein (Fragment) n=10 Tax=Ixodoidea TaxID=297308 RepID=A0A0K8RR11_IXORI  ali  19  48.KTGLTPREKGLVRDTWALVRKDVK------ANAIAIFLTLFQRHPEYQKLFSGFADALSTNPRLGAHAMSVAYAITSLVDSLDDAECLVELVRKVAVNHTRRP-VSVTHFENLTVVIVDTLKERLGPAAVAAWEKTLRLVVTV..... 191
502 1.000e-31UniRef50_A0A0J9XAH5 Uncharacterized protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XAH5_GEOCN  ali  19  38........EIAEIRQSWASMRDDQLEVSQEKAFCQQFYENLLGEYPELSVLFPS----------IKSQASSMAGILALVISQLDNLPRVREVLISLGKRHSRIIGVEVTHYELVGNALLRTLQDEFTPELENAWIKFFTYITNLMLQA. 179
503 1.000e-31UniRef50_UPI0008D21D70 NO-inducible flavohemoprotein n=1 Tax=Rosenbergiella nectarea TaxID=988801 RepID=UPI0008D21D70  ali  17  2....LTSQQKKIIQQTIPILKAN------GTVLTDYFYHRMLSQVPELRETFNMGHQRDG------KQAKALANSVLAYAENIDDPSVLLPVITMICQKHVS-LNIQAPDYSIVGEHLLHSISEVLSDELIGAWGAAYQQLAALMID.. 135
504 1.000e-31UniRef50_UPI000771BB3A cytoglobin-1 n=1 Tax=Cephus cinctus TaxID=211228 RepID=UPI000771BB3A  ali  28  21.DTGLTGKQKKIIQSTWITISKDSATS------GAAIMLALLKKYPEYQKLFTAFSDDLKNNPKFRAHGSGIINALSSAINSLDDSELLAAKLTMLGERHATR-GQTKEQFNDLKPIILEVLKEKFTSEVSEAWSKLIDGAYTFIFKG. 168
505 1.000e-31UniRef50_A0A1H3TY46 Methyl-accepting chemotaxis protein n=1 Tax=Asanoa ishikariensis TaxID=137265 RepID=A0A1H3TY46_9ACTN  ali  16  10......QADAKLLNASLEVVADRAD------ALIASFYDRLFTEYPAVRPMFP---------ASMDAQHDKLLGAIIALVTNYENPEALRPTLLALGAKH-DGWGVQPAHYTAVAGCLLATLREAFTPEVEGAWVRAYTFAAGTMMQG. 139
506 1.000e-31UniRef50_A0A1G6VJH5 NAD(P)H-flavin reductase n=5 Tax=Rhodococcus TaxID=1661425 RepID=A0A1G6VJH5_9NOCA  ali  16  1....MDSTTISLVRTTFKDV---AAVEDGPARLTRDFYATLFAQSPAAREFFP---------AAMDVQRDRLVQAIAYVVDKLDEPERILPFLAQLGRDHR-KYGIEEAHYIAVGNALITALREMWTEEVDNAWREGIALIASTMIDA. 136
507 1.000e-31UniRef50_W7YVL1 Flavohemoprotein n=2 Tax=Bacillus TaxID=55087 RepID=W7YVL1_9BACI  ali  18  4......QETIKTIKATAPVL------AEHGLAITTHFYTLLLEQHPELWHVFNHANQKRGI------QQQALADSLYAAAVHIEQLEAIVPVVKKIAHKHRSI-GVQAEHYPIVGDYLLKAMKDVLTDSILTAWEEAYSVIAKLFIE.. 135
508 1.000e-31UniRef50_UPI0009DA4C24 hypothetical protein n=1 Tax=Pannonibacter phragmitetus TaxID=121719 RepID=UPI0009DA4C24  ali  22  10.....TPEQIRLVQASFDRLR------PQGASIVSGFYCRFFELSPTLRPLFR---------TPLPAQELRLLEALSAVISMLSNLQMLLPELEALAKRHVT-YGVSAAHYHAAGDALLWTLEEAFTPAVRSSWIAAYATLSDIMIA.. 139
509 1.000e-31UniRef50_A0A1Z4J4C8 Globin domain protein n=2 Tax=Scytonema TaxID=1203 RepID=A0A1Z4J4C8_9CYAN  ali  21  171..........DLLEKSFATIK------PRAQEFVASFYENLFIAHPEVKPLF--------ANIDMVTLQKKLLNALILVVENLRNPESLGQVLSALGARHVG-YGALPKYYPAVGEALLTTFEQYWTPEVKQAWVNAFRAITAGMLQG. 297
510 2.000e-31UniRef50_UPI000D729BE4 neuroglobin-like n=1 Tax=Pomacea canaliculata TaxID=400727 RepID=UPI000D729BE4  ali  22  22..DFLTVEEIEVIRHTWAIVKQDIPGT------GMFMFTRLFELQSDFKKFFKRMMTQTETGEKLGNHANVVMTALDKAVDSLDDSSFLSKGLAELGERHK-MYNVKPYMWPAVRDALKKALAEDFTVEAELAWKHVFDYIVSKMAQGI 171
511 2.000e-31UniRef50_P04243 Hemoglobin subunit pi n=82 Tax=Amniota TaxID=32524 RepID=HBPI_CAIMO  ali  16  3....LTQAEKAAVITIWTKV------ATQADAIGAESLERLFSSYPQTKTYFPHF-DLSQGSTQLRGHGSKVMNAIGEAVKNIDD---IRGALAKLSELHAYILRVDPVNFKLLCHCILCSVAARFTPEVHAAWDKFLSSVSSVLTE.. 139
512 2.000e-31UniRef50_A0A132AHZ9 Cytoglobin-1-like protein n=1 Tax=Sarcoptes scabiei TaxID=52283 RepID=A0A132AHZ9_SARSC  ali  21  1..MSLTNRDKEIIVSTWSLIRKDSDQA------GIHLFKRFFEANPDYVKYFPFGDLDDLEDPRLKWHASRVMAALSTIVDNLDDPVCFEDSLQKVLSSHLNR-KIQLYHFENLKKALVCLFMDKLGPETIEAWSKAYDVILDT..... 144
513 2.000e-31UniRef50_A0A1H8TRS9 Flavohemoprotein n=197 Tax=Bacteria TaxID=2 RepID=A0A1H8TRS9_9RHIZ  ali  15  3..QTLTETTKAIVRATVPAL------TTNGTEITAAMYKRLFENS-NVRDLFNQSNQGEEG-----RQTKALAQAILAYAQNIDNLAVLTGAVERIAQKHVG-LHIRPDHYPHVATALLGAIRDVLGDDILNAWGEAFWFLANILI... 137
514 2.000e-31UniRef50_A0A178XDP2 Ferredoxin--NAD(P)(+) reductase (Naphthalene dioxygenase ferredoxin-specific) n=120 Tax=Actinobacteria TaxID=201174 RepID=A0A178X  ali  19  33.........VQLIRDTWAK------SEPYAPEISQFFYGMLFTLAPATRDFFPI---------NMEVQGGRIIRALARVVQMVDRPDDLLPFLRQLGRDHR-KFGVAPKHYEAVGTALLAALKNHWTPEVERAWAEAFTIV........ 152
515 2.000e-31UniRef50_L9L0J9 Inactive rhomboid protein 2 n=1 Tax=Tupaia chinensis TaxID=246437 RepID=L9L0J9_TUPCH  ali  18  22.......AERKAVQATWARLYANCED------VGVAILVRFFVNFPSAKQYFSQFKHEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFPPETQRAWAKLRGLICSHVTAA. 165
516 2.000e-31UniRef50_A0A239HGU4 Nitric oxide dioxygenase n=2 Tax=Sphingomonas TaxID=13687 RepID=A0A239HGU4_9SPHN  ali  20  5....LSPVTVAIVKSTAPALQQ------HGVEITTRMYERLF-VDPAIKAMFDQAAQESGEQPK------RLAGAILAFAQNVDKLEALTGAVDRMARRHVET-GVKAEHYPVVAAALLPAIRDVLGDEVLAAWAEAYGMLADILIAGM 143
517 2.000e-31UniRef50_K1RJ02 Nacrein-like protein F n=1 Tax=Crassostrea gigas TaxID=29159 RepID=K1RJ02_CRAGI  ali  16  387.EPSLSEDQLELLEKSWNSIKVNIAN------IGVVAFMNLFQTHPEVKDAFLPFQQDMEHSAILRSHALRVMGTVDKCLTRIRTPEKLQSLMHELGERHVN-YSAKYDFIDMVGGQFVHAIKDSWSEELGEAWVQLFRVLCYYMKKGM 535
518 2.000e-31UniRef50_O04985 Non-symbiotic hemoglobin 2 n=48 Tax=Mesangiospermae TaxID=1437183 RepID=HBL2_ORYSJ  ali  21  18.....SEEQEALVLKSWAIMKKDSAN------IGLRFFLKIFEVAPSASQMFSFLRNSLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVDTTLKRLGATH-FKYGVGDAHFEVTRFALLETIKEMWSPAMKSAWSEAYNQLVAAIKQEM 165
519 2.000e-31UniRef50_W7T570 Cysteine desulfurase n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7T570_9STRA  ali  20 1391..GVLGPQAIQLVQSSFEVIKPAGD------AFCTCFYDRLFSQHPELETHFRY--------TDMKHQHASLLSALVLVIQELLDPSSLRSRLLQLGKRH-FYYGASPAHYGHVGAAMLWALSTHLGEEIHDAWSDTITFIATVMIEG. 1525
520 2.000e-31UniRef50_I1XFU2 Flavohemoprotein (Nitric oxide dioxygenase) n=1 Tax=Methylophaga nitratireducenticrescens TaxID=754476 RepID=I1XFU2_METNJ  ali  12  1....MKPETFDIIRQTVPVLEQHGEL------LADCFYKNMFHNNPEVKAFFNPAHQHSG------AQQRALAATICAYARHIENFDQLQQLIGLISQKHVSF-GIKPEHYPIVENHFLLALREVMGEEVIEAWTEAYGVLAGIFID.. 134
521 2.000e-31UniRef50_A0A220SM61 Flavohemoprotein n=18 Tax=Bacteria TaxID=2 RepID=A0A220SM61_9GAMM  ali  18  2....LTADQLAVIQQTVPVLQE------HGETLTRHFYQRLFRENPEVKAYFNPAHQRSGS------QQRALAGAICAYAQHVDNPAALMGAVELIAQKHAS-LGIRPEHYPIVGANLLASIREVLGEAASD................. 116
522 2.000e-31UniRef50_UPI0009B763A7 hypothetical protein n=1 Tax=Bradyrhizobium elkanii TaxID=29448 RepID=UPI0009B763A7  ali  20  47........QQELVQTTFARLAAMPEVT------GALFYERLFASNPNFRPLFRN---------NMRIQGVKLMTMLAMVVYNLPAQDQLSPAIHDLALRHVE-YGVKLEDYDAMREALLWTLEEDLTPAVREAWTVCYDELAGEMKAA. 174
523 2.000e-31UniRef50_T0RU19 Globin n=3 Tax=Oligoflexia TaxID=1553900 RepID=T0RU19_9PROT  ali  16  4........DINMIRSSFEKAKPIA------GDVANKFYEFLFQDYPASKGLFTDVN--------MAAQKKALINSLVYIVDHLEDGEKLTNYLKKMGSRHVN-YGTEPEHYSWVGQSLLKTFADEWTPELKSQWTQAYTFIAETMLEG. 132
524 2.000e-31UniRef50_A0A0S8BHN5 Uncharacterized protein n=1 Tax=Acidithiobacillales bacterium SG8_45 TaxID=1703383 RepID=A0A0S8BHN5_9PROT  ali  18  1....MTPRQIMLVQATFEQ------SRTRSRIIGERFYRRLFTRYPEIRELF---------SGDIEDQAGKLIRMMAVLVDSLDRPAETADILFELGIRHQA-YGVRQEHYYAAGRIFLWAIKPAFSPEIKQAWMAFYEMIVRQMIEA. 132
525 2.000e-31UniRef50_A0A0L8LEY7 Flavohemoprotein n=1 Tax=Streptomyces viridochromogenes TaxID=1938 RepID=A0A0L8LEY7_STRVR  ali  22  2.......................AEIEPIADRVTSYFYALLFLRHPGLRDLFP---------AAMDTQRDRLFNALLTAATHADDTATLTTYLTHLGRGHR-KYGTLPEHYPAVGEALLGALARHWGPRTEAAWVGAYTTISQIMIDA. 120
526 2.000e-31UniRef50_Q6WZ20 Neuroglobin n=9 Tax=Cercopithecinae TaxID=9528 RepID=NGB_MACMU  ali  21  7..........ELIRQSWRAVSRSP------LEHGTVLFARLFALEPDLLPLFQSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAV-GVKLSSFSTVGESLLYMLEKCLGPATRAAWSQLYGAVVQAMSRG. 147
527 2.000e-31UniRef50_UPI000C04E0A3 neuroglobin-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C04E0A3  ali  21  30...PLSHEQKNTLREFWKLV------DPVKSVIGKNMFKRLFECNPRVQDIFPAFKEDVINSRSLYLHVRRVMAALENALLSLNDAEVFMEYLKNLGERHKP-WSVRLEHFDMIEEALIWTLKDSFTDYIAETWRELFRFITANVMKGL 176
528 2.000e-31UniRef50_A0A0B6YIN5 Uncharacterized protein n=4 Tax=Mollusca TaxID=6447 RepID=A0A0B6YIN5_9EUPU  ali  19  21...YLTARQLELVQDTWDVMKQDLP------TLGLTVFVKLFQTEPDLKRLFPKIVQMNEKNEMLQRHAVTVMEGLGAAVESLDDSDFLNSVLVSIGQTHVRRS-VKPQMWPSLNHGFEKILGEQYTKETMEAWRRLYNYIIFQMKKGM 171
529 2.000e-31UniRef50_Q9NPG2 Neuroglobin n=125 Tax=Amniota TaxID=32524 RepID=NGB_HUMAN  ali  21  7..........ELIRQSWRAVSRSP------LEHGTVLFARLFALEPDLLPLFQSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAV-GVKLSSFSTVGESLLYMLEKCLGPATRAAWSQLYGAVVQAMSRG. 147
530 2.000e-31UniRef50_A0A246WU54 Flavohemoprotein n=19 Tax=cellular organisms TaxID=131567 RepID=A0A246WU54_9BURK  ali  18  2....LTDAQLAIVKSTVPLLE------SGGEALTTHFYKMLMRDYPQVRPLFNRTHQASGDQP------RALANGVLMYARHIDRLEALGPLAAQIVNKHVAV-QIMPEHYPMVGDCLLRAIREVLGDAVIDAWGAAYGQLADILIGA. 137
531 2.000e-31UniRef50_A0A2U8HHM8 Hemin receptor n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2U8HHM8_9RHOB  ali  16  7....LTPQHITDIRLSWQVLASDAD------GFASGFYHRLFRRDPDLGPLF--------ASTDLPAQRRKLIAAIALVVRHADDLSPVLGPLAELGARHLG-YGVKTSDYTTVGGALIETMEAAFTPEVRDAWLTAYGAVAGTMM... 137
532 2.000e-31UniRef50_A0A1Z4SBX9 Globin domain protein n=3 Tax=Nostocales TaxID=1161 RepID=A0A1Z4SBX9_9NOSO  ali  21  189.........VDLLEISFEKIKPCAE------EFAASFYENLFKAHPEVKQLF--------TNIDMVNQHKQLLNSLVLVVENLRNPEALVPVLKALGRRHVA-YGAIPRYYGPVGDALLVTLQEDWTHEVKKAWVDAFRAITALMLKG. 316
533 3.000e-31UniRef50_A0A1T4TGD9 Hemoglobin-like flavoprotein n=9 Tax=Nocardiopsaceae TaxID=83676 RepID=A0A1T4TGD9_9ACTN  ali  17  25.......................ADLPEDSVELAERFYDHLFELVPEIRSMF---------SKDMGPQHLRMSRALLGVIRHLDQPEEVQEELRRLGARHHTALGVKPEHYPYVGRAMVRAVSETWSSRMSSSWVTVYEWIAASMMSG. 143
534 3.000e-31UniRef50_A0A2W6E4M4 Flavohemoprotein n=1 Tax=Pseudonocardiales bacterium TaxID=2201155 RepID=A0A2W6E4M4_9PSEU  ali  15  32..........EAITHTFSLVNQAGDRAV------AYFYGRLFAENPELRPMFP---------AAMDAQRDRLFHALTRIVHGLSSPEAMEPYLSQLGLDHR-KYGVLTEHYPAVGRALLATMGDAWTPGAEAAWAGAYERATQLMTAA. 157
535 3.000e-31UniRef50_A0A2M9JPB5 Flavohemoprotein n=13 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2M9JPB5_9ACTN  ali  20  23..........ALIRSSLAVAERRAE------ALTKYFYAHLFKHNPGVRAMFP---------ERMEEQRDRLFAALTMAILNLEDTDALVGHLHTLGFDHR-KFGTRIEHYPAVGRSLIAALKSAWTPKTEAAWRAAYELISKIMIAG. 148
536 3.000e-31UniRef50_A1ZN75 Neuroglobin n=2 Tax=Cytophagales TaxID=768507 RepID=A1ZN75_9BACT  ali  21  1....MTTQDINLVRNSWVSV------LAHRDEAGDIFYNYLFKQNPQVKRLF-------QSNTHIQNQ--KLMSSITLIVTKLNKLDNIKEEVKFLAKRHVN-YQVKPAYFTAFGNAFLYMLAQVWTHEMKTAWKKVYQLISQAMIEGL 133
537 3.000e-31UniRef50_A0A239E2Y4 NAD(P)H-flavin reductase n=4 Tax=Actinomadura TaxID=1988 RepID=A0A239E2Y4_9ACTN  ali  19  2........DAQRLKDSFDRVAEQGD------AVALFFYSDLFVRNPHLRDMFPVG---------MSGQRDKLLRALGHIVARVDDLPALVPFLQQLGRDHR-RFGIVAEHYPHVGASLLATLRDGWTDDVEGDWNAAYSLVAKVMLEA. 129
538 3.000e-31UniRef50_A0A2U1FLN9 NAD(P)H-flavin reductase n=1 Tax=Actinomycetospora cinnamomea TaxID=663609 RepID=A0A2U1FLN9_9PSEU  ali  22  188.........VSLIRQSWASIQHRSD------ELTKLFYAWLFRLSPETRELFPVT---------MELQRTRFLRGLLHVIQMVDRPEELSVFLRQLGRDHR-KFGVVDKHYDQVGEALVGALKEVWNNEIEQAWLGAYSLTASIMLDA. 314
539 3.000e-31UniRef50_UPI00048A457A flavohemoprotein n=1 Tax=Thermocrispum agreste TaxID=37925 RepID=UPI00048A457A  ali  20  2.........VRIIQASFAPVELRAD------EMAEHFYAVLFSLVPSARDLFPV---------NMQKQRTRLFRALVQLVEAADRPEELTPYLRRLGRDHR-KFGVRQEHFRAFGVALRAAVRTEWTDEVEQAWTQAYEVVARIMQEG. 128
540 3.000e-31UniRef50_S3FIT4 Globin family protein n=17 Tax=Bacillales TaxID=1385 RepID=S3FIT4_9BACL  ali  17  2....LDQQTIEIVKATAPVLK------DHGVAITSHFYKRMFANNPEVRQFFNHTNQQRGRQPEALANAVYAAAV------HIDRLEAILPAIQPALHKHQS-LNIRPEHYPIVGANLLGAIQDVLGPEIIDAWAKAYGVIADVFIS.. 135
541 3.000e-31UniRef50_UPI0006972C3D hypothetical protein n=1 Tax=Candidatus Hepatobacter penaei TaxID=1274402 RepID=UPI0006972C3D  ali  21  10....LSERKINIVKDCAPALK------GHGLSITSHMYDLMFQHHPEVFSLFNPVNNKTGEQPK------SLARAMLAYAEHIDDLAALGPRINQIAHKHVS-LDIKAEHYDVVGANLLKAIDDVLNPECLDAWQEAYAFLAQIFVQ.. 141
542 3.000e-31UniRef50_A1ZE02 Flavohemoprotein n=1 Tax=Microscilla marina ATCC 23134 TaxID=313606 RepID=A1ZE02_9BACT  ali  18  3.....SKENIAIVKSTVPVLE------TQIHTITQAFYKRLFKNHPQLKEVFNMTHQAKGSQPK------ALATAIFQYARYIEQPEVLKAAIAMIAEKHVS-LSVTPTQYEVVGENLLAAIKEVLGPEVLGAWAEAYGQLAQLLI... 134
543 3.000e-31UniRef50_UPI0006F39086 hypothetical protein n=1 Tax=Sphingomonas sp. Leaf20 TaxID=1735685 RepID=UPI0006F39086  ali  17  34...SLTADQIRLVRESYALISRSP------TRYSDAFYYRLLLDHPFARALFP---------DDMAHQIAVFSKSIDALVENVVDLGRLHPELSALALRHVQ-YGVKPYHYAVIGAVLIDTLADCFTPATREAWEAVYAETAGVMIA.. 165
544 3.000e-31UniRef50_A0A2M8WP56 Nitric oxide dioxygenase n=3 Tax=Yoonia TaxID=2211641 RepID=A0A2M8WP56_9RHOB  ali  16  1....MTPNQIETVKDSFQQIY------PVHEALSATFYDELFRIAPSVRPFF---------AEDMTEQRVKLSETLGAVVNNLHQLPLIADTVIGLARRHVS-YGAKPEHFAPVGHALIFALEKHLTEVETDAWVAAYTQISDLMTEAM 133
545 3.000e-31UniRef50_A0A0S2MLM4 Extracellular globin n=2 Tax=Siboglinidae TaxID=41324 RepID=A0A0S2MLM4_LAMLU  ali  41  22...YCSNADANLVINQWQQVSSPDAAAKSKLTGGQAVFKKLFALAPGAVDVFKRVNVDNFDSPEFSAHIMRVMGGLDILINYLNDPETLEQMLDHLAGQHAVREGVTAAAFELMANVLIGGLPKVVEDFNPDAWSNCLTPILNGIAAGL 167
546 4.000e-31UniRef50_A0A2E8EB56 Flavohemoprotein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E8EB56_9BACT  ali  17  44........EVQLLRDSF------VALTPRHGELLQTFYDTLFERYPQVRPLFAK--------NDMSEQRKNLGEAPALVVANLERPDVLTQTLHRMGARHVA-YGAEPPHYDAVGECLLHALAVTWNDELADAWAGAYGAVADLMKQG. 172
547 4.000e-31UniRef50_A0A142BGA4 Flavohemoprotein n=3 Tax=Endozoicomonas TaxID=305899 RepID=A0A142BGA4_9GAMM  ali  14  3....LSAETVQTVKATVPVLEE------HGVAIVEYFYKDMLSENPELLNVFNAANQRSGR------QQAALTGAIYAYAANIDNLDALTSTVQRIAYKHVSF-NILPEHYGIVGRHLIKAMAHVLGDRILDAWSEAYNYLASLFID.. 136
548 4.000e-31UniRef50_Q3SGG8 Flavohemoglobin n=14 Tax=root TaxID=1 RepID=Q3SGG8_THIDA  ali  16  2....LSAETLATIKSTAPLL------AEQGRAITDLFYSKLFSEHPELQHIFNMANQAQGE------QSRALAESVFMYATHIDALQKLGPMVSRIAHKHAS-LQVAPEHYPIVGKYLLEAIRDHLGLEVLGAWSEAYAQLADIFI... 134
549 4.000e-31UniRef50_UPI000C6C8E7A non-symbiotic hemoglobin 1-like n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6C8E7A  ali  17  27.....TYQQKVALVQTWNVLMENL------SRVGVIAFMRLFETHPDVQEIFIPFHESLRNSKELRAHALRVMSFVQKVVARLEQPRKLEMLLGELGKSHLN-YGAKAEYIEKIGPQFIYALEDHWNPGVENAWLQLFRYITHYMKVTM 171
550 4.000e-31UniRef50_A0A060WFV6 Uncharacterized protein n=4 Tax=Protacanthopterygii TaxID=41705 RepID=A0A060WFV6_ONCMY  ali  15  19..EPLTDPEREIIQNTWVHVYENCED------VGVSVLIRFFVNFPSAKQYFSQFQDEMERSVQLRHHARRVMSAINTVVENLHDPEKVSSVLALVGKAHAVKHKVEPMYFKILCGVMLEVFSEDFTAEVQMVWTKLMGTVYWHVTGA. 167
551 4.000e-31UniRef50_W4XUE2 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XUE2_STRPU  ali  23  19....LTKQQKALIKKSWTYVLED------KLRIGVIIFIKLFKAFPASQQLFEKLKDELARNKKMKAHATRVMAALTSLVENIDQPDILDELLRNTSVTHY-RMRMPPHYFEDLGEALVENLGDKFTPKTKEAWLIYYGYMCRI..... 160
552 4.000e-31UniRef50_A0A2V1AIR1 Uncharacterized protein n=1 Tax=[Candida] duobushaemulonis TaxID=1231522 RepID=A0A2V1AIR1_9ASCO  ali  14  11..QPLTTAQKELIKASVPILE------TSGLDLTKTFYNSMLSGNPEVRPFFNDTNQITYRQPKV------LAFALLNYAKNIDDLTPLTDFVNQIVVKHVG-LQVRAEHYPVVGSHLIATMGKLLGPEFVEAWSIAYGNLAQLLIDA. 148
553 4.000e-31UniRef50_V4ARY3 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4ARY3_LOTGI  ali  21  19..GYLTQREVDIVQKTWAILSTDMMGT------GVYMFQRLFEIQKDLQKLFSETADYFFDEVKLQSHAMIVMQGLGAAVESLDDSVYLTNILLTMGEKH-SQYNVQPEMWPAIRDALKHKLKEDFTPETELAWRHVFDYISSNMAEGI 168
554 4.000e-31UniRef50_UPI000A2B5033 plastid division protein PDV2 n=1 Tax=Arachis ipaensis TaxID=130454 RepID=UPI000A2B5033  ali  18  333.....TEEQEALVVKSWNVMKKNSA------ELGFKFFLKIFEIAPSAQKLFSFLKDSLEQNPKLKTHAVTVFVMTCESAVQLRKAGKVESNLKKMGATH-FRVGVVDAHYEVTKFALLETIKEMWSPAMKEAWSEAYDQLVGAIKSEM 479
555 5.000e-31UniRef50_A0A2W4LBT9 Uncharacterized protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2W4LBT9_9PROT  ali  15  3.....TDAQKQAIKKSWKLVVPIAETA------ADLFYKRLFELRPEYRRLFG---------DDMTSQKRKLIRMLAFIVKSLDWSDALLLVILALGRRHSELYKIPDESYDVVGEALLWTLGDAFTSEVRDAWAHVYTLLASAMKMA. 145
556 5.000e-31UniRef50_A0A2M9AL56 NAD(P)H-flavin reductase n=11 Tax=Streptomyces TaxID=1883 RepID=A0A2M9AL56_9ACTN  ali  20  5..........ERIRASFARVERRADH------VAKYFYSHLFARNPGVRELFP---------ADMSEQRDRLFAALTHVVQRLDDPD-LPRYLATLGRDHR-KFDARPEHYAAVGESLIAALRNTWDEETEQAWLGAYKVLSEAMIGG. 129
557 5.000e-31UniRef50_A0A2P1PMX0 Uncharacterized protein n=1 Tax=Ahniella affigens TaxID=2021234 RepID=A0A2P1PMX0_9GAMM  ali  19  53.QDLLSKTDHPILKHSLSNVASDPA------AFAGRFYANLFAAMPGLRVLFP---------ADLSEQQMKLAQTLAMVVSGLDESDAMVPLLRRLGAAHRG-YGTKPAHYQVVGDVLIKTLSDTWNDDLERSWQRLYQWVAANMI... 185
558 5.000e-31UniRef50_A0A2G2G493 Uncharacterized protein n=1 Tax=Arcobacter sp. TaxID=1872629 RepID=A0A2G2G493_9PROT  ali  15  1....MTQNTMEIIKATAPVIKE------HGEAITTAMYKLLFEAHPEAKELFKDAEPD---------QYKKLAAMVYAYAANIDNLGALGKGVEKVANLHVNV-NIEPKHYPWVGQALLGAIQEVLGPEIMNAWKEAYFFLADVFI... 130
559 5.000e-31UniRef50_F6EYW1 Nitric oxide dioxygenase n=76 Tax=Bacteria TaxID=2 RepID=F6EYW1_SPHCR  ali  21  2..TQLTADTIAIVKATAPALRK------HGVEITTAMYARLFEDA-SIKDMFDQAAQESGEQPK------RLAAAILGYAENIDRLQALDGAVARMVQRHVET-GVKAEHYPKVAEALLPAIRDVLGAEVADAWGQAYWFLANILI... 136
560 5.000e-31UniRef50_A0A1G6VAC4 NAD(P)H-flavin reductase n=2 Tax=Glycomyces TaxID=58113 RepID=A0A1G6VAC4_9ACTN  ali  20  3........DAERLKKNWSLVASHGDQVP------LYFYSTLFLTHPETRDLFPM---------NMAAQRDKLVNALGAVVSNVDTIDAVVPTLQALGRDHR-KFGALRGHYPAVGEALVATLEHHWTPAIAADWTAAYGLVSATM.... 127
561 5.000e-31UniRef50_A0A2T7CFG6 Uncharacterized protein n=2 Tax=Panicum hallii TaxID=206008 RepID=A0A2T7CFG6_9POAL  ali  18  94......EEQEALVLKSWALMKKDSAN------LGLRFFLKIFEIAPSAKQMFSFLRDSLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVETTLKRLGATH-FKYGVADGHFEVTRFALLETIKEMWSLEMKNAWSEAYNQLVAAIKQEM 240
562 5.000e-31UniRef50_A0A1S4E332 plastid division protein PDV2 n=7 Tax=Cucurbitaceae TaxID=3650 RepID=A0A1S4E332_CUCME  ali  17  326.....TEEQEALVIKSWSVMKKNAAD------LAFKFFLKIFEIAPSAQKMFPFLRDSLEQNPKLKPHALNVFTLTCESAVQLRKAAAKETTIKRLGATHL-KYGVLDEHFEVTKFALLETIKEMWSVEMKGAWAEAYDQLVSAIKAEM 472
563 6.000e-31UniRef50_A4BR57 Flavohemoprotein n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A4BR57_9GAMM  ali  14  3.....SAQEIEVIKSTAPLL------ATHGKDITGRFYQLLFEQNPELSNVFNMSNQRSGN------QQQALARAVYAFAAHVDNLPAIAGEVERIAQKHAS-LGVIAEQYPLVGAALLQAIEQTLQPEVLDAWAKGYGVLAGVFIE.. 133
564 6.000e-31UniRef50_C1EC08 Uncharacterized protein n=2 Tax=Eukaryota TaxID=2759 RepID=C1EC08_MICCC  ali  18  5......PNHVQEVENSWNKVAALGVEN-----VGVLLFKNIFTIAPEALELFSFRNENLYDSLTLKAHGVNVVNTVGKAVAGLREFYTLVPALAALGERHVE-YGILEPHYDVVGKALLMTLEDAFTPQVKEAWTIVYEAVAVTMK... 143
565 6.000e-31UniRef50_A0A2N3I060 Globin n=1 Tax=Raineya orbicola TaxID=2016530 RepID=A0A2N3I060_9BACT  ali  20  1....MTPNQAEIVKKSFPKILAGTLSATH------ILYDKLFELSPDTRDLFKK--------TSMERQSQMLIAAIGKLVKSIDNWDTVKPDLEALAKRHAG-YGLSPEHFVYFGHAFIHMLKSMWNTDLEESWKAVYQKISEVMIGTL 134
566 6.000e-31UniRef50_A0A1W0WNA7 Uncharacterized protein n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0WNA7_HYPDU  ali  14  69..MFLTHEQKAMIRESFEVLKQ------TVGDVGVVFFMRLFETHPEVQDVFVPFQGDLMHSHQLRNHGLRVMGFVEKCVARLEQPEKLVALCLELGARHA-KYQVPAPYLLLIPPQFIYAIKDKWSAEMEAAWGTLFRIAIYYM.... 212
567 6.000e-31UniRef50_A0A1Y6BM38 Hemoglobin-like flavoprotein n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6BM38_9PROT  ali  20  5.........VKIIRDSFRR------TNTISEQLTDKFYETLFQNHPEAKGLFHKV--------DIAKQQQLLYNSLDFIVANLDNPDRLSEYLQNLGERHVT-YGAEEEHFAWVADALLSSLKDEWTDELETNWSAAIKTIADYMIIGM 133
568 6.000e-31UniRef50_V4CJX8 Uncharacterized protein (Fragment) n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4CJX8_LOTGI  ali  17  4NPPVLSEEEKTLILNSWKFIKDDIAK------VGIFTFIGLFESHPDIKHAFVSFRGELNNSSVLRAHALRVMTTVDKCLFRFDNLEKVEELMKSLGCRHGQSYQVVHQHLDLMAPHFNYALKDQWSPELESAWDKLFKLMIHYMKSGM 154
569 6.000e-31UniRef50_P08924 Extracellular globin-1 n=10 Tax=Haplotaxida TaxID=6382 RepID=GLB1_LUMTE  ali  32  10............VKLQWASAFG---HAHQRVAFGLELWKGILREHPEIKAPFSRVRGDNIYSPQFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVER-NLKPEFFDIFLKHLLHVLGDRLGHFDFGAWHDCVDQIIDGIK... 140
570 7.000e-31UniRef50_UPI000B9EBEF1 hypothetical protein n=1 Tax=Zooshikella ganghwensis TaxID=202772 RepID=UPI000B9EBEF1  ali  16  2....LDARTIATVQATIPLLEQA------NTALTTNFYQRMFKWNPELKHIFNVSNQHNSSQPK------ALFNAILAYAKHLHEPGRLAEMVEHIAQKHTGFM-ILPEHYPIVGQHLLATLQEAATAEVLAAWDKAYAALADIFIQ.. 135
571 7.000e-31UniRef50_Q8WWM9 Cytoglobin n=291 Tax=Euteleostomi TaxID=117571 RepID=CYGB_HUMAN  ali  18  22.......AERKAVQAMWARLYANCED------VGVAILVRFFVNFPSAKQYFSQFKHEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFPPETQRAWAKLRGLIYSHVTAA. 165
572 7.000e-31UniRef50_A0A254QUT0 Uncharacterized protein n=1 Tax=Phaeobacter sp. 22II1-1F12B TaxID=1317111 RepID=A0A254QUT0_9RHOB  ali  18  1....MTPDEIKALQMNFARIY------PVKHSVAKSFYDKLFELAPGVRALFP---------DDMREQREKLADTLAFIVKNLDQPDKMELAVSSMARRHAG-YGALPSHLPVVGEALIFALEDQMTPLEHDAWLKAYGRISDMMVDQL 133
573 8.000e-31UniRef50_A8LLN0 Putative flavohemoglobin n=1 Tax=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) TaxID=398580 RepID=A8LLN0_DINSH  ali  21  1....MTQDEITLIQRSFSRIFA------QKARFGALFYERFFALNPEARAMF---------QTSITRQSEMLIEALALVVRGMRTDGALPPKALQMAARH-GRYGVTPDHYAQMGEALMDTLAEVLGDETREAWQRAYGRLSE...... 127
574 8.000e-31UniRef50_A0A1Q6ZA02 Uncharacterized protein n=2 Tax=Ktedonobacter TaxID=363276 RepID=A0A1Q6ZA02_9CHLR  ali  14  10.........VALLQQSFAEVK------SQQEAFAEAFYRRLFALYPQTIPLFATTN--------MKRQQSLLMATLELVVAGVTRGDNVIPSVEQLGRRHA-IYGVKAEHYPMVGQALLETLQDKWTAQVEATWAQAYAMITDLMRRA. 137
575 8.000e-31UniRef50_F0SL04 Methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor n=2 Tax=Planctomycetaceae TaxID=126 RepID=F0SL04_RUBBR  ali  20  4........DIPQLRDSFGLIAPRADQ------FAKSFYDRLFADHPELRSLF--------AGTSMEDQRQKLIQSLLVTMRSLDQPEKLQPFLQDLGERHRE-YNVMPRHYDLVGGALLETLEESWTPDLAAQWKLAYQTIAQIM.... 129
576 8.000e-31UniRef50_A0A1E3QQ45 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QQ45_9ASCO  ali  16  1..MPLTDVQKDIIKASIPVLK------TSGVELTTRFYAHLLENHPDVRPFFNKAHQITKSQPKI------LAFALVAYAKNIDDLTPLLPFVHKIVVKHIG-LQVQARHYDAVGTSLLHTLHAFLGPEFMGAWKVAYYDLANILIEA. 139
577 8.000e-31UniRef50_A0A136P213 Globin n=1 Tax=Chloroflexi bacterium OLB13 TaxID=1617414 RepID=A0A136P213_9CHLR  ali  20  2..ESLTEHDKKLVQRSFTHI------APQNEDIAAVFYARLFELDPDIEHLF---------STGLDVQRAKLMRMMADLVNALDAPEALSQSMRELGKQHVS-YGVHDKHYATVGEALIWALRKVMTPTVTQAWEKTYALFAELAISG. 135
578 9.000e-31UniRef50_A0A1G8T2I5 Globin n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1G8T2I5_9RHOB  ali  21  1....MTPDDIRLVRHHFAALS------GQEEAFSAAFYDHLFALAPDLRAYFPR---------DTADQGRKLMAVLHFAMDHLDRAETLAPAVIALGARHAD-YGVRPDQFAPVGAALLQVLEQWLGAAARQVWTSLYGALADLMRQGL 133
579 1.000e-30UniRef50_E5A9L7 Uncharacterized protein n=1 Tax=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) TaxID=985895 RepID=E5A9L7_  ali  17 1149....LTPDQVAIIKATVPVL------AEHGITITSKFYADMLTAHPELKNVFNNTHQVTGHQPAALAGAL------YAYASNIDNLGALSPAVELICHKHASLF-IRPEQYDIVGEYLLKTMATVLGPEILNAWGAAYWQLADIMIGA. 1283
580 1.000e-30UniRef50_A0A2D9KZA2 NO-inducible flavohemoprotein n=2 Tax=Methylophaga sp. TaxID=2024840 RepID=A0A2D9KZA2_9GAMM  ali  17  1....MKPETFDIIHQTVPLLEQ------HGEQLADCFYKNMFRNNPEVNVFFNPAHQQSG------AQQHALASVICAYARHIDNPGQLRQALEVIFHKHVS-LGIKPEHYPIVGNNLLLTLREVLGEEVIESWTEAYGVLAGIFID.. 134
581 1.000e-30UniRef50_A0A2P4ULE5 Flavohemoprotein n=6 Tax=Actinomadura TaxID=1988 RepID=A0A2P4ULE5_9ACTN  ali  16  2........DAQRLKENFARVAEQGD------AVALFFYSDLFVANPHLRDMFPIG---------MTGQRDKLLRALGLIVSRVDDLPELVPFLQQLGRDHR-KFGIVAEHYAPVGASLIRTLKSYWTPELEADWGAAYGVVAQVMQEA. 129
582 1.000e-30UniRef50_Q0UPY5 Uncharacterized protein n=51 Tax=Fungi TaxID=4751 RepID=Q0UPY5_PHANO  ali  17  3...LLSPSQVQIIKSTVPVLAQ------HGEAITAKFYTDLLTANPSLKNVFNTTHQATG------HQSRALAGALYAYAANIDNLGALSPALELICHKHVSLF-IQPAQYAIVGEFLLATMKTVLGAEVLDAWGAAYWQLADIMIA.. 137
583 1.000e-30UniRef50_A0A2P8ADH4 Flavohemoprotein n=36 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2P8ADH4_9ACTN  ali  22  46.....TDEDVALVRASLTVV------TPHVSELAAHFYSILFSRYPQVRDLFP---------AELDVQRERLVRALLRIVELVDDPDNLVAFCSRLGRGHR-KFGTQSGHYPAVGECLLQALSHAWHPALATAWQRAYTAAADVMVRA. 176
584 1.000e-30UniRef50_UPI00047F7324 hemin receptor n=1 Tax=Mesorhizobium sp. WSM2561 TaxID=1040985 RepID=UPI00047F7324  ali  15  1....MTPDQIRLVQDSFHEV------LPIRVAAAALFYERLFAIDSDLRALF--------LASDMPKQGAELMASLGSVVRGLDRANTVLPTVRELAKRH-GACGFKEHHYPIVGQALIDTLGTAFTPAVGEAWEAAYALLASVMIAA. 133
585 1.000e-30UniRef50_A0A0B5INT0 Flavohemoprotein n=28 Tax=Streptomycetaceae TaxID=2062 RepID=A0A0B5INT0_9ACTN  ali  21  2.......................AEIEPIADTVTSYFYALLFLRHPALRALFP---------AAMDTQRDRLFKALLTAATHADDPVTLTTYLTHLGRGHR-KYGTRPEHYPAVGEALIGALARTWGPGAEAAWVAAYTTISQIMIDA. 120
586 1.000e-30UniRef50_UPI0003F0AB64 non-symbiotic hemoglobin 1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0AB64  ali  16  30.....TDRETAILRSTWPLLASDM------TRNGGKIFLQIFAVAPHVKDLFPFRNDMLQQNEIFKMHGRRFMQSVGAVIENIDNLDGISILLHNLGKRHTDFDEVDGAYFDIYTDCMMHTWRELFTPDVGQVWHKLFDFIINCIKDG. 175
587 1.000e-30UniRef50_A7RZB2 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7RZB2_NEMVE  ali  20  31...PLDAKETQLVRKTWAIL------GDRQVEVGKSLFLRFFEEHPTSKDLFPEFNEKIAESPALYGHARRVMKSVDNAVASIENVQVYSAYLYELGTRHQTR-QLSEEQLKFMGGAFLFALRKEWSRATSKAWEKIFSFMADAMMRG. 176
588 1.000e-30UniRef50_A0A1M6AQG1 Nitric oxide dioxygenase n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1M6AQG1_9GAMM  ali  18  2....LSTQTISVVKSTVPLLQE------HGLEITSTFYKQLFEENPQLLNIFNRSNQRD------TSQSSALADAILAYASNIDNLEALLPAVSHIANKHASI-GIEKEHYPLVGASLLSAIQKVLDPALI-AWKEAYEALAQIFIDA. 136
589 1.000e-30UniRef50_UPI000D6C0BE6 hemin receptor n=1 Tax=Roseicyclus mahoneyensis TaxID=164332 RepID=UPI000D6C0BE6  ali  15  1....MTPKQVELVETSFK------AFVPVAYQTTEDFYESLFRVSPHLRGLFPK---------DMQGLRKKLVETLTYVVNGLRYPDALLPVVRDLGRRHKGF-RVEPGYYALVSAALIEAMGTAFGPEVKQAWKACITFLATEMITA. 132
590 1.000e-30UniRef50_Q14SN0 Globin 1 n=10 Tax=Apocrita TaxID=7400 RepID=Q14SN0_APIME  ali  26  24....LTERQKKLVQNTWAVVRKD------EVASGIAVMTAFFKKYPEYQRYFTAFMDELPANKRFQAHCAGVITALNNVIDFLHDPGLMEASLIGLVERHKKR-GQTKEEFQNLKEVMLEVLRQALGPEVAEAWNKTLDMMFGKI.... 165
591 2.000e-30UniRef50_UPI00096B16B6 non-symbiotic hemoglobin 1-like n=1 Tax=Aethina tumida TaxID=116153 RepID=UPI00096B16B6  ali  21  24....LTSQDKTLIKTSWAKLRAD------TTASGVKIFLTLFQHEPGYQKLFPFRKDQLKQNKRFLAHCNSFMYGFSSLVDNVGDADILIELLKKQGEAHKPR-GVEARAYDVVENVLIEILEKDFDQQTVEAWKKGLKVMLKVIVEG. 163
592 2.000e-30UniRef50_Q9URY5 Flavohemoprotein n=13 Tax=Ascomycota TaxID=4890 RepID=FHP_SCHPO  ali  16  31....LNESQKQYIRSSIPILE------SSGVNLTKAFYQKMLGNYPEVLPYFNKAHQISLSQPRI------LAFALLNYAKNIDDLTSLSAFMDQIVVKHVG-LQIKAEHYPIVGHCLLSTMQELLTPAFLEAWTTAYGNLAKILID.. 165
593 2.000e-30UniRef50_A0A2S9YM25 Flavohemoprotein n=2 Tax=Enhygromyxa salina TaxID=215803 RepID=A0A2S9YM25_9DELT  ali  17  1....MHPKQIELIRASLPILRE------QAVAITQAMYRRMFTANPEVAKMFNPSH----MHPD--GQQGALAGAIVAYAEHLDELEVLHDALAVIVHKHVAV-QVQPAQYEVVGEHLLAAIAEVLGPELMHTWAAAYRELADVCIAA. 135
594 2.000e-30UniRef50_A0A167EK10 Yhb1p n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167EK10_9ASCO  ali  11  5....LTSQQVEHIKAGVPLMEQAGD------AFLSEFYAKMISENPALLNVFNKTHQRTLDQP------RALTRAVVAYAKNIDNLGVLSPVVERIVQKHCS-LNVKAEHYPIVGKYLLDAISVKFGPDVADAWAAAYGQLAELLIGA. 140
595 2.000e-30UniRef50_A0A2G9H4Y5 Uncharacterized protein n=5 Tax=Lamiales TaxID=4143 RepID=A0A2G9H4Y5_9LAMI  ali  18  11...LFTEEEEALVVKSWSLMKKNA------GEWGLKFFLKIFEIAPSAQKLFSFLRDSLEQNPKLKSHAKSVFVMTCEAAVQLRKAGRVVSSLKKLGSVH-FKYGVVDEHFEVTKYALLETIKEMWSTEMKKAWSVAFDHLVAAIKTEM 159
596 2.000e-30UniRef50_A0A2H8TK81 Cytoglobin-2 n=6 Tax=Neoptera TaxID=33340 RepID=A0A2H8TK81_9HEMI  ali  16  56....LTMRQKELLTEMWKLLEEDIAK------VGVITFVSLFETHPDVQQSFMPFKGDLKHSRQLRDHALRVMAFVQKAVARLYEPDKLETLLRDLGKKHY-HYGAKQKYVDLIGPQFIMAIQDRWTDEMHSAWTALFLNMAYIMKGSM 201
597 2.000e-30UniRef50_A0A0D0PE50 Hemoglobin-like flavoprotein n=1 Tax=Wenxinia marina DSM 24838 TaxID=1123501 RepID=A0A0D0PE50_9RHOB  ali  18  2....LDPAHQDLIRSSFQRLRCRPE------ALALDFYGILFRDQPSLRRLFP---------TDMDAQAAKLSKMLVRLVRSVDDLSRMEAQLRDLGRYHVRR-GTEDGQYAMVGAALLEALERQWTDDHRAAWTEVFRAVAATMIAG. 132
598 2.000e-30UniRef50_A0A1W2G989 Hemoglobin-like flavoprotein n=2 Tax=Reichenbachiella faecimaris TaxID=692418 RepID=A0A1W2G989_9BACT  ali  12  1....MTTQEISTIKSCWEVIAPNGIL------VAQKFYKELFESKPEYRRLFT---------GDMDKQAEKLMMTLGFLMANLDRMSTIKKSVEDLGKLHANHFKVLPEYYPPVKVALISSIEEDWTQTHHNAWDKLINSVATMMING. 133
599 2.000e-30UniRef50_A0A1Q6YA85 Uncharacterized protein n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A1Q6YA85_9CHLR  ali  13  4........QGELLETSFQAI------VLHGEAFVTAFYERLFTRFPETRAFF--------AATDMFEQRKKLQQSLALIVQHMQHPEVLGDMLRELGQRHVT-YGIRPEHYPLVGAVLLETFADHWTQAHHDAWVKGYEAVSSLMLQG. 132
600 2.000e-30UniRef50_D3D7N7 Transcriptional regulator, ArsR family n=5 Tax=Frankia TaxID=1854 RepID=D3D7N7_9ACTN  ali  18  322....LSIESAAVVRATAPVV------AAHSVEITSAFYPRLFTAHPELLRLFNQGNQANGD------QRRALAASVVAYATQLIDPQAFQPVLERIAHKHAS-LGVLPEQYTIVGRNLLAAVGDVLGPEIAAAWDEVYWLFACQLIAE. 458
601 2.000e-30UniRef50_Q8UUR3 Cytoglobin-1 n=5 Tax=Otomorpha TaxID=186634 RepID=CYGB1_DANRE  ali  19  14..DSLTEEDVCVIQDTWKPVYAERDNA------GVAVLVRFFTNFPSAKQYFEHFREEMQQNAQLKEHGQRVLNALNTLVENLRDADKLNTIFNQMGKSHALRHKVDPVYFKILAEVLVEAFPQCFSPEVQSSWSKLMGILYWQM.... 160
602 2.000e-30UniRef50_A0A258GJE5 Globin n=1 Tax=Rhodobacterales bacterium 32-67-9 TaxID=1970560 RepID=A0A258GJE5_9RHOB  ali  18  4.....TTRQAELIRQSFETLQQRLGPAS------MVFYEALFRRAPQLREMFR---------DDLAGQGMKFMTTLGTIIVNLDDPDAQGDKFAELGRGHALI-GVKASHFAPMGAALIETLRDELGPDLEAAWQAGYDELAARIIR.. 133
603 2.000e-30UniRef50_UPI000BAF2000 neuroglobin-like isoform X3 n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAF2000  ali  18  25.EPTLSEKDLDILETSWGKLKKDI------SKVGVVMFMNLFQTHPEVQDAFLPFKEDMEHSAILRSHALRVMGTVDKCLARIRTPEKLQTLMRELGERHTN-YNARYDFVDLVGSQFVYALEDCWSKELEDAWLQLFRVMSYHMKKGM 173
604 2.000e-30UniRef50_A0A125BCZ6 Flavohemoglobin n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A125BCZ6_THIDE  ali  16  2....LSAETLATIKSTAPLL------AEQGKAITDLFYSKLFAQHPELQHIFNMANQAQGE------QSRALAESVFMYATHIDALQNLGPMVSRIAHKHAS-LQVAPEHYPIVGKYLLEAIQDHLGLEVLGAWAEAYAQLAGIFIK.. 135
605 2.000e-30UniRef50_H6L2T7 Globin n=2 Tax=Saprospira grandis TaxID=1008 RepID=H6L2T7_SAPGL  ali  20  1....MNQEDIRLVQASVPILEEHAE------TLTRLFYKNMLSNHPELKNIFNLANQALGQ------QQKSLALSVLAYAKHIEQPEVLLPALELIGHKHRS-LQVQADQYPIVGKYLLGALQELLDPDILGAWGRAYQQLADILIE.. 134
606 2.000e-30UniRef50_UPI00035CEF7B hypothetical protein n=16 Tax=Actinobacteria TaxID=201174 RepID=UPI00035CEF7B  ali  17  8............LQASWARVVAHGDAVP------AYFYAALFTRNPQLRQLFP---------ASMAGQRDRLVTALGRIVAGVGQPDVMLPFARGLGRDHR-RFDVRPEHYPPVGEALLATLSQFLGPDLAAGWTEAYGLVAQVMCDA. 131