current user: public

If you have questions about the server, please let us know.

Query: d2itka2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# E-value Template Links and tools%idFirst EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTELast
1 5.000e-52UniRef50_A0A1G2Z615 Peptidylprolyl isomerase n=1 Tax=Planctomycetes bacterium RBG_13_60_9 TaxID=1801963 RepID=A0A1G2Z615_9BACT  ali  45  85.PERVRASHILISTEPTDPNADPNQA-----KVQARQKAEELLKKVKDGE-DFAALAKENSACPSKTQGGDLGMFGRDQMVPPFEEAAFALKAGEVSGLVETQFGYHIIKVTE 190
2 1.000e-51UniRef50_K7G506 Peptidyl-prolyl cis-trans isomerase n=50 Tax=Tetrapoda TaxID=32523 RepID=K7G506_PELSI  ali  93  29EPAKVRCSHLLVKHNQSRRPSSWRQEKITRSKDEALELINGYIQKIKSGEEDFESLASQFSDCSSAKAGGDLGAFGRGQMQKPFEDASFALRAGEMSGPVFTDSGIHIILRTE 141
3 2.000e-50UniRef50_F7BLZ7 Peptidyl-prolyl cis-trans isomerase n=19 Tax=Amniota TaxID=32524 RepID=F7BLZ7_HORSE  ali  99  33EPTRVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 145
4 3.000e-50UniRef50_Q13526 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 n=166 Tax=Bilateria TaxID=33213 RepID=PIN1_HUMAN  ali  100  51EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 163
5 4.000e-50UniRef50_A0A1T4KZZ8 Peptidylprolyl isomerase n=1 Tax=Geobacter thiogenes TaxID=115783 RepID=A0A1T4KZZ8_9DELT  ali  45  188QPEQVRASHILITLDAKATDAD---------KAKAKEKIEGLLKQIKAG-ADFAKLAQENSGCPSSKQGGDLGYFGKGQMVKPFEETAFAMKPGDVSGVVETQFGYHIIKLTE 290
6 5.000e-50UniRef50_A7SG38 Peptidyl-prolyl cis-trans isomerase n=21 Tax=Opisthokonta TaxID=33154 RepID=A7SG38_NEMVE  ali  70  40..DQVRASHLLVKHSESRRPSSWKTDKITRSKDEALAILKGYQEQIKSGEATLEDLAKTESDCSSAKNGGDLGFFGRGQMQKPFETATFSLRVGEMSEPVFTDSGIHLILRT. 149
7 1.000e-49UniRef50_UPI0004058EE5 hypothetical protein n=1 Tax=Spirochaeta cellobiosiphila TaxID=504483 RepID=UPI0004058EE5  ali  38  193QPEQVRASHILIQVASNASDDE---------KTKAYKKAEAVLEKVKEG-LDFGDLAKEYSEGPSGPNGGDLNYFGRGQMVPAFEEAAFALDVGEVSDIVETQFGYHIIKVFD 295
8 2.000e-49UniRef50_J3PGW2 Peptidyl-prolyl cis-trans isomerase n=114 Tax=saccharomyceta TaxID=716545 RepID=J3PGW2_GAGT3  ali  58  77.PGKIRAAHLLVKHRDSRRPSSWKQDRIVRTKEEARTEIEEYHRQIVSGQATLAELATQESDCSSARKRGDLGWFGRGDMQKEFEDAAFALKPGEISDIVESASGLHLIERLE 188
9 8.000e-49UniRef50_A0A2H6GPH5 Peptidylprolyl isomerase n=1 Tax=bacterium BMS3Abin14 TaxID=2005722 RepID=A0A2H6GPH5_9BACT  ali  39  205KKEQVRASHILINVAKDASREE---------KGKALARANEIAKKAREKGADFAALAKEKSEGPSGPSGGDLGFFGRGKMVKPFEDAAFGMKVGEISDPVLTQFGYHVIKVTD 308
10 1.000e-48UniRef50_A0A1X2HNK0 Peptidyl-prolyl cis-trans isomerase n=6 Tax=Eukaryota TaxID=2759 RepID=A0A1X2HNK0_SYNRA  ali  67  38..ERVRASHLLVKTRESRRPSSWRQENITRSKEEAMELIQEYQTKIQNGVETLSALATNLSDCSSAKRGGDLGYFERGQMQKPFEDATFALQVGQLSEPIWTDSGVHLILRT. 147
11 1.000e-48UniRef50_A0A1C7N4Z7 Peptidyl-prolyl cis-trans isomerase n=182 Tax=Eukaryota TaxID=2759 RepID=A0A1C7N4Z7_9FUNG  ali  70  40..ERVRASHLLVKSKDSRRPSSWREEHITRTKEEALEILKEYQHKIESGQETLSALATHFSDCSSAKRGGDLGYFERGQMQKPFEDATFALQVGELSKPVWTDSGVHLILRT. 149
12 2.000e-48UniRef50_W0TGZ8 Peptidyl-prolyl cis-trans isomerase n=14 Tax=Opisthokonta TaxID=33154 RepID=W0TGZ8_KLUMD  ali  57  52.PLRVRALHLLIKHKDSRRPASHRNENITITKEEARKELESYIKRLKEDGEPFEALAKERSDCSSAKRGGDLGFFGRGEMQPSFEKAAFALKVGEVSDIVESDSGLHIIKRV. 162
13 2.000e-48UniRef50_P0C1J8 Peptidyl-prolyl cis-trans isomerase pin1 n=31 Tax=Opisthokonta TaxID=33154 RepID=PIN1_RHIO9  ali  63  40..ERVRASHLLIKSRESRRPSSWREEHITRSKEEALKILTDFQHKIESGQETLSALATNYSDCTSAKRGGDLGYFERGQMQKPFEEATFALQVGELSKPVWTDSGVHLILRT. 149
14 2.000e-48UniRef50_Q4SMI5 Chromosome 18 SCAF14547, whole genome shotgun sequence n=1 Tax=Tetraodon nigroviridis TaxID=99883 RepID=Q4SMI5_TETNG  ali  82  45.PEKVRCSHLLVKHNQSRRPSSWRQQNITRTKEEALELIQGYIEDIKSGKEKFESLASQFSDCSSAKNGGDLGLFGRGQMQKPFEDASFALKVGDMSGPVFTDSGVHVILRT. 155
15 3.000e-48UniRef50_S7TWG7 Peptidylprolyl isomerase n=1 Tax=Desulfococcus multivorans DSM 2059 TaxID=1121405 RepID=S7TWG7_DESML  ali  40  190KPEQIKASHILIKADASAGEAD---------KAAARKKIEEIQDKLKKGEK-FDALAKQYSEDPSSAQGGDLGYFSRGQMVKPFEETAFAMKKGDVSDIVVTQFGYHLIQVMD 292
16 3.000e-48UniRef50_A0A1F9AQ72 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RBG_13_61_14 TaxID=1797834 RepID=A0A1F9AQ72_9DELT  ali  44  192.PETIRASHILIGFDEKDTDE---------TKAAKKKQAEDILAQLKKGG-DFAELAKQSSTCPSKQQGGDLGYFPRGQMVKPFEDAVFALKLGQLSGVVETQFGYHIIKKTD 293
17 5.000e-48UniRef50_A0A2P6KYW3 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6KYW3_NEPCL  ali  70  110..DQVRCSHLLVKHRDSRRPSSWREENIIRTKEEALEIIEGFREQLISGKSTFEDLASKFSDCSSAKRGGDLGLFGRGAMQKPFEDASFALKVGELSKPVMTDSGVHLIIRT. 219
18 1.000e-47UniRef50_Q9LEK8 Peptidyl-prolyl cis-trans isomerase Pin1 n=21 Tax=Eukaryota TaxID=2759 RepID=PIN1_DIGLA  ali  52  4..EKVRASHILIKHQGSRRKSSWKDPDSATTRDDAVSQLQSLRQELLSDPASFSDLASRHSHCSSAKRGGDLGPFGRGQMQKPFEEATFALKVGEISDIVDTDSGVHIIKRT. 117
19 1.000e-47UniRef50_A0A2P6NJS4 Uncharacterized protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NJS4_9MYCE  ali  60  424...QVRASHILVKHKESRRPSSWREENVTRSRAEAQERLNGLRKQAESGPEAFAKVAQTESDCSSARNGGDLGFFGRGQMQKAFEDATYALKVGELSGTVDSDSGYHIILRT. 532
20 1.000e-47UniRef50_A0A285HCS8 Peptidylprolyl isomerase n=1 Tax=Orenia metallireducens TaxID=1413210 RepID=A0A285HCS8_9FIRM  ali  44  195.PARVKARHILVTTDD-------------KTDQEAKAKAKEVINKLKEG-ADFATLAKEYSEGPSAENGGDLGYFSKGQMVPAFEQAAFNLQVDEISEPVKTKFGYHIIKVED 292
21 2.000e-47UniRef50_A0A1J5MSQ1 Peptidylprolyl isomerase n=7 Tax=Desulfovibrionaceae TaxID=194924 RepID=A0A1J5MSQ1_9DELT  ali  38  264EPEQIHARHILVTVKDSDSEAA---------QKKAKERIDKIYKEARAG-ANFAKLAEENSDGPSAPNGGDLGWFGRGAMVPDFEKAAFALDKGEVSEPVKTRFGWHVIKVED 366
22 2.000e-47UniRef50_A0A2G6NEN1 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2G6NEN1_9DELT  ali  43  183QKEQVRASHILVKVESSAPDE---------TRAAARKKLEGIQERLKKGE-DFSALAKESSDCPSSASGGDLGFFERGRMVKPFSDAAFAMKKNEVSDIVETRFGYHLIQLTD 285
23 4.000e-47UniRef50_A0A2E6VS64 Peptidylprolyl isomerase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E6VS64_9DELT  ali  44  235QPKKVRARHILVKAAESADAP---------TLTAAKSKIEAALKRVKTDKEDFAKVAKEVSDDGSAAKGGDLGLFGPGQMVKPFEDAAYALKVGEISDVVKTQFGFHIIKVEE 338
24 4.000e-47UniRef50_A0A1C0A7Y5 Peptidylprolyl isomerase n=3 Tax=Halanaerobiales TaxID=53433 RepID=A0A1C0A7Y5_9FIRM  ali  42  194.PAQIKARHILIKTD-------------KKSDEEAKDKAQKVLNKLKDG-ADFAKLAKEYSEGPSAKNGGDLGYFRKGQMVPEFEQAAFDLEVGELSELVKTEFGYHIIKVE. 290
25 5.000e-47UniRef50_F8E8U5 Peptidylprolyl isomerase n=1 Tax=Flexistipes sinusarabici (strain DSM 4947 / MAS 10) TaxID=717231 RepID=F8E8U5_FLESM  ali  37  265QPEKVRASHILIRVKDFDNETEVKN---------ARNKIENILAQLKKG-KDFSEMAKKYSEDASAQNGGDLGYFKKGEMIKEFENTAFSLETGKISGIVKTPFGFHIIKVTD 367
26 5.000e-47UniRef50_A0A1U7ZH71 Peptidyl-prolyl cis-trans isomerase n=3 Tax=Eukaryota TaxID=2759 RepID=A0A1U7ZH71_NELNU  ali  51  5...QVRASHILIKHQGSRRQASWKDPDKNTTRETAVNQLKSLREDIVAGKAKFEDVASRYSDCSSAKRGGDLGPFGKGRMQKPFEEAAFGLKVGEISDIVDTDSGVHIIKRT. 117
27 6.000e-47UniRef50_A0A2G6N6F0 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2G6N6F0_9DELT  ali  42  179QPEQVKASHILVKVSPDAGEAQ---------KNKARTAIESLKTRIDKGE-SFATLAMENSDCPSKAKGGDLGFFGREQMVKPFSDAAFVLEPGQTSDVVETRFGYHLIRVTD 281
28 7.000e-47UniRef50_A0A1C0A4T2 Peptidylprolyl isomerase n=4 Tax=Halobacteroidaceae TaxID=53434 RepID=A0A1C0A4T2_9FIRM  ali  41  186QYEEVTASHILIKTDDKED-------------AEAKAKAEEVLAKAKAGE-DFAKLAKDYSEGPSASRGGELGSFTRGRMVKPFEEAAFSMEVGEVSDLVKTEFGYHIIKVTD 284
29 8.000e-47UniRef50_A0A212PDD7 Peptidylprolyl isomerase n=2 Tax=Geobacter TaxID=28231 RepID=A0A212PDD7_9DELT  ali  44  190.PESIKASHILVGVDSKASAED---------KKKAREKADGLLKKIKEGG-DFAVLAKENSTCPSSAQGGDLGYFGKGQMVPPFEKAAFSLKPGEVSDVVETQFGYHIIKLTE 291
30 9.000e-47UniRef50_A0A1W9LTW2 Peptidylprolyl isomerase n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9LTW2_9DELT  ali  44  185QPEQVKASHILIMSNAKDDDAK---------KAEARKKIEDVEKRLKKGE-DFAELAKTVSECPSKEKGGDLGSFAKGQMVKPFEDKAFTLKPGEMSGIVETEFGFHIIKVTD 287
31 1.000e-46UniRef50_A0A1F9MDK0 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RIFOXYD12_FULL_50_9 TaxID=1797902 RepID=A0A1F9MDK0_9DELT  ali  45  218..EEVKASHILIRVPADANED---------TKKEAHKKIEAIQAKLKAGG-DFATLAKEQSDCPSKEKGGDLGSFGKGQMVPPFESAAFALKVGETSDIVATEFGYHIIKVTE 318
32 1.000e-46UniRef50_A0A2I0VCK3 Peptidyl-prolyl cis-trans isomerase n=7 Tax=Streptophyta TaxID=35493 RepID=A0A2I0VCK3_9ASPA  ali  55  5..EQVKASHILIKHEGSRRKASWKDPDSATTREEAAAQLADFREKIVSGQAQFEDIASRYSDCSSAKRGGDLGPFGRGQMQKPFEEAAFSLGVGEVSGIVDTDSGVHIIKRT. 118
33 1.000e-46UniRef50_D8F8B5 Peptidylprolyl isomerase n=2 Tax=delta proteobacterium NaphS2 TaxID=88274 RepID=D8F8B5_9DELT  ali  40  164QPEQVKASHILIKVKPDATEAE---------KAEAMKKIEKAQDKLLEGE-DFAEVAKTTSEGPSASKGGDLGYFGRGQMVKPFEDVAFSLEPGKVSDVVKTQFGYHLIKVVD 266
34 1.000e-46UniRef50_A0A257UM77 Peptidylprolyl isomerase n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A257UM77_9BACT  ali  42  316.PEEVHARHILIR-PATQDAAGWK---------AALAKAEQVRAKALKG--DFAALAKQYSDDPSKATGGDLGWFPRGRMVKEFEDAAFALKPGEVSEPVKSQFGYHIIKVE. 415
35 1.000e-46UniRef50_A0A2I7N804 Peptidylprolyl isomerase n=1 Tax=Neisseriaceae bacterium DSM 100970 TaxID=2052837 RepID=A0A2I7N804_9NEIS  ali  33  248..EQVDVSHILFAVPADATPAQ---------KAEIKAKAEKVLSEIKANPAKFAALAKQYSEDPSAANGGDLGYFGKGVMVKPFEQVAFSMKKGQISDLVETQYGYHILKLND 350
36 1.000e-46UniRef50_A0A0B4XYR5 Peptidylprolyl isomerase n=77 Tax=Proteobacteria TaxID=1224 RepID=A0A0B4XYR5_9PROT  ali  45  3..EQVRASHILLMYAGSARSS------ATRTKEEALTEINALKDQIANG-ADFGEVAKANSDCPSGQQGGDLGFFGRGMMVPEFDAAAFNMEVGTTSDVVETDFGYHLLQRT. 105
37 1.000e-46UniRef50_B8FJH0 Peptidylprolyl isomerase n=3 Tax=Desulfatibacillum TaxID=218207 RepID=B8FJH0_DESAA  ali  47  258EDQQVHARHILISLAKDAPEEKA---------AEALKKAQEIEAKAKAGE-DFAELAKEFSDGPTAKNGGDLGSFPRGRMVKPFEDAAFALNAGEISDPVRTDFGFHIIKVEE 360
38 1.000e-46UniRef50_A0A2K2VTS8 Peptidylprolyl isomerase n=2 Tax=Desulfobacteraceae bacterium TaxID=2049433 RepID=A0A2K2VTS8_9DELT  ali  40  181KPEQVRASHILIKVDPEAEEAKKAEA---------RTKIESVQAKLKKGE-DFGALAKEYSEGPSGPKGGDLGFFGRGQMVKPFEEAAFSMKPGQVSGMVETRFGYHLIMVAE 283
39 1.000e-46UniRef50_E0RQC8 Peptidylprolyl isomerase n=2 Tax=Spirochaeta thermophila TaxID=154 RepID=E0RQC8_SPITD  ali  37  189QPEQIRARHILIRLDPDASKEE---------EEAAYAKIHEVQEKLKQG-ADFAELARTYSEGPSAPNGGDLGFFGRGQMVPAFEEAAFALEVNQVSDVVRTEYGLHLIQVTD 291
40 2.000e-46UniRef50_A0A1G3ASI4 Peptidylprolyl isomerase n=3 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G3ASI4_9BACT  ali  37  200.PEQVRASHILIK-PEFTDPNADPNADPNEAKAKARTKTEDLLKQLKDG-ADFAELAKNYSACPSAPKGGDLGFFPRGETTPAFENTAFELEIGQISDIVETEYGYHIIKVTE 309
41 2.000e-46UniRef50_A0A2N3ANR2 Peptidylprolyl isomerase n=3 Tax=Bacteria TaxID=2 RepID=A0A2N3ANR2_9BACT  ali  47  183EPEQVHARHILV---------------------ETEEEANNLLLQLKEGLTDFAELAKEKSIGPSAPSGGDLGFFTRGQMVKEFEDAAFSLEPGEISDVVQTQFGYHIIKCEE 274
42 2.000e-46UniRef50_A0A1F2TLX7 Peptidylprolyl isomerase n=4 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2TLX7_9BACT  ali  40  215QDEAVRASHILLKVDEQADAA---------TKKKALARARAVLKQAR-GGADFAALAKKHSQDASAQQGGDLDFFSHGQMVAPFDQAAFALKPGQISDIVTTQFGYHIIKVTE 317
43 2.000e-46UniRef50_A6GJ59 Peptidylprolyl isomerase n=30 Tax=cellular organisms TaxID=131567 RepID=A6GJ59_9DELT  ali  48  4....VRASHILLMYQGSAR------STATRSKAEAEQQINALAEQIR-GGADFGDLAKANSDCPSGAKGGDLGSFGKGQMVKPFEVAAFGMDVGQVSGVIETDFGYHIIKRT. 104
44 2.000e-46UniRef50_A0A1W9Q4V7 Peptidylprolyl isomerase n=1 Tax=Desulfococcus sp. 4484_242 TaxID=1968523 RepID=A0A1W9Q4V7_9DELT  ali  37  264QPAQVKARHILFELDEDAPE---------KTEQAVRKKAEAVLEKVKKGE-DFAKLAKEYSSCPSKERGGDLGYFEKGQMAPAFEEAAFSLKKGEVSELVRTPFGYHIIQVED 366
45 2.000e-46UniRef50_A0A2N2PUV4 Peptidylprolyl isomerase n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-1 TaxID=2013723 RepID=A0A2N2PUV4_9CHLR  ali  39  230..EQVRASHILVRAPTPDPNAQPTPTPAPRDDAQALARIIEVKQKLDAGG-DFATLALEYSDDGSAANGGELGWFGRGQMVTEFEDAAFSLQPGQVSDPVQTPFGYHLIKVEE 356
46 3.000e-46UniRef50_B6TQC5 Peptidyl-prolyl cis-trans isomerase n=11 Tax=Eukaryota TaxID=2759 RepID=B6TQC5_MAIZE  ali  51  10..ETVRASHILIKHEGSRRKASWKDPDSATTRGDAAARLLDLRNQILSGQANFADLAARHSDCSSARRGGDLGTFGRRQMQKPFEDATYALKVGELSDIVDTDSGVHIILRT. 123
47 3.000e-46UniRef50_A0A081CL29 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Pseudozyma antarctica TaxID=84753 RepID=A0A081CL29_PSEA2  ali  58  155KPDKVRASHLLIKHAGSRRPSSWKEANITRSREDAIEQLKKFEHQLKQDPANFASLASVHSDCSSARAGGDLGFFQRGQMQKPFEDAAFGLKVGELSSIVDTDSGVHLIYRT. 268
48 5.000e-46UniRef50_A0A1V4RUL6 Peptidylprolyl isomerase (Fragment) n=3 Tax=Desulfobacterales TaxID=213118 RepID=A0A1V4RUL6_9DELT  ali  46  182QPEKVKASHILIKVSPKADESK---------KKDALEKIKKIQKRLQKGE-DFGALAKESSECPSSKRGGDLGFFKRGQMAKPFEDAAFTTKPGEISDIVKTRFGYHLIKVVE 284
49 5.000e-46UniRef50_A0A1G9BJ34 Peptidylprolyl isomerase n=1 Tax=Desulfovibrio ferrireducens TaxID=246191 RepID=A0A1G9BJ34_9DELT  ali  39  264QDEQVKARHILLLVDENASAADIK---------KAENKIQKILAKAKSGE-DFAKLAKKYSEGPSKTKGGELGWFSRGAMVKPFEDAAFKLKKGQISEPVRTRFGFHIIKVDD 366
50 7.000e-46UniRef50_A0A0S6VZK0 Peptidylprolyl isomerase n=5 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0S6VZK0_9BACT  ali  45  163EPAQIRASHILILVPQDATPEA---------KDAAKKKIEGVLAEVNAG-KDFAELAKANSEDPSKDNGGDLDFFPRGAMVKPFEDAAFALKEGEVSGVVETQFGYHIIKKT. 265
51 7.000e-46UniRef50_A0A1V4MLB4 Peptidylprolyl isomerase n=1 Tax=delta proteobacterium ML8_D TaxID=1775672 RepID=A0A1V4MLB4_9DELT  ali  40  149.PESVKARHILLKVPEGADEKAW---------EEAESRAKDIKEKLKKGE-NFAELAKKHSDDPSKDRGGDLGFFTKGRMVPEFESAAFSLKQGEFSDPVKTNFGYHIIEVQE 251
52 7.000e-46UniRef50_C6E3D6 Peptidylprolyl isomerase n=1 Tax=Geobacter sp. (strain M21) TaxID=443144 RepID=C6E3D6_GEOSM  ali  38  192QKEQVRASHILIGCDSKGTAEE---------KKKARDKAERLLKEVKEG-ADFAKLARENSTCPSATNGGDLGYFPRGKMVPPFEEAAFALKSGEVSDVVETGFGFHLVKQTD 294
53 8.000e-46UniRef50_A0A2W4U8M9 Uncharacterized protein n=1 Tax=bacterium TaxID=1869227 RepID=A0A2W4U8M9_9BACT  ali  43  135...QVRARHILLRVPPDATPAQ---------RDSVLALARDLQQRAASG-ADFAALASEYSQDPSARQGGDLGLFGRGQMVPPFEEAAFALQVGEVSDVVETPFGFHIIKVEE 235
54 9.000e-46UniRef50_UPI0004091AD0 hypothetical protein n=1 Tax=Desulfatirhabdium butyrativorans TaxID=340467 RepID=UPI0004091AD0  ali  47  228..EQVRASHILVKVGPNDTPEQ---------KAEAHKKIEEIQKKLQ-GGEDFATLAKEQSDCPSKAKGGDLGFFDKNAMVKPFSDAAFALKPGETSGIVETQFGYHIIKQTD 328
55 1.000e-45UniRef50_Q9SL42 Peptidyl-prolyl cis-trans isomerase Pin1 n=101 Tax=Eukaryota TaxID=2759 RepID=PIN1_ARATH  ali  52  5..DQVKASHILIKHQGSRRKASWKDPELTTTREAAVEQLKSIREDIVSGKANFEEVATRVSDCSSAKRGGDLGSFGRGQMQKPFEEATYALKVGDISDIVDTDSGVHIIKRT. 118
56 1.000e-45UniRef50_A0A074ZFB5 Uncharacterized protein n=1 Tax=Opisthorchis viverrini TaxID=6198 RepID=A0A074ZFB5_9TREM  ali  68  375..DKVRCLHLLVKHSGSRRPSSWREAKITRSKEDALKLIQNYKKRIESGEISFEELARTESDCSSASSGGDLGFFSRGQMQKPFEEAAFNLKLDEMCGPVYTDSGIHIIKR.. 483
57 1.000e-45UniRef50_A0A1V5K8A1 Peptidylprolyl isomerase n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1V5K8A1_9BACT  ali  41  228KPERVKASHILIMADAS------PTSPSGRTDEQAKKLADELVTKARAG-ASFSDLAKQYSQDPSGSKGGDLGYFGKGQMVAEFEKAAFALKIGEISGVVKSQFGYHIIKVT. 333
58 1.000e-45UniRef50_A0A1U8KD76 Peptidyl-prolyl cis-trans isomerase n=4 Tax=rosids TaxID=71275 RepID=A0A1U8KD76_GOSHI  ali  52  9...QVRASHILIKHQGSRRKASWKDPESNTTRDAAVSQLKALRDDIASGNAKFGEVASRHSDCSSAKRGGDLGPFGRGQMQKPFEDATYSLKIGEISDIVDTDSGVHIIMRT. 121
59 1.000e-45UniRef50_A0A2U3K1A8 Peptidylprolyl isomerase n=1 Tax=Candidatus Sulfopaludibacter sp. SbA4 TaxID=2043165 RepID=A0A2U3K1A8_9BACT  ali  40  160EFEQVRARHILVRMQGS--PLPVKPGQKELTEAEALAKATDLRKKI-EGGADFAALATAESDDTSAAKGGDLGAFKHGQMVPSFDQAAFAMKPGDLSQPVKSQFGYHIIKVE. 269
60 2.000e-45UniRef50_A0A2H0A9I2 Peptidylprolyl isomerase n=1 Tax=Desulfobacterales bacterium CG23_combo_of_CG06-09_8_20_14_all_51_8 TaxID=1973983 RepID=A0A2H0A9I  ali  46  206.PERVHASHILLKLDPKASDAV---------KAETRKKMDGIKKRLDAGE-DFAKLAKENSDCPSSAKGGDLGFFARGQMVKPFEEAAFALKPGEVSGVVETQFGYHLIKSQE 307
61 2.000e-45UniRef50_F9UGI6 Peptidylprolyl isomerase n=4 Tax=Thiocapsa TaxID=1056 RepID=F9UGI6_9GAMM  ali  43  195QPESMRASHVLIGVDADAGAEE---------KENAKRKADEILEKVKSG-ADFAELAKSESTCPSAAQGGDLGEFGRGQMVAPFENAAFALKSGDLSEVVETQFGYHIIKATD 297
62 2.000e-45UniRef50_C4JEG1 Peptidyl-prolyl cis-trans isomerase ssp-1 n=1 Tax=Uncinocarpus reesii (strain UAMH 1704) TaxID=336963 RepID=C4JEG1_UNCRE  ali  55  17QKEQIRASHLLIKHRDSRRPTSWREANITRTKEEAIEILNGHLKRIMAGEATLGDIATTESDCSSARKKGDLGFFTHGVMQKEFEDASFALKPGQISGIVETQSGVHLIER.. 128
63 2.000e-45UniRef50_A0A143PRW5 Peptidylprolyl isomerase n=1 Tax=Luteitalea pratensis TaxID=1855912 RepID=A0A143PRW5_9BACT  ali  46  222QPEAMRASHILLKAD------------TPETKAVAKPKAEDLLRQIK-GGADFAALAKQHSNDGSAPNGGDLGFFPRGQMVKAFEEAAFALKAGEISPIVETEFGYHIIK... 318
64 2.000e-45UniRef50_O74448 Peptidyl-prolyl cis-trans isomerase pin1 n=40 Tax=Ascomycota TaxID=4890 RepID=PIN1_SCHPO  ali  60  66...KIRASHLLVKHRESRRPSSWKEEHITRSKEEARKLAEHYEQLLKSGSVSMHDLAMKESDCSSARRGGELGEFGRDEMQKPFEDAAFALKPGEISGVVETSSGFHIIQR.. 173
65 2.000e-45UniRef50_P54353 Putative peptidyl-prolyl cis-trans isomerase dodo n=70 Tax=Bilateria TaxID=33213 RepID=DOD_DROME  ali  60  55.PDEVHCLHLLVKHKGSRRPSSWREANITRTKEEAQLLLEVYRNKIVQQEATFDELARSYSDCSSAKRGGDLGKFGRGQMQAAFEDAAFKLNVNQLSGIVDSDSGLHIILR.. 164
66 3.000e-45UniRef50_A0A2G6M5E7 Peptidylprolyl isomerase n=1 Tax=Dethiosulfovibrio peptidovorans TaxID=47055 RepID=A0A2G6M5E7_9BACT  ali  35  140.PETVKASHILIQVSKDAGKKDW---------EEAKKKLVVLRKDILAKKISFEDAAKANSSCPSKARGGDLGFFTKGQMVPEFDEVAFKTKVGEISAPVKTQFGYHLIKVTD 242
67 3.000e-45UniRef50_A0A1Y1RYE6 Peptidylprolyl isomerase n=2 Tax=Marispirochaeta TaxID=1911565 RepID=A0A1Y1RYE6_9SPIO  ali  39  225QPETVRARHILVSLEEGATEED---------KAAAREKIEAIQEELAAG-ADFAELAKEKSEGPSSKNGGDLGYFSADKMVPSFSDAAFALQPGEVSGIVETRFGYHIIKLED 327
68 3.000e-45UniRef50_A0A197K096 Peptidyl-prolyl cis-trans isomerase n=10 Tax=Eukaryota TaxID=2759 RepID=A0A197K096_9FUNG  ali  65  75.PRRVRVSHLLVKHTESRRPSSWREPTITRTKDEALERLKGFQSKIESGEAQLSELAATESDCSSAKKSGDLGFFERGQMQPEFERASFALQIGEMSSPIWTDSGVHLIHRT. 185
69 4.000e-45UniRef50_A0A1G2Y5D0 Peptidylprolyl isomerase n=1 Tax=Planctomycetes bacterium GWF2_50_10 TaxID=1801959 RepID=A0A1G2Y5D0_9BACT  ali  36  185.PEQVRASHILISTRSTDPNADANSVKAAAKKKA-----DELMAQIKNG-ADFAELAKANSSCPSKDRGGDLGFFGKGQMVPEFDAVAFSMKVGDVNGPVETQFGYHIIKVTE 290
70 4.000e-45UniRef50_A0A2H5VZJ1 Peptidylprolyl isomerase n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H5VZJ1_9BACT  ali  37  217EFEQVRARHILFSTRPIARDGNPPPD-----KETVRRKAQEVLRRARAGE-DFAALAREFSDDPSKDKGGDLDFFGRGRMVREFEDAAFALQPGQISDLVETSYGFHIIKVE. 323
71 4.000e-45UniRef50_A0A1Z5RGG3 Peptidyl-prolyl cis-trans isomerase (Fragment) n=3 Tax=Panicoideae TaxID=147369 RepID=A0A1Z5RGG3_SORBI  ali  51  93..EKVRASHILIKHEGSRRKASWRDPEGVATRDDAADLVRALRDQIVSGDRKFEDIAAENSDCSSAKRGGDLGSFGRGKMQKAFEKAAFALKVGEISDVVDTESGVHIIKRT. 206
72 5.000e-45UniRef50_G7LCY6 Peptidyl-prolyl cis-trans isomerase n=15 Tax=Eukaryota TaxID=2759 RepID=G7LCY6_MEDTR  ali  54  9...EVRASHILIKHEGSRRKASWKDPEKNTTRESAVAILTSMKEDILTGKAKFEDLASRYSDCSSAKRGGDLGSFGRGQMQKPFEDATYALQVGEISDIVDSDSGSHIIKRT. 121
73 5.000e-45UniRef50_UPI000DBE8300 hypothetical protein n=1 Tax=Bradymonadales bacterium B210 TaxID=2211119 RepID=UPI000DBE8300  ali  31  214.PDEVRARHILIKVERGADDEAVAT---------ARAKAQEILELAKAEGADFEALAREHSEGPTAPRGGDLGFFGKGRMVPEFSEVAFGMEPNQVSDLVRTQFGFHIIQLVE 316
74 5.000e-45UniRef50_A0A1V6K3W1 Peptidylprolyl isomerase n=2 Tax=Candidatus Fermentibacteria TaxID=1729712 RepID=A0A1V6K3W1_9BACT  ali  42  43.PQTIEASHILIAYAGAMRAD----PAITRTSDEARQLAVDLLSQIQTGTITFEDAAVEYSDCPSGVNGGTLGQFGRGAMVPEFENAAFALGVGDVSGIVETPFGFHIIKRT. 149
75 5.000e-45UniRef50_G0W838 Peptidyl-prolyl cis-trans isomerase n=11 Tax=Opisthokonta TaxID=33154 RepID=G0W838_NAUDC  ali  46  61.PVRIRCLHILIKHKDSRRPASHRSQNITLSKEDAIKELETIKLRLDDNKNTFESLAKERSDCSSYKRGGDLGWFGKGEMQPSFEKAAFALKVNQVSDIVESDSGVHLIKRV. 171
76 5.000e-45UniRef50_A0A136MXI5 Peptidylprolyl isomerase n=1 Tax=Omnitrophica bacterium OLB16 TaxID=1617433 RepID=A0A136MXI5_9BACT  ali  40  212.PESVSASHILIGATEGTDPQV---------KSASLAKAQALRDQLR-GGADFAELARTNSSCPSSQRGGDLGSFERGQMVPEFEDAAFKLKPGEISDVVETKFGYHIIKVT. 312
77 5.000e-45UniRef50_UPI000D7EFB3B rotamase-domain-containing protein n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D7EFB3B  ali  54  152EPAQVRASHLLVKHRNSRRPSSWKESNITRSPEEAEAILLEHAKTLGPNPSDFAALAKVHSDCSSAQKGGDLGFFAKGQMQKAFEDAAFSLPVGKLSDVVKSDSGHHLIIRT. 265
78 5.000e-45UniRef50_A0A1W9LZB9 Peptidylprolyl isomerase n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9LZB9_9DELT  ali  46  217QPEQVKASHILVKVDPKADEAA---------KAGARKKLEDIENKVKKGE-DFAAIAKSSSDCPSKDNGGDLGYFSRGQMVKPFEDAAFALKTGEVSKIVETQFGFHLIKAVD 319
79 6.000e-45UniRef50_A0A1V4S8X6 Peptidylprolyl isomerase n=2 Tax=unclassified Desulfobacteraceae TaxID=231684 RepID=A0A1V4S8X6_9DELT  ali  38  264.PAKVCARHILFRLKENATKAEA---------EKIRKKAEAVLKMARSG-KDFANLAKKYSEGPTGKNGGDLGCFSRGKMVKPFEEAAFKLKKGEISDLVKTRFGYHIIKVE. 364
80 7.000e-45UniRef50_A0A2N6FIA3 Peptidylprolyl isomerase n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6FIA3_9DELT  ali  39  271.PEEVHAAHILITVPQDADQA---------TRDAKRAEIDKILEQARAGE-DFAALAKRYSEDSSKSQGGDLGFFPRGRMVKPFENAAFSLPVGEISDVVTSQYGYHIIKLLE 372
81 7.000e-45UniRef50_U6D888 Peptidyl-prolyl cis-trans isomerase (Fragment) n=10 Tax=Amniota TaxID=32524 RepID=U6D888_NEOVI  ali  99  1.......SHLLVKPSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 106
82 8.000e-45UniRef50_Q5AZY5 Peptidyl-prolyl cis-trans isomerase n=77 Tax=Eukaryota TaxID=2759 RepID=Q5AZY5_EMENI  ali  55  69QEGKIRCSHLLVKHRDSRRPSSWREAEITRTKEEAREILRGHQERIMRGEIRLGDLAMSESDCSSARKKGDLGFFGRGEMQKEFEEAAFALQPGQVSDIVESGSGLHLIER.. 179
83 8.000e-45UniRef50_D2Z6N3 Peptidylprolyl isomerase n=2 Tax=Dethiosulfovibrio TaxID=47054 RepID=D2Z6N3_9BACT  ali  38  138.PESVKASHILIQVSKDAGNDLWK---------KAKKEATKIRKDILAGKVSFEDAAKRDSDCPSKSRGGDLGFFTEGQMVPEFEKAAFATKIGDISDPVKTQFGYHIIKVTD 240
84 9.000e-45UniRef50_A0A150FSJ3 Peptidylprolyl isomerase n=1 Tax=[Clostridium] paradoxum JW-YL-7 = DSM 7308 TaxID=1121328 RepID=A0A150FSJ3_CLOPD  ali  39  176..EQVKASHILFKTIDENN-----NPYPDEKIESIRKKAEDVLARLKNGE-DFASLAKEYSDDASAQNGGDLGNFSRGVMVPEFEEAAFSLKVGEISDLVKTMYGYHIIKVEE 281
85 1.000e-44UniRef50_A0A2U1DVT2 Peptidylprolyl isomerase n=1 Tax=Acidovorax sp. 99 TaxID=2135634 RepID=A0A2U1DVT2_9BURK  ali  42  150.PEEVKASHILI----------------LATEENAEAKASELLAELK-GGKDFAELAKARSQDPSGAKGGDLGFFGRGRMAKEFEEAAFQLKVGELSGLVKTQFGYHIIKVTD 245
86 1.000e-44UniRef50_X1DVL1 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1DVL1_9ZZZZ  ali  46  24EPVQVHARHILV---------------------ETEEEANNLLLQLKEGLTDFAELAKEKSIGPSAPSGGDLGFFTRGQMVKEFEDAAFSLEPGEISEVVQSQFGYHIIKCEE 115
87 1.000e-44UniRef50_A0A2P9H173 Peptidylprolyl isomerase n=1 Tax=Syntrophobacter sp. SbD2 TaxID=2043168 RepID=A0A2P9H173_9DELT  ali  46  193.PEMVRASHILVKVDEAASGEE---------KAKALEKIKAIQKRIQSGE-DFAKVAHEVSDCPSKEDGGDLNFFHKGQMVLPFEKAAFSLKPGETSDIVETEFGYHIIKLTD 294
88 1.000e-44UniRef50_A0A2U3E0U9 Uncharacterized protein n=1 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3E0U9_9HYPO  ali  62  534.PEKIRAAHLLVKHRDSRRPSSWRESEITRSKDEAMEIIKGHEQKIKSGAISLGDLAPTESDCSSARKRGDLGYFGRGDMQKEFEDAAFALKPGEMSGIVETASGLHLIERLE 646
89 1.000e-44UniRef50_UPI000B8A13D7 hypothetical protein n=1 Tax=Atribacteria bacterium JGI 0000014-F07 TaxID=1104602 RepID=UPI000B8A13D7  ali  47  185EPEQVHARHILV---------------------ETEEEANDLLLQLKEGLTDFAELAKEKSIGPSAPSGGDLGFFSRGQMVKEFEEAAFSLESGEISDVVQTQFGYHIIKCEE 276
90 1.000e-44UniRef50_A0A1V5Y4V0 Peptidylprolyl isomerase n=1 Tax=candidate division BRC1 bacterium ADurb.Bin183 TaxID=1852823 RepID=A0A1V5Y4V0_9BACT  ali  40  186QEEEVKASHILVKVEKDATPEE---------RAAAKKKIEEIRDKITKGG-DFAKLAAEFSDCPSGKRGGNLDWFGKGRMVPEFEAAAFKLKPGELSDIVETSFGYHIIKVTD 289
91 1.000e-44UniRef50_A0A1M6FJH6 Peptidylprolyl isomerase n=4 Tax=Desulfatibacillum TaxID=218207 RepID=A0A1M6FJH6_9DELT  ali  33  190KPEEVRASHILFGTKDAKTAEE---------KEAIKNQAQEVLMKAKQPGADFAALAREYSSCPSKEKGGDLDFFTKERMVPEFSKAAFSMDVGEISSLVETQFGYHIIKVTD 293
92 2.000e-44UniRef50_A0A1C0AH55 Peptidylprolyl isomerase n=1 Tax=Criibacterium bergeronii TaxID=1871336 RepID=A0A1C0AH55_9FIRM  ali  36  180..EQVKASHILIKTQDQDG-----NPLPQDQQDAAKAKIDDIAKKIKAGE-SFEALAKEFSQDGSKDNGGDLGYFRKNEMVPEFEQKAFSMNVGEISEPVKTQYGYHLIKLTD 284
93 2.000e-44UniRef50_A0A285Z361 PPIC-type PPIASE domain-containing protein (Fragment) n=2 Tax=bacterium JGI 053 TaxID=1855372 RepID=A0A285Z361_9BACT  ali  34  89..EEVRARHILLRIPKNATPADH---------DAVRRAAEAIQRQAASFDADFVALARQYSEDPSKENGGDLGFFSRGQMVREFEEAAFKLQPGQVSPVVESPFGFHVIKLEE 190
94 2.000e-44UniRef50_A0A1Y1UD15 Peptidyl-prolyl cis-trans isomerase n=2 Tax=Tremellales TaxID=5234 RepID=A0A1Y1UD15_9TREE  ali  56  68.PGHVRASHILCKHAGSRRPSSWREPNITRPASQARQIIQGYIQQLEAAPSSFAEIASQKSDCSSAKKGGDLGWFGKGMMQKSFEEAAMSLKPGQMSGIVESDSGIHVILRT. 183
95 2.000e-44UniRef50_X1A6I7 Uncharacterized protein (Fragment) n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1A6I7_9ZZZZ  ali  47  1EPEQVHARHILV---------------------ETEEEANNLLLQLKEGLTDFAELAKEKSIGPSAPSGGDLGFFARGQMVKEFEDAAFSLEPGKISGVVQTQFGYHIIKCEE 92
96 2.000e-44UniRef50_S7VIS7 Peptidylprolyl isomerase n=2 Tax=Desulfovibrio TaxID=872 RepID=S7VIS7_9DELT  ali  46  263QDAMVRARHILIKVPENAPADVA---------AKALKKIEDIRAHIKS-PKDFAAAAQKYSEGPSAKVGGDLGWFSRGSMVKPFEDAAFALKPGEISEPVRTSFGYHLILVEE 365
97 2.000e-44UniRef50_A0A0D2T5K4 Peptidyl-prolyl cis-trans isomerase n=16 Tax=Mesangiospermae TaxID=1437183 RepID=A0A0D2T5K4_GOSRA  ali  52  93...QVRASHILIKHQGSRRKASWKDPESNTTRDAAVSQLKALRDDIASGNAKFGEVASRHSDCSSAKRGGDLGPFGRGQMQKPFEDATYSLKIGEISDIVDTDSGVHIIMRT. 205
98 2.000e-44UniRef50_A0A101DHP6 Peptidylprolyl isomerase n=1 Tax=Desulfonauticus sp. 38_4375 TaxID=1635258 RepID=A0A101DHP6_9DELT  ali  43  263EPEKVKARHILVKLSPEASDQE---------KKEAEKKIADILSKLKKGE-DFAKLAKKYSEGPSASRGGELGWFGKGEMIKPFEDEAFKLKKGEIGGPVQTQFGLHLIQVED 365
99 2.000e-44UniRef50_A0A1F4I5T6 Peptidylprolyl isomerase n=1 Tax=Burkholderiales bacterium RIFCSPHIGHO2_12_FULL_69_20 TaxID=1797561 RepID=A0A1F4I5T6_9BURK  ali  36  266..EERRARHILIKADKDAAPD---------IKQKAKARAEALLADARKNPAAFADLAQKNSDDPSATQGGDLDFFGRGAMVKPFEDAAFAMKPGEISNVVESDFGYHVIKLE. 367
100 2.000e-44UniRef50_O60045 Peptidyl-prolyl cis-trans isomerase ssp-1 n=88 Tax=Eukaryota TaxID=2759 RepID=SSP1_NEUCR  ali  62  73...KIRCAHLLVKHNQSRRPSSWRESEITRTKQEALTTLQGFEQRIKSGSISLGELALTESDCSSARKRGDLGYFGRGDMQKEFEDAAFALKPGEISGIVDTASGLHLIERLE 182
101 2.000e-44UniRef50_E1R4Z9 Peptidylprolyl isomerase n=3 Tax=Sediminispirochaeta TaxID=1911556 RepID=E1R4Z9_SEDSS  ali  42  204QPERVRASHILFSVAEDASDQDV---------AAAKTKAESALERYKNGEE-FSDLARELSEGPSASQGGDLGFFGRNQMVKPFEDAAFSMKVGEVSDPVRTKFGFHLIRLT. 305
102 2.000e-44UniRef50_A0A2J0LV17 Peptidylprolyl isomerase n=5 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2J0LV17_9BACT  ali  41  178.PDEVKASHVLIKVGDKA---------VAEEKQKAKEKIEALRARAMSGE-DFAKLAKENSEDASAPNGGDLGYFKKGDMVKPFEDAAFGLEKDQISPVVETQFGYHVIKVTD 279
103 2.000e-44UniRef50_A0A0S8DHE0 Peptidylprolyl isomerase (Fragment) n=1 Tax=Betaproteobacteria bacterium SG8_40 TaxID=1703389 RepID=A0A0S8DHE0_9PROT  ali  40  24.PEERRASHILIAAGADASDED---------KSAAKAKADEIYQQLQAAPGRFEELARANSQDPSAEQGGDLGFFQRGFMVKEFEDAAFALKAGEISSPVQTQYGYHIIRVDE 127
104 2.000e-44UniRef50_F4QFP3 Uncharacterized protein pinA n=1 Tax=Cavenderia fasciculata (strain SH3) TaxID=1054147 RepID=F4QFP3_CAVFA  ali  65  264...KVQCRHLLVKHRESRNPRSWRQEEITRTKEEAMVKLQGYRDMITSGSHKFDELAHKYSDCSSAKRGGDLGFFTRGQMQKAFEDASFALQVGEMTEIVSTDSGVHIIERT. 373
105 2.000e-44UniRef50_A0A2N2H781 Peptidylprolyl isomerase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2H781_9DELT  ali  42  179QPEQVHASHILIKVDPKGGDAA---------KKKARKDMEEILKKLKKGE-DFAALAKQHSQCPSKEKGGDLGFMGRGQTVKPFEDVAFGLKPGETSGIVETEFGFHIVRVLE 281
106 2.000e-44UniRef50_A0A1X7E5A3 Peptidylprolyl isomerase n=1 Tax=Desulfovibrio sp. K3S TaxID=1519643 RepID=A0A1X7E5A3_9DELT  ali  40  264QDAQVKARHILILVDEKASPDEIK---------KAEAKIDKILAKAKSGQ-DFAKLAEKYSEGPSKTKGGELGWFSRGSMVKPFEEAAFKLKKGEISKPVRTRFGFHIIKVED 366
107 2.000e-44UniRef50_A0A208XGA0 Peptidylprolyl isomerase n=4 Tax=Burkholderiales TaxID=80840 RepID=A0A208XGA0_9BURK  ali  41  264QDEQRRASHILIAVDSSASEAA---------REEARKKAQALADQAKAPNADFAKLARENSQDPSARNGGDLDWFGRGMMVKPFEDAAFALKQGEVSGVVPTDYGFHVIKLT. 367
108 3.000e-44UniRef50_A0A2W0A1F1 Uncharacterized protein n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2W0A1F1_9BACT  ali  35  124QAEEVKASHILIQVPAKAD---------TKTDDAARAKAEDILKQLKAG-ANFEELAKKNSDDGSAAKGGSLGWFQRGAMVPEFEKAAFSTPPGQISGAVKSDFGYHIIRVED 227
109 3.000e-44UniRef50_A0A1F5V5Z2 Peptidylprolyl isomerase (Fragment) n=1 Tax=Candidatus Fischerbacteria bacterium RBG_13_37_8 TaxID=1817863 RepID=A0A1F5V5Z2_9BACT  ali  45  264EPEQVKARHILLTT-------------ANKDEEEVRKQAQALYNRVK-GGEDFASLAKQSSEDPSAKNGGDLGFFSRGQMIKEFEDTAFSMNPGEISEPVKTLFGYHIIKVED 363
110 3.000e-44UniRef50_A0A098DPX7 Peptidyl-prolyl cis-trans isomerase n=12 Tax=leotiomyceta TaxID=716546 RepID=A0A098DPX7_GIBZE  ali  61  136.PEKIRAAHLLVKHRDSRRPSSWREAEITRTKEEAFEIIKEHEQKIKSGSVSLGELALTESDCSSARKRGDLGYFGRGDMQKEFEDASFGLSPGQMSEIVETASGLHLIERLE 248
111 3.000e-44UniRef50_B4NCP1 Peptidyl-prolyl cis-trans isomerase n=19 Tax=Arthropoda TaxID=6656 RepID=B4NCP1_DROWI  ali  63  57..DEVQCLHLLVKHKGSRRPSSWREENITRTKEEAQMLLEVYRNKIINEEATFDELARSYSDCSSAKRGGDLGKFGRGDMQAAFEKAAFALNVGQMSGIVDTDSGLHIILR.. 165
112 3.000e-44UniRef50_X1LG44 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1LG44_9ZZZZ  ali  46  148..EQVYARHILV---------------------ETEEEANNLLLQLKEGLTDFAELAKEKSIGPSAPSGGDLGFFTRGQMVKEFEDAAFSLEPGEISDVVQTQFGYHIIKCEE 237
113 3.000e-44UniRef50_A0A2V8DS09 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8DS09_9BACT  ali  35  286..EQVRASHILLKTEGKDDAAV-------------KAKAEDVLKQSKAG-ADFSELAKKYSEDASAKNGGDLDYFGRGRMVPEFDQAAFAMQPGQTSDLVKTQYGYHIIKLVD 383
114 3.000e-44UniRef50_A0A2K8UH35 Peptidylprolyl isomerase n=1 Tax=Candidatus Thiodictyon syntrophicum TaxID=1166950 RepID=A0A2K8UH35_9GAMM  ali  46  192KPESVRASHILIKFAPKATDEE---------KQAAKKKADDLLAKLK-GGADFAEVAKQESADSSAKQGGDLGEFSRGQMVKPFEDAAFGLKPGDLSEVVESQFGYHIIKST. 293
115 4.000e-44UniRef50_A0A2P5HSN3 Maintenance of ploidy protein mob1 n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A2P5HSN3_9PEZI  ali  57  76...KIRAAHLLVKHNQSRRPMSWKESNITRGKEEARKIIEAHQERIKSGDISLGDLAVTESDCSSARKRGDLGYFGRGDMQKEFEDAAFALQPGDISGIVDTASGLHLIERLE 185
116 4.000e-44UniRef50_A0A2S5LXJ9 Peptidylprolyl isomerase n=2 Tax=Nitrosomonadales TaxID=32003 RepID=A0A2S5LXJ9_9PROT  ali  39  265..EQRRASHILIGFGVSATPEQ---------KQQAKAKAEEILAAVKKNPKRFEELAVKESQDPSASKGGDLGSFGRGAMVKPFEDAAFAMKVGQVSDIVESEFGFHIIKLTE 367
117 5.000e-44UniRef50_A0A2P5XP22 Peptidyl-prolyl cis-trans isomerase n=5 Tax=rosids TaxID=71275 RepID=A0A2P5XP22_GOSBA  ali  52  83...QVRASHILIKHQGSRRKASWKDPESNTTRDAAVSQLKALRDDITSGNAKFGEVASRHSDCSSAKRGGDLGPFGRGQMQKPFEDATYSLNIGEISDIVDTDSGVHIIMRT. 195
118 5.000e-44UniRef50_F5R748 Peptidylprolyl isomerase n=7 Tax=Betaproteobacteria TaxID=28216 RepID=F5R748_METUF  ali  34  263QGEERKARHILLGVKQGATPEE---------RKAVKDKAEALLKQLKANPAKFGELAKANSDDPSKDNGGDLGFFGRGTMVKPFEEVAFSLKKGEISGLVETDFGYHIIQLED 367
119 5.000e-44UniRef50_H1XSV4 Peptidylprolyl isomerase n=1 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=H1XSV4_9BACT  ali  40  127QRDEVKARHILIQYKGARN------SKAKRSKEEALKLAEKVAREAKSGKTSFNYLAEKYSDDPSAKNKGDLGYFTWGQMVDEFQKAAFSMKPGEISDPVETPYGYHIIKVED 234
120 5.000e-44UniRef50_A0A2M8CD12 Peptidylprolyl isomerase n=6 Tax=root TaxID=1 RepID=A0A2M8CD12_9BACT  ali  47  183EPEKVHALHIIVNTE---------------------EEANNILNKLKEGIIDFSELAKQKSIDASALNGGDLGFFTRGQMVKEFEDAAFSLKPGEISNVVKTEFGYHIIKLVE 274
121 5.000e-44UniRef50_A0A1Q2HM63 Peptidylprolyl isomerase n=3 Tax=unclassified Phycisphaerae TaxID=1546154 RepID=A0A1Q2HM63_9BACT  ali  44  196.PKQVKASHILIKTE------------SKEDQQAAKEKAEELLKKINDGG-DFAAIAKENSDCPSSERGGDLGFFSRGRMVGAFEDAAFNLEVGEVSDVVKTKFGYHIILVTD 294
122 6.000e-44UniRef50_A0A1V5H1E9 Peptidylprolyl isomerase n=1 Tax=Lentisphaerae bacterium ADurb.BinA184 TaxID=1852901 RepID=A0A1V5H1E9_9BACT  ali  38  141KPETVHARHVLLKVDEGATPED---------KAAKKKQADEIRKQLVDG-ADFAKVAGEKSDCPSKSQGGDLGTFGRGQMVKPFEEAAFAQKVNEVGEVVETQFGYHIIQVTE 243
123 6.000e-44UniRef50_A0A1M2VDF1 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Trametes pubescens TaxID=154538 RepID=A0A1M2VDF1_TRAPU  ali  63  129.PAQVRASHLLVKHSGSRRPSSWKEPNITRSKEEAIEILKGYEAHINSSPEKFAELASKHSDCSSHSHGGDLGFFKPGQMQKPFEDATYALKVGEISDIVSTESGVHLILRT. 259
124 7.000e-44UniRef50_C9M5N6 Peptidylprolyl isomerase n=2 Tax=Jonquetella anthropi TaxID=428712 RepID=C9M5N6_9BACT  ali  44  141.PESIRASHILISVPKGASDKEV---------AEAKDKAMDIIKKIKSGSLEFSKAAQDMSSCPSKVQGGDLGFFSKGQMVPAFEKAAFALKPGEMSEPVRTDFGFHIIKVTD 244
125 7.000e-44UniRef50_A0A1J5ERC3 Peptidylprolyl isomerase n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1J5ERC3_9DELT  ali  43  199.PEQVRARHILIKVAKDADEA---------IKKAAREKIDKLLAQTKKGG-DFAELATKNSEDSSAEKGGDLGFFSKEQMVAPFADAAFALKAGEISPVVESPFGFHIIKCEE 300
126 8.000e-44UniRef50_A0A1W7QNC3 Peptidylprolyl isomerase n=1 Tax=Geobacter pelophilus TaxID=60036 RepID=A0A1W7QNC3_9DELT  ali  39  191QKEQVRASHILIGCDAKATADE---------KKKAREKAEMLLKELK-GGADFAKLAKENSTCPSATNGGDLGYFGRGRMAPTFEEAAFALKTGELSNVVETGYGYHLVKQTD 293
127 8.000e-44UniRef50_A0A1I7FF25 Peptidylprolyl isomerase n=3 Tax=Comamonadaceae TaxID=80864 RepID=A0A1I7FF25_9BURK  ali  34  269..EERRASHILIASPQTAPAAD---------REKAKAKAQELLAQVKKAPDTFADVARKNSQDPSAPNGGDLDFFARGSMVKPFEDAAFALKKGDISDVVESEFGYHVIKLTD 371
128 8.000e-44UniRef50_B3E7D6 Peptidylprolyl isomerase n=1 Tax=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) TaxID=398767 RepID=B3E7D6_GEOLS  ali  47  186QPEQVRASHILITLDXXXXXXXXXXXXXXXXXXXXXVKA----------GADFAKLAQENSGCPSSKQGGDLGYFGKGQMVKPFEETAFAMKPGDVSGVVETQFGYHIIKLTE 288
129 9.000e-44UniRef50_UPI00040731D8 hypothetical protein n=1 Tax=Desulfovibrio aminophilus TaxID=81425 RepID=UPI00040731D8  ali  43  265.PEEVRVRHILLTVDPAAGPAEA---------QKAEASIRALAAKAKSG-ADFAELARRNSQDTSAANGGDLGWFGRGAMVKPFEDAAFALKKGEVSEPVRSEFGWHLIQMED 366
130 9.000e-44UniRef50_H5SJ72 Peptidylprolyl isomerase n=3 Tax=Candidatus Bipolaricaulota TaxID=67810 RepID=H5SJ72_9BACT  ali  43  193.PEEVHARHILIRVPXXXXXXXXXXXXXXXXXXXXX----------LEDGADFAELAKKYSQDPSAQNGGDLGFFGRGQMVQEFEDAAFALEPGQVSDPVRTQFGFHLIKVEE 295
131 9.000e-44UniRef50_F3YU97 Peptidylprolyl isomerase n=3 Tax=Desulfovibrio africanus TaxID=873 RepID=F3YU97_DESAF  ali  41  265..EEVRASHILVKVAKDAPQEEV---------DTAKAKIEDIRKKIT-GSLSFADAAKKFSEGPSGPAGGDLGWFGRGRMVPTFEQAAFALKPGQVSAPVRTEFGWHIIKLEE 365
132 9.000e-44UniRef50_A8J3E3 Peptidyl-prolyl cis-trans isomerase n=7 Tax=Chlorophyta TaxID=3041 RepID=A8J3E3_CHLRE  ali  62  146...RVRASHLLVKHKDVRRPSSWKEPVVTRTREEALAMIEHFHSMLVKGEVEFAALAAQESHCSSAKRGGDLGEFGRGEMQKPFEDATYALKVGELSGPVFSDSGVHLILRT. 254
133 9.000e-44UniRef50_A0A1W9U405 Peptidylprolyl isomerase n=1 Tax=Desulfobacterium sp. 4572_20 TaxID=1971621 RepID=A0A1W9U405_9DELT  ali  40  253.PKKIKARHILLKVSPDASESENK---------ETKERALSLLKRLKNGE-DFAALAKKYSQGPTASRGGDLGYFTRGKMVKPFEKLAFSLKKGEIGGPVKTRFGWHIIRVDD 354
134 9.000e-44UniRef50_F8ADL9 Peptidylprolyl isomerase n=3 Tax=Thermodesulfatator TaxID=241192 RepID=F8ADL9_THEID  ali  41  135EPEEVRARHILIQVPQNASKEEVK---------KAYEKAQKIRERLLKGE-DFAKLAKEYSDDPTKDKGGELGFFSRGQMIKEFEDAAFSLKPGEISKPIRTPFGFHIIQVEE 238
135 1.000e-43UniRef50_D8F5E0 Peptidylprolyl isomerase n=1 Tax=delta proteobacterium NaphS2 TaxID=88274 RepID=D8F5E0_9DELT  ali  38  265QPKQVKARHILFKFNKDDSEEV---------KNTVKKKAEKVLEKARKGE-DFASLAKKYSEGPTKSKGGDLGYFKTGEMEKPFEEAAFALKKGEISDLVQTRFGYHIILVED 367
136 1.000e-43UniRef50_A0A1J5E9S8 Peptidylprolyl isomerase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1J5E9S8_9DELT  ali  40  267.PEKRHVRHILIRADATASPEVM---------DAKRKKAEDLLARLKKGE-DFATLAKAYSEDSSASRGGDLGFFGRGQMVPAFEDAAFALLAGETSAVVRTDFGFHLIKLEE 368
137 1.000e-43UniRef50_A0A1E7I914 Peptidylprolyl isomerase n=6 Tax=Desulfovibrio TaxID=872 RepID=A0A1E7I914_9DELT  ali  38  264QDEQVNARHILILVDENASDADI---------AKAEKSIKKIYAKAKAGQ-DFSELASKYSEGPSKTKGGELGWFSRGAMVKPFEDAAFSLKKGQISKPVRTRFGFHIIKAED 366
138 1.000e-43UniRef50_A0A1G0DXJ7 Peptidylprolyl isomerase n=5 Tax=root TaxID=1 RepID=A0A1G0DXJ7_9PROT  ali  36  264.PEERQAAHILIAVAATAPQAE---------QDAAKAKAEQLLQQAKKNPAEFAALAKQNSQDPSAVNGGDLGFFGHGMMVGPFEDAAFALKQGEISDLVKSDFGYHIIKL.. 365
139 1.000e-43UniRef50_P22696 Peptidyl-prolyl cis-trans isomerase ESS1 n=23 Tax=Saccharomycetales TaxID=4892 RepID=ESS1_YEAST  ali  49  57.PVRVRCLHILIKHKDSRRPASHRSENITISKQDATDELKTLITRLDDDSKSFEALAKERSDCSSYKRGGDLGWFGRGEMQPSFEDAAFQLKVGEVSDIVESGSGVHVIKRV. 169
140 1.000e-43UniRef50_UPI000DBEA30C hypothetical protein n=1 Tax=Bradymonadales bacterium B210 TaxID=2211119 RepID=UPI000DBEA30C  ali  44  247..EEVRARHILVRV-DSESPEDW---------ESARQEAQALHDQIT-GGADFAQVARDNSDDGSAQAGGDLGSFGRGRMVPEFEEAAFSMQVDEISEPVRTDFGWHIIQVTE 346
141 1.000e-43UniRef50_A0A1J5AJP4 Peptidylprolyl isomerase n=1 Tax=Anaerolineae bacterium CG2_30_64_16 TaxID=1805005 RepID=A0A1J5AJP4_9CHLR  ali  41  226..EQVRASHILVRIPTPTPDPSAQPTPTPRDDAQALARIIEVKQKLAAGE-DFATLAMEHSDDGSAASGGELGWFGRGQMVTEFEDAAFSLQPGQTSDPVKTAFGYHLIKVEE 350
142 1.000e-43UniRef50_A0A179D7G3 Peptidylprolyl isomerase n=1 Tax=Thermosulfurimonas dismutans TaxID=999894 RepID=A0A179D7G3_9BACT  ali  36  136.PERVKARHILIRVPEKAGPEA---------QKAALKKAEDLRQKILAG-ADFSEIARKYSEDPTKDKGGDLGFFARGQMIPEFEEAVFKLKVGEISPPIKTRFGYHLVQVE. 237
143 1.000e-43UniRef50_A0A1W9PSB9 Peptidylprolyl isomerase n=1 Tax=candidate division KSB1 bacterium 4484_219 TaxID=1968530 RepID=A0A1W9PSB9_9BACT  ali  38  184EPEKVHVRHIFFKVDKNATPTK---------RTKVRKKAEQVLQLARSGE-DFAELAQKYSEDPSASNGGDLGFFARGDMVKPFDETVFQLEVGEISDLVETSHGYHIIKLEE 286
144 2.000e-43UniRef50_A0A0S8CKE1 Peptidylprolyl isomerase n=2 Tax=Desulfobacterales TaxID=213118 RepID=A0A0S8CKE1_9DELT  ali  41  262.PEQRSARHILIKTSEEDTEDIL---------AEKRKMAEQVLELAKSGE-DFAELAKQYSEGPTGPRGGDLGAFSRGRMVKPFEDAAFSLKEGEISDIVETQFGFHVIKLE. 362
145 2.000e-43UniRef50_A0A2E4ZZ19 Peptidylprolyl isomerase n=2 Tax=root TaxID=1 RepID=A0A2E4ZZ19_9BACT  ali  41  507.PSEIRASHILVAYKGGPDP----KPSITRTKEEARARAETIRKQVSEEGKDFAQVARESSDGPSAPQGGDLGKFTFDKMVKPFSEAAFALKVGGISGVVESKFGFHVIKRTE 614
146 2.000e-43UniRef50_A0A069ATU8 Peptidylprolyl isomerase n=72 Tax=Clostridia TaxID=186801 RepID=A0A069ATU8_CLODI  ali  40  229...QVRASHILIKTVDDKGKQVSSSK-----KAELKKEAEEILKKAQAGE-DFATLAKKYSEDSSAESGGDLGFFGKGQMVESFEKAAFALKKGEVSKLVESDYGYHIIKKTD 333
147 2.000e-43UniRef50_A0A286USZ0 Peptidyl-prolyl cis-trans isomerase n=2 Tax=Agaricomycetes TaxID=155619 RepID=A0A286USZ0_9HOMO  ali  58  54...QVRASHLLVKHSGSRRPSSWKEENITRSKEDAIDILRQYEREIDGSVEKFGELAAKHSDCSSHTHNGDLGFFSKGMMQKPFEDATYALQVGQISDIVETDSGVHLILRT. 162
148 2.000e-43UniRef50_D6SRD4 Peptidylprolyl isomerase n=3 Tax=Desulfohalobiaceae TaxID=213117 RepID=D6SRD4_9DELT  ali  40  263QPEEVKARHILVEVEEDAPELE---------QEQARERIEQILAELEMGQ-SFEELAREHSQCPSAAEGGDLGRFGRGEMVEPFEEAAFDLTPGEVSSPVQTRFGWHLIKVEE 365
149 2.000e-43UniRef50_A0A1Q2MC28 Peptidylprolyl isomerase n=1 Tax=Phycisphaerae bacterium SM-Chi-D1 TaxID=1851148 RepID=A0A1Q2MC28_9BACT  ali  53  193QPEQVRASHILVKVEXXXXXXXXXXXXXXXXXXX---------XXIDAGE-DFAELAKSESDCPSGKNGGDLNFFSQGRMVKPFSDAAFAMEVGEISDVVETQFGYHIIKVTD 295
150 2.000e-43UniRef50_A0A0G4LJ43 Uncharacterized protein n=2 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4LJ43_9PEZI  ali  61  291...KIRAAHLLVKHEGSRRPSSWRQEKIDRTKEDAYSIIRGYEEKIKSGQSSLGDLAVTESDCSSARKRGDLGYFGQGDMQREFEEAAFALKVGEVSGIVETASGLHIIERLE 400
151 2.000e-43UniRef50_E8WLA8 Peptidylprolyl isomerase n=2 Tax=Geobacter sp. (strain M18) TaxID=443143 RepID=E8WLA8_GEOS8  ali  43  189.PENARASHILVKVDDKLTAEQ---------KQQAKEKAEALLKRVK-GGEDFAAVAKTESGCPSATVGGDLGTFGRGQMVPPFEKAVFAMKPGEISSVVESQFGFHIIKLVE 290
152 2.000e-43UniRef50_W9SN23 Peptidyl-prolyl cis-trans isomerase Pin1 n=2 Tax=Morus notabilis TaxID=981085 RepID=W9SN23_9ROSA  ali  52  290...QVRASHILIKHQGSRRKASWKDPESNTTRDAAVSQLKSLRDDIVSGKAKFDAVASRYSDCSSAKRGGDLGPFGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRT. 402
153 3.000e-43UniRef50_A0A2S5QPE3 Peptidylprolyl isomerase (Fragment) n=1 Tax=Methylotenera sp. TaxID=2051956 RepID=A0A2S5QPE3_9PROT  ali  38  265..EQRRASHILIGSGVNATPEQ---------KQEAKDKAQTLLATIKKNPKSFEELAIKNSQDPSATKGGDLGSFGRGAMVKPFEEAAFSMKVNEVSDLVESEFGYHIIKLTE 367
154 3.000e-43UniRef50_H0PTI5 Peptidylprolyl isomerase n=27 Tax=Proteobacteria TaxID=1224 RepID=H0PTI5_9RHOO  ali  37  263QPEERNARHILITVAADAAPEAV---------EKAKAKAEGILAQVRENPKRFAELAKAESQDPSASRGGDLGAFGRGTMVKPFEDAAFSLAKGQISDLVRSDFGFHIIEVTD 367
155 3.000e-43UniRef50_A0A1F2S0T9 Peptidylprolyl isomerase n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2S0T9_9BACT  ali  40  190QAERVHASHILIRVPEGADAAA---------KTQARERAAGVLEEVKAG-KDFAALAKQHSQDPSAAKGGDLGYFERGQMVGPFEEAAFSLPTGQTSELVETPFGFHILKVID 293
156 3.000e-43UniRef50_A0A2H5ZJX4 Peptidylprolyl isomerase n=1 Tax=bacterium HR30 TaxID=2035425 RepID=A0A2H5ZJX4_9BACT  ali  35  265QPERVHARHILFRLQPNATSEQ---------KEAVRKRASEVLERARKGE-DFAELAKTYSEDPSGPQGGDLGFFPRGQMVPAFEAVAFALPPGSISDLVETNFGFHIIKVE. 367
157 3.000e-43UniRef50_A0A1Y2EA98 Peptidyl-prolyl cis-trans isomerase n=6 Tax=Fungi TaxID=4751 RepID=A0A1Y2EA98_9PEZI  ali  58  65..DKIRAAHLLVKHNESRRKSSWRQADITRSKQEAEDIIKGYEARIKRGETTLGELATTESDCSSARKRGDLGYFGKGDMQKEFEDAAFALQPGQMSGVVSTASGLHLIERLE 175
158 4.000e-43UniRef50_A0A2F0APW4 Peptidylprolyl isomerase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2F0APW4_9DELT  ali  32  199..EQVRASHILIKVGKKDDEAKQKT---------AEKKAKDVFKLATAKGADFAKLAKEHSEGPTKSRGGDLSFFTKGRMVPAFEKVAFALEKGKVSEPVKTQFGWHIITVTD 300
159 4.000e-43UniRef50_A0A1G1DIB6 Peptidylprolyl isomerase n=3 Tax=unclassified Nitrospinae TaxID=1449243 RepID=A0A1G1DIB6_9BACT  ali  40  194EQESVKASHILVKVDKNATKEAKETAKKK---------IDGLLKKVR-GGEDFAKLAKENSDDPSGQNGGDLGFFGKGMMVPPFEKAAFSLNKGEVSDVVETEFGYHIIKMVD 297
160 4.000e-43UniRef50_K4B6B4 Peptidyl-prolyl cis-trans isomerase n=20 Tax=cellular organisms TaxID=131567 RepID=K4B6B4_SOLLC  ali  50  13..DKVKASHILIKHQESRRKFSWKDPESNTTKEAAVSQLKSIREDIVSGKAKFQDIAATHSHCSSAKRGGDLGSFGKGQMQKPFEEATFALKVGEISDIVETESGVHIILRT. 126
161 4.000e-43UniRef50_A0A0D3CRI5 Uncharacterized protein n=2 Tax=Brassica oleracea var. oleracea TaxID=109376 RepID=A0A0D3CRI5_BRAOL  ali  52  259..DQVKASHILIKHQGSRRKASWKDPEMTTTREAAVEQLKSIREDIVSGKATFEDVAARVSDCSSAKRGGDLGPFGRGQMQKPFEEATYALKVGDISEIVDTDSGVHIIKRT. 373
162 4.000e-43UniRef50_D4H1I0 Peptidylprolyl isomerase n=2 Tax=Denitrovibrio TaxID=117999 RepID=D4H1I0_DENA2  ali  36  264EPERVRAAHILFRVENWDDEKAAT---------EIYQKAKKVRKEIVDG-ADFAKMAEKYSEDSTAQNGGELGFFTRGQMVPEFENAAFTTNPGEVSDVVKTQFGFHIINVEE 366
163 5.000e-43UniRef50_A0A1Y3Q9V5 Peptidylprolyl isomerase n=1 Tax=Firmicutes bacterium ZCTH02-B6 TaxID=1861639 RepID=A0A1Y3Q9V5_9FIRM  ali  44  158QPEQVRARHILV---------------------ETEEQAQELKQRLAAGE-NFAALAQEHSIDGSAARGGDLGWFGRGVMVAPFEEAAFSLQPGEISDVVKTNFGYHLILVEE 249
164 5.000e-43UniRef50_A0A0T6A014 Peptidylprolyl isomerase n=1 Tax=candidate division NC10 bacterium CSP1-5 TaxID=1640516 RepID=A0A0T6A014_9BACT  ali  40  175QEEAVQARHVLIKVAPDASPEV---------EQKTKERANAVLAKAKKGE-DFSKLAAQHSEDSTKDNGGDLGYFGRGRMVKPFEEAAFALKAGQISDLVRSQFGYHIIKVE. 276
165 5.000e-43UniRef50_A0A0D2BU36 Peptidyl-prolyl cis-trans isomerase n=63 Tax=Fungi TaxID=4751 RepID=A0A0D2BU36_9EURO  ali  61  67...KIRAAHLLVKHKDSRRPSSWRETNITRSKEEAIEMLKGYEEEIRSGQKSLGDLAVSESDCSSARKRGDLGFFGKGQMQKEFEDAAFALAPGEMSGVVETASGVHLIQR.. 174
166 6.000e-43UniRef50_A0A2V9MGD7 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9MGD7_9BACT  ali  41  267.PERVRAAHILFKTEGKSPEEV----------EKIRNKATEVLLQAKKGE-DFATLAKKYSEDGSAANGGDLGFFGRGQMVLPFENAAFTLGVGAISDLVTTKFGFHIIKVLE 367
167 6.000e-43UniRef50_A0A1F4GGI8 Peptidylprolyl isomerase n=2 Tax=unclassified Burkholderiales TaxID=119065 RepID=A0A1F4GGI8_9BURK  ali  39  266.PEERRASHILIKTESGASADQ---------KKAARTKAEGLLAQLKQNPSLFAELARKNSDDPSAVAGGDLDFFGRGAMVKAFDETAFKLKKGEVSGIVETEFGYHIILLTD 369
168 6.000e-43UniRef50_A0A0F4YL81 Peptidyl-prolyl cis/trans isomerase n=1 Tax=Rasamsonia emersonii CBS 393.64 TaxID=1408163 RepID=A0A0F4YL81_TALEM  ali  57  69...KIRCAHLLIKHRDSRRPSSWREAEITRSKEEAIEILRGHERRIKSGEARLGDIALTESDCSSARKKGDLGFFGRGEMQKEFEEAAFALQPGQISGIVETASGVHLIER.. 176
169 6.000e-43UniRef50_A0A2S7PXF2 Putative parvulin (Peptidylprolyl isomerase) protein n=1 Tax=Rutstroemia sp. NJR-2017a BVV2 TaxID=2070413 RepID=A0A2S7PXF2_9HELO  ali  56  253...KIRASHLLVKHRDSRRPSSWREAEITRTKEEAMSIILQHEARIRAGTSSLGDLAVSESDCSSARKMGDLGYFGRGDMQKEFEEAAFALEPGQVSGVVETASGLHLIER.. 360
170 7.000e-43UniRef50_Q1H1F6 Peptidylprolyl isomerase n=22 Tax=root TaxID=1 RepID=Q1H1F6_METFK  ali  42  265..EQRRASHILIGFGVSPTPE---------TKQKAKEKAEEVLALVKKNPERFEQLAHQYSQDPSKDKGGDLGLFGPGTMVKPFEDAVFSMKPGTISDLVETDFGYHIIKLTE 367
171 7.000e-43UniRef50_A0A1A9NPU5 Peptidylprolyl isomerase n=1 Tax=Methylobacillus sp. MM3 TaxID=1848039 RepID=A0A1A9NPU5_9PROT  ali  39  265..EQRRASHILIGFGKGD----------AASKQSAREKANSILAEVKKDPAKFDALAKQYSQDPSAQNGGDLGLFGRGMMVKPFEEAVFNMRPGAISDLVESEFGFHIIKLTE 366
172 7.000e-43UniRef50_A0A2U8FRY1 Peptidylprolyl isomerase n=1 Tax=Aquabacterium olei TaxID=1296669 RepID=A0A2U8FRY1_9BURK  ali  35  291.PEERRASHILISVDPKATADQ---------KKAARTKAEGLLAQARKNPAGFGELARANSSDGSATNGGDLDFFGRGAMVKPFDEAVFKLKTGEISDLVESEFGFHIIKLT. 393
173 7.000e-43UniRef50_A0A2P9H3P7 Peptidylprolyl isomerase n=2 Tax=Burkholderiales bacterium TaxID=1891238 RepID=A0A2P9H3P7_9BURK  ali  39  266..EQRRASHILITSGKDGSAPD---------KAAARALAENLLRQVRAKPADFARLAREYSKDPSAEKGGDLGWFGRSMMTKPFEDAAFALKEGQISDIVESDFGFHIILVT. 367
174 7.000e-43UniRef50_Q55EZ0 Peptidyl-prolyl cis-trans isomerase n=6 Tax=Dictyostelids TaxID=33083 RepID=Q55EZ0_DICDI  ali  60  158..KTVTCRHLLVKHQGSRNPSSWRESKITRTKERAIAKLNEYRATIISGSATFEDLAHKNSDCSSAKRGGYLDPFKRGQMQRPFEDCAFSLKVGEVSGIVDTDSGVHIIER.. 266
175 8.000e-43UniRef50_B7FZK3 Peptidyl-prolyl cis-trans isomerase n=2 Tax=Eukaryota TaxID=2759 RepID=B7FZK3_PHATC  ali  53  44KPTHVRALHILRKHKDSKRPSSWRVPKITISREQAREELQGLLEILQEEAHDFEELAKEESDCSSAKRGGDLGVFGRGKMRPEFEHAAFALDVGQLSGLIDTSSGVHIILRTE 163
176 9.000e-43UniRef50_UPI0009D9EC69 peptidylprolyl isomerase n=1 Tax=Melaminivora alkalimesophila TaxID=1165852 RepID=UPI0009D9EC69  ali  38  117..EERRASHILINAPKDAPAAE---------RAQARERAEQLLAELREAPDRFAELARKNSQDPSAEAGGDLGFFGRGAMVKPFEDATFGLAKGEISDVVETDFGYHIIRLTD 219
177 9.000e-43UniRef50_A0A2M6XW49 Peptidylprolyl isomerase (Fragment) n=1 Tax=Gallionellales bacterium CG08_land_8_20_14_0_20_59_87 TaxID=1974018 RepID=A0A2M6XW49_  ali  36  171..EQRHAAHILIGVPKNASDAD---------KDAARQKAEAILQQVRQKPATFAALAKQHSEDGSAANGGDLGMFARGMMVKPFDDAVFSLKVGEISALVQTDFGFHIIKL.. 271
178 9.000e-43UniRef50_A0A2D7NP52 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2D7NP52_9DELT  ali  44  36....ITASHILISFKGASRSEQ------NRXRDEAKKLAGELAEKAQKGE-DFANLARXNSDGPSAPKGGLLGTFGRGQMVPPFEEAAFALKVGEVSGVVETPFGFHVIKR.. 135
179 9.000e-43UniRef50_A0A194AER9 Peptidylprolyl isomerase n=2 Tax=Desulfoplanes formicivorans TaxID=1592317 RepID=A0A194AER9_9DELT  ali  34  263QEEQIKARHILIKVAQDADHKDV---------AKAQAKMEDILARYKKG-TPFAELATTFSQGPSRAQGGDLGWFPRGRMVPAFEQAAFALQKGEVSEPVRTPFGFHLIQVED 365
180 9.000e-43UniRef50_A0A1G0XQM0 Peptidylprolyl isomerase n=5 Tax=unclassified Lentisphaerae (miscellaneous) TaxID=641407 RepID=A0A1G0XQM0_9BACT  ali  40  227.PESVRASHILITPDDIDPEKEKGMSEEDKKKAEARKKASEILAKIKQGE-DFAKLAAENSACPSKEKGGDLGAFEKGRMAEEFEKAAFAMEPGNISEVVETDYGFHIIKLTE 343
181 9.000e-43UniRef50_A0A062Y090 Peptidylprolyl isomerase n=1 Tax=Thermoanaerobaculum aquaticum TaxID=1312852 RepID=A0A062Y090_9BACT  ali  39  268EPETVHARHILVRPEGDGEDAWR----------KAQERAMAVLRKAQAPGADFAALAKEFSEDPSKESGGDLGWFERGRMVKEFEDAVFAMQPGEVKGPVRSQFGYHIILLE. 370
182 1.000e-42UniRef50_UPI0004034F22 hypothetical protein n=1 Tax=Thermithiobacillus tepidarius TaxID=929 RepID=UPI0004034F22  ali  39  267..EQRRARHILISVPQDASAEAVK---------QAQGKAETLVKQLR-GGADFAALAKAESQDPSAAQGGELGFFGRGTMVKPFEDAVFALKPGEISAPVRTPFGFHIIQLEE 368
183 1.000e-42UniRef50_A0A1F2S2T8 Peptidylprolyl isomerase n=10 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2S2T8_9BACT  ali  41  276.PEQVRASHILLNVAG---------------KEEARTQAEALLQQVKAGG-DFAELARKFSDDGTRAMGGDLDYFGRGRMVPEFEQAAFALEPGQVSDIVRTQFGFHIIKVVD 374
184 1.000e-42UniRef50_A0A1V1WWA6 Peptidylprolyl isomerase n=1 Tax=Desulfobacterales bacterium S7086C20 TaxID=1869302 RepID=A0A1V1WWA6_9DELT  ali  41  178QPEKIQAKHILIKVDPKEDKSK---------KAEAKNKIKKAQQRLKAGEQ-FSKLAEELSQCPSSKKGGDLGYFGRGQMVKSFEEAAFTLKQGEVSDIVETSFGYHLIKLVD 280
185 1.000e-42UniRef50_V7CFQ6 Peptidyl-prolyl cis-trans isomerase n=28 Tax=Spermatophyta TaxID=58024 RepID=V7CFQ6_PHAVU  ali  53  9...EIRASHILIKHEGSRRKASWKDPEKSTTREAAVSQLKALRDDIVSGKATFEDVASRFSDCNSSKRGGDLGPFGRGQMQKPFEDATLALKVGELSDIVDTDSGVHIIKRT. 121
186 1.000e-42UniRef50_A0LFR5 Peptidylprolyl isomerase n=3 Tax=Syntrophobacter TaxID=29526 RepID=A0LFR5_SYNFM  ali  43  204.PEMVRASHVLIKVDPKAGDAD---------KAKAKERITAAQKKVQAGE-DFAKVAKEVSECPSAAKGGDLDFFQRGQMVGPFEQAAFALKVGSVSDIVETQFGYHVIKVTD 305
187 1.000e-42UniRef50_V4J6W9 Peptidylprolyl isomerase n=1 Tax=uncultured Desulfofustis sp. PB-SRB1 TaxID=1385624 RepID=V4J6W9_9DELT  ali  39  265.PEQRRARHILLQASETDSDQIH---------EEKRALAEQLRERLLAGE-DFSELATSYSEGPTAQNGGDLGFFGRGQMVAPFEEAVFSLSVGEISEVVQTGFGYHIIILDD 366
188 1.000e-42UniRef50_A0A2N6DJ32 Peptidylprolyl isomerase n=1 Tax=Denitrovibrio sp. TaxID=2053308 RepID=A0A2N6DJ32_9BACT  ali  33  264EPEQVNAAHILLTVDNWDDEKAAT---------AVYQKAKDIKKQIENG-ADFAEMAKKFSEDGSAETGGDLGFFTKDQMVPEFEKAAFETEVGEISDVVKTQFGFHIIKVKE 366
189 1.000e-42UniRef50_E5Y7P0 Peptidylprolyl isomerase n=3 Tax=Bilophila TaxID=35832 RepID=E5Y7P0_BILWA  ali  37  264.PEMVRARHILILSDAKASAED---------QAKAKAKIEEIAKRIKAGE-DFGEVAKEVSEDPSGPQGGELGWFAHGQMVPEFDKASFALNPGELSEPVKTQFGWHLIQLEE 366
190 1.000e-42UniRef50_UPI00041890CF hypothetical protein n=1 Tax=Desulforegula conservatrix TaxID=153026 RepID=UPI00041890CF  ali  46  176KPESVKASHILAKCDKADAAGC----------KKAEEKIKDLRKKIAAGG-DFAALAKANSDCPSKDQGGDLGEFGRGQMVKPFEDAAFAMKQGDLSQPVKTDFGWHLIKVT. 276
191 1.000e-42UniRef50_A0A1E7H8G4 Peptidylprolyl isomerase n=2 Tax=unclassified Desulfobacterales TaxID=1403365 RepID=A0A1E7H8G4_9DELT  ali  42  263.PKSVKARHILFMLPEDASPEQV---------EEARKRAADCLEKAR-GEEDFAALARKYSEGPTKDRGGDLGTFSPGRMVKPFEDAAFSLSAGEISDLVRTKFGWHIIKVEE 364
192 1.000e-42UniRef50_A1TMY2 Peptidylprolyl isomerase n=38 Tax=Comamonadaceae TaxID=80864 RepID=A1TMY2_ACIAC  ali  32  268..EERRASHILINAPKDAPAAD---------REKARARAQALLEQVRKAPGTFAEVARKNSQDGSAPSGGDLGFFKRGDMVKPFEDAAFSMKKGDISDLVESEYGYHIIQLND 370
193 2.000e-42UniRef50_A0A0D8XWS6 PPIC-type PPIASE domain protein n=2 Tax=Strongylida TaxID=6308 RepID=A0A0D8XWS6_DICVI  ali  63  216...QVRAAHLLVKHSGSRRPSSWRSDNITRSKEDARNILKDYIRQIRSSSATFRKLAQQFSDCNSAKRGGDLGMFGRRQMQKPFEDASFALDVGEMSDIIETESGLHII.... 324
194 2.000e-42UniRef50_A0A2N6BCU3 Peptidylprolyl isomerase n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2N6BCU3_9DELT  ali  39  198.PETVHASHILITPEGDSEEAKEAAKKK----------IEGLREDIAKG-ADFAEVAKENSSCPSAPNGGDLGTFERGKMVPEFEEAAFSLKPGELSNVVETKFGYHIIKAQE 298
195 2.000e-42UniRef50_A0A143PUQ1 Peptidylprolyl isomerase n=12 Tax=unclassified Acidobacteria TaxID=458031 RepID=A0A143PUQ1_9BACT  ali  35  272QSEQVRASHILLNTEGKD-------------EAAVRAKAEDLLKQIK-GGADFEALARANSQDPSASKGGDLDFFGRGRMVPEFEAVAFTLPVGQLSDVVRTQYGFHIMKVTD 371
196 2.000e-42UniRef50_E4TJ68 Peptidylprolyl isomerase n=1 Tax=Calditerrivibrio nitroreducens (strain DSM 19672 / NBRC 101217 / Yu37-1) TaxID=768670 RepID=E4TJ68_C  ali  43  260QDEQIKARHILIKIDNFQDNVSV---------EKALKKAEEIYKKAKSG-AKFEELAKQYSDDISKNNGGDLGFVKRGMMIKEFEDALFSLKEGEISKPVKTSFGYHIIK... 359
197 2.000e-42UniRef50_A0A257FXW0 Peptidylprolyl isomerase n=13 Tax=Burkholderiales TaxID=80840 RepID=A0A257FXW0_9BURK  ali  33  269..EERRASHILITAAKDAPAAD---------RTKARAKADELLAAVRKSPKSFADLARKNSQDPSAAKGGDLDFFAKGAMVKAFEDAAFALKKGEISDVVESEFGFHIIELTD 371
198 2.000e-42UniRef50_A0A2E6EMQ3 Peptidylprolyl isomerase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2E6EMQ3_9RICK  ali  37  235QPKKVSARHILLKFGDNDDDS---------SRAEIRTRMEEILALAKADGSDFAALASEHSEDSSASRGGDLGFFDKGRMVEEFSDAAFALEIGGISGIVETRYGLHIIKVED 338
199 2.000e-42UniRef50_E8WN82 Peptidylprolyl isomerase n=2 Tax=Geobacteraceae TaxID=213422 RepID=E8WN82_GEOS8  ali  44  299KPESVRASHILVGSDEKATPEE---------RKKAKEKAEALLKRVKAGE-DFAAIAKAESSCPSASQGGDLGTFGRGQMVPAFEKAAFALKQGETSGVVESEFGYHIIKVTE 401
200 2.000e-42UniRef50_I0I3E5 Peptidylprolyl isomerase n=1 Tax=Caldilinea aerophila (strain DSM 14535 / JCM 11387 / NBRC 104270 / STL-6-O1) TaxID=926550 RepID=I0I3  ali  40  285..EAVHARHILLRIREPAPTPTPLPEGVTRNEEQTLALANELRQRLLNGE-DFAALAAEYSDDPSAAQGGDLGWFGRGRMVAPFEEAAFSLAVDEISEPIKTDFGYHIIQVLE 412
201 2.000e-42UniRef50_I1IVR5 Peptidyl-prolyl cis-trans isomerase n=15 Tax=Pooideae TaxID=147368 RepID=I1IVR5_BRADI  ali  50  14..ETVRASHILIKHEGSRRKSSWKDPESATTRADAAARLGGLRDQILAGGASFADIAAQHSDCSSARRGGDLGTFGRRQMQKPFEDATYALKVGEISDIIDTESGVHIILRT. 127
202 2.000e-42UniRef50_U5H1R7 Peptidyl-prolyl cis-trans isomerase n=2 Tax=Microbotryum TaxID=34416 RepID=U5H1R7_USTV1  ali  56  118.PTKVRASHLLIKSEKSRRPSSWRQLHITRTVGQAREILQTHQQNLQAAEKQFARVAKAESDCSSAREGGDLGFFGRQQMQKPFEEAAFALKVGEMSPIIQTDSGLHLILRT. 231
203 2.000e-42UniRef50_A0A1V4XE27 Peptidylprolyl isomerase n=1 Tax=Syntrophaceae bacterium PtaB.Bin038 TaxID=1811716 RepID=A0A1V4XE27_9DELT  ali  42  143.PEMVRARHLLVAVKPDAKEDE---------KKAARKKAEELLAKAKAGE-DFAKLAQENSDDPSKAKGGDLGFFTQGSMVGKFEQAAFALKPGELSGVVETEFGYHIIKQEE 245
204 2.000e-42UniRef50_A0A2G9MJN6 Uncharacterized protein n=4 Tax=Candidatus Woesearchaeota TaxID=1801616 RepID=A0A2G9MJN6_9ARCH  ali  48  198.PEQVRARHILVNSS---------------------EEAESILKELKDG-ADFIDLAKEKSICPSASEGGDLGYFSKGQMVKEFEDAAFALEVGELSPVVETQYGYHIIKLLD 287
205 2.000e-42UniRef50_A0A077ZQD7 Peptidyl-prolyl cis-trans isomerase n=31 Tax=Eukaryota TaxID=2759 RepID=A0A077ZQD7_STYLE  ali  54  4.PTQVRASHILLKHTGSRNPDSYRNKQVTRSKQDAIDGIEQIKSQISSHE-DFVRLAQEFSECRSAANGGDLGVFGRGQMQQQFEEAAFALQVGELSGLVDSDSGIHIILR.. 113
206 2.000e-42UniRef50_UPI000DAD5568 hypothetical protein n=1 Tax=Bradymonas sediminis TaxID=1548548 RepID=UPI000DAD5568  ali  33  215QPEQVHARHILIKVPEDADEAGW---------ESARKRAAEIQTKASAPDADFAALAAELSEGPGARNGGDLGWFGRQQMVPEFEKVAFTLEKNAISEPVRTQFGWHIIQKLD 319
207 2.000e-42UniRef50_A0A2G6FC05 Peptidylprolyl isomerase n=4 Tax=Desulfobulbus TaxID=893 RepID=A0A2G6FC05_9DELT  ali  37  264.PEQRRASHILFKVAESDSAER---------KAEQRKKAEDILQQLREG-ADFAALATEFSEGPSKTKGGDLGLFPRGAMVPAFDAAVFSMEKGALSEIVETPFGYHVIKLTE 365
208 2.000e-42UniRef50_F7HDX7 Peptidyl-prolyl cis-trans isomerase n=22 Tax=Opisthokonta TaxID=33154 RepID=F7HDX7_MACMU  ali  100  51EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFED---------MSGPVFTDSGIHIILRTE 154
209 2.000e-42UniRef50_A0A1G3BKT3 Peptidylprolyl isomerase n=1 Tax=Planctomycetes bacterium RIFCSPLOWO2_02_FULL_50_16 TaxID=1801981 RepID=A0A1G3BKT3_9BACT  ali  42  173..EEVKASHILI---------DTRNLKAKKDYAIAFDKIHKLKEQL-NGGANFEELAKANSNCPSAKNGGDLGYFPRGVMIEPFAEAAFALKVGEISEPVQTQFGFHIIKVTD 274
210 3.000e-42UniRef50_A0A1M4TT54 Peptidylprolyl isomerase n=4 Tax=Desulfacinum TaxID=35836 RepID=A0A1M4TT54_9DELT  ali  42  175.PERVHARHILAAVAPDASEAD---------KKAAREKIADAQKRLQKGE-DFAAVASEMSDCPSREKGGDLGLFGRGEMVEPFEKAAFALEPGKTSDVVETQFGYHLIQVTE 276
211 3.000e-42UniRef50_A0A1T4VJ04 Peptidylprolyl isomerase n=1 Tax=Desulfovibrio bizertensis DSM 18034 TaxID=1121442 RepID=A0A1T4VJ04_9DELT  ali  36  267.PEMVSARHILLKLDPSASDEDVK---------AAEGKAQSIEKKLARGG-DFAALAKKYSEGPTASRGGDLGWFGRGAMVPEFEKAAFGLKEGAVSKPVRTQFGLHIIKLE. 367
212 3.000e-42UniRef50_I0HPN0 Peptidylprolyl isomerase n=281 Tax=Bacteria TaxID=2 RepID=I0HPN0_RUBGI  ali  36  264QAEERRASHILVKVDPSAPADE---------KKAAKARAEQLLADVRRSPNSFAEVARKNSQDPSAARGGDLDFFGRGMMAKPFEDAVYAMKPGEISNVIETDFGYHIITLT. 367
213 3.000e-42UniRef50_A0A0A8W4M0 Peptidylprolyl isomerase n=18 Tax=Clostridiales TaxID=186802 RepID=A0A0A8W4M0_PAESO  ali  38  176..DEVRASHILISTVDPKTKKPVSDDKKKEAKKKA----EQVYEKVKSGQ-DFAKLAKEYSDDGSASNGGDLGFFSKGQMVPEFEKAAFGMDKDQVSNIVETQFGYHIIKVTD 281
214 3.000e-42UniRef50_A0A1J5HUT4 Peptidylprolyl isomerase n=1 Tax=Syntrophobacteraceae bacterium CG2_30_61_12 TaxID=1805379 RepID=A0A1J5HUT4_9DELT  ali  45  174.PAQVKASHILAKVEEQNNADQ---------KAAALDKIKKAQKRL-EGGDDFATVAKEMSDCPSSSKGGELGYFSRGQMAKPFEDAAFAMKPGETSGIVETQFGYHLIRVEE 275
215 3.000e-42UniRef50_V5WIG9 Peptidylprolyl isomerase n=1 Tax=Salinispira pacifica TaxID=1307761 RepID=V5WIG9_9SPIO  ali  44  166.PESITASHILVQLPEDAGEEE---------RQVAREKIDEVAEKIASGE-DFAALAEEYSEGPSAANGGSLGSFSRGDMVPPFEEAAFALEEGEVSDIVQTQFGYHIIKVSE 267
216 3.000e-42UniRef50_A9RW23 Peptidyl-prolyl cis-trans isomerase n=2 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A9RW23_PHYPA  ali  53  5..EKVRGSHLLVKHQGSRRPASWKDPERKTTRDDAVAKLMQFKSDIESGRATLADLATQNSDCSSAKRGGDLGWFGRGQMQEPFERATFNLNVGELSDIIDTDSGSHIILRT. 118
217 3.000e-42UniRef50_A0A1Y0N531 Peptidylprolyl isomerase n=11 Tax=Burkholderiales TaxID=80840 RepID=A0A1Y0N531_9BURK  ali  33  269..EERRASHILINAPKDMPAAD---------RAKAKERATALLAQVRKAPDSFAEVAKKNSQDGSAPRGGDLDFFGRGAMVKPFEDAAFSMKKGEISDLVESDFGFHIIKLAE 371
218 3.000e-42UniRef50_A0A060NGL7 Peptidylprolyl isomerase n=6 Tax=Burkholderiales TaxID=80840 RepID=A0A060NGL7_9BURK  ali  33  269..EERRASHILLTLEPGASPEQ---------QAQVRARAEELLAQLRQNPARFAELAQAHSQDPSAARGGDLGFFARGAMVPPFEQAVFALQRGAISDLVQSDFGFHIIQLVE 371
219 3.000e-42UniRef50_A0A0L0MXZ3 Peptide hydrolase n=35 Tax=Pezizomycotina TaxID=147538 RepID=A0A0L0MXZ3_9HYPO  ali  57  541.PEKIRAAHLLVKHRDSRRPSSWRESEITRSKDDAMDIIRAHEQKIKSGGISLGDLAPTESDCSSARKRGDLGYFGRGDMQKEFEDAAFALKPGELSAVIETASGLHLIERLE 653
220 3.000e-42UniRef50_A0A1G3BRR1 Peptidylprolyl isomerase n=7 Tax=Planctomycetes TaxID=203682 RepID=A0A1G3BRR1_9BACT  ali  47  215...EVKASHILV---------DTREMKTAEELVKAKEKINKLKVEV-DGGKDFAEVAKQNSDCPSAKNGGDLGSFKRGQMVEPFAAAAFSLKVGEVSAPVKTEFGYHIIKVTE 315
221 4.000e-42UniRef50_UPI0006D05E50 hypothetical protein n=1 Tax=Paenibacillus pinihumi TaxID=669462 RepID=UPI0006D05E50  ali  43  71.PEQVRASHILVASE---------------------KEAEDILKELKQG-ADFATLAKEKSTDPSKENGGDLNFFGRGQMVPEFEEAAFALKKGELSGIVKTMHGFHIIKLTD 161
222 4.000e-42UniRef50_A0A081C5V6 Peptidylprolyl isomerase n=4 Tax=unclassified Bacteria TaxID=2323 RepID=A0A081C5V6_9BACT  ali  36  270..KEVHARHILFRVEQTAEEEAVN---------QVKAKAEEVLQQLK-GGADFAEMAKTHSEDASGKEGGDLGFFSKGMMIPEFEQAAFALSPGEISELVRTQFGFHIIKVEE 371
223 4.000e-42UniRef50_A0A0D6EG74 Peptidyl-prolyl cis-trans isomerase n=27 Tax=Dikarya TaxID=451864 RepID=A0A0D6EG74_SPOSA  ali  58  85...KVRASHLLIKHSGSRRPSSWKEANITRSKEEAVDILKGHQKTLREAPEAFAKLASTESDCSSARDGGDLGWFGRNQMQKPFEEASFATEVGQLSDIISTDSGVHIILRT. 196
224 4.000e-42UniRef50_A0A1F9X4N7 Peptidylprolyl isomerase n=5 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9X4N7_9BACT  ali  40  201..EQVRARHILVTLDKNAPMAD---------KTAALNKIKKAQKELK-GGADFGELAKKYSDDPSKTRGGDLGFFSKGEMVPEFEKTAFSLNVGQVSEPVLTDFGYHIIKVEE 302
225 4.000e-42UniRef50_A0A1D9BBT1 Peptidylprolyl isomerase n=7 Tax=Neisseriales TaxID=206351 RepID=A0A1D9BBT1_9NEIS  ali  32  249..EERRAAHILITVAKDASAEQ---------RAAAKTKAEGILKEVRANPARFAELAKQYSQDPSAQQGGELGWFGRGAMVKPFDDTVFKLDKGQISDVVQTDFGYHVIKLED 351
226 4.000e-42UniRef50_A0A218NML1 PpiC-type peptidyl-prolyl cis-trans isomerase n=1 Tax=Candidatus Micrarchaeota archaeon Mia14 TaxID=1920749 RepID=A0A218NML1_9ARC  ali  47  2.PDKIRCSHILV---------------------DKESTAKEVLEKLK-GGEDFSKLASEYSLDGSRRRGGDLGYFGRGMMVKEFENAAFNLKKGEVSGIIKTQFGYHIIKRTD 91
227 4.000e-42UniRef50_U7UWG4 Peptidylprolyl isomerase n=17 Tax=Peptoniphilaceae TaxID=1570339 RepID=U7UWG4_9FIRM  ali  45  116....VEASHILV---------------------EDESVAKEIKEKLNNG-ADFKELAKEYSNCPSKENGGNLGVFTKGQMVKEFEDAAFNMGVGEISDPVKTQFGYHIIKVT. 201
228 4.000e-42UniRef50_W4LW78 Peptidylprolyl isomerase n=2 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4LW78_9BACT  ali  43  146..ETVTASHILVKTEP-----------------EAKALLEEL-----KGGKDFAELAKEKSTGPSGPQGGSLGSFGRGRMVPAFEKAAFSLKAGEVSEPVKTRFGWHVIKVTE 234
229 4.000e-42UniRef50_A0A0G2HXD2 Peptidyl-prolyl cis-trans isomerase n=3 Tax=Eukaryota TaxID=2759 RepID=A0A0G2HXD2_9EURO  ali  56  20...KIRASHLLIKHRGSRRPSSWRESEITRSKEEALEILRGHEQRIRSGETTLGDIAMSESDCSSARKKGDLGFFGRGEMQAEFEEAAFALKPGQVSGIVETASGVHLIERV. 128
230 4.000e-42UniRef50_A0A100IQ79 Peptidyl-prolyl cis/trans isomerase n=1 Tax=Aspergillus niger TaxID=5061 RepID=A0A100IQ79_ASPNG  ali  57  68...KIRCSHLLVKHRDSRRPSSWREAEITRSKEEAIEILRSHEARINAGEASLGDIAVSESDCSSARKRGDLGFFGRNEMQKEFEDAAFALQPGQVSGIVETASGVHLIER.. 175
231 5.000e-42UniRef50_B8DJ82 Peptidylprolyl isomerase n=6 Tax=Desulfovibrio TaxID=872 RepID=B8DJ82_DESVM  ali  39  265.PERVHARHILFMAQEGASKDE---------DAAARAKAEDVIAQLKKG-KDFASLAAKLSDDGSGAQGGDLGWFTKGQMVPPFEEAAFALKPGEISAPVRSAFGWHVIKME. 366
232 5.000e-42UniRef50_A0A1L0DCZ2 Peptidyl-prolyl cis-trans isomerase n=6 Tax=Clavispora/Candida clade TaxID=1540022 RepID=A0A1L0DCZ2_9ASCO  ali  50  64...KVRAAHLLVKNETSRRPKSWKLPDITISRDEAIAKIKGFQKQILNGEVKLSDLARTESDCSSHTNGGDLGFFGKGQMQPAFEQAAFGLNVGEYSDIIETDSGIHIVQRT. 173
233 5.000e-42UniRef50_A0A011QCV0 Peptidylprolyl isomerase n=24 Tax=Betaproteobacteria TaxID=28216 RepID=A0A011QCV0_9PROT  ali  38  266..EERRASHILILVDANQD------------EEKAKAKADGIRRELQEAPGKFAELAKQYSQDPSAEKGGDLGFFGRGMMVKPFEESVFKLQEGEISGVVRSEFGFHIIKLT. 364
234 5.000e-42UniRef50_A0A0P8Z9I4 Foldase protein PrsA n=6 Tax=Caloranaerobacter TaxID=171003 RepID=A0A0P8Z9I4_9CLOT  ali  43  175...RVRARHILVKTED---------------------EAKEILKQLKNG-KDFAELAKEKSIGPSAANGGDLGYFSKGQMVPEFEKAAFSLEPGQISDIVKTQYGYHIIKVED 262
235 5.000e-42UniRef50_A0A2H5W7D7 Peptidylprolyl isomerase n=1 Tax=bacterium HR11 TaxID=2035406 RepID=A0A2H5W7D7_9BACT  ali  40  275EPERVHARHVLVSTQ-------------KRSEDEARQRAETVRARLKAGE-DFAKVAREYSDDPTREKGGDLGWFERGRMVPEFEQAAFSLAVGQVSEPIRTAYGFHIIQVLE 374
236 6.000e-42UniRef50_A0A1M6MFN1 Peptidylprolyl isomerase n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1M6MFN1_9CLOT  ali  46  114..ESVRASHILIA-------------------EEDEALGKEIIERINKGEA-FEDLAKEYSNCPSSEKGGDLGQFTRGQMVPEFDQAVFAMKVGDVSGLVKTQFGHHIIKVTD 204
237 6.000e-42UniRef50_A0A1A7MRE1 P-loop containing nucleoside triphosphate hydrolase protein n=2 Tax=Aureobasidium TaxID=5579 RepID=A0A1A7MRE1_AURPU  ali  54  64QEGKIRASHLLVKHRDSRRPSSWREAQITRSKDEAMTIILGHEARIRSGATSLGDLATTESDCSSSRKRGDLGFFGKGDMQKEFEDAAFALKPGEVSHVVETASGLHLIER.. 174
238 7.000e-42UniRef50_A0A068RFQ5 Peptidyl-prolyl cis-trans isomerase n=21 Tax=Opisthokonta TaxID=33154 RepID=A0A068RFQ5_9FUNG  ali  71  38..ERVRASHLLVKHKDSRRPSSWREENITRSXXXXXXXXXXXXXXXXXXXXXLSALATNFSDCSSAKRGGDLGYFERGQMQKPFEEAAFALQVGELSKPVWTDSGVHLILRT. 147
239 7.000e-42UniRef50_A0A140L7P2 Peptidylprolyl isomerase n=1 Tax=Thermotalea metallivorans TaxID=520762 RepID=A0A140L7P2_9CLOT  ali  39  189...QVRASHILLKTIGDDGK-----PMPEDQVKKAEEQAKELLKRVKNGE-DFAKLAIEFSQDPSAKQGGDLGYFPKGMMVQEFEKVAFELQPGEISDLVKTDYGYHIIKVVD 293
240 7.000e-42UniRef50_A0A1F2Q977 Peptidylprolyl isomerase n=2 Tax=Bacteria TaxID=2 RepID=A0A1F2Q977_9BACT  ali  34  268QPEELNARHILVRPKTQDDAGW----------QEALSRAREVHAKVTASGADFAAVARQYSEDPSKDSGGDLGWFPRGRMVKEFEDAAFKLSPGEISEPIKSQFGYHILKME. 370
241 7.000e-42UniRef50_J5GW41 Peptidylprolyl isomerase n=3 Tax=Peptostreptococcaceae TaxID=186804 RepID=J5GW41_9FIRM  ali  38  188..EQIRASHILIKTVNDDLSDMPKDKV-----EAAKKQIDEIYEKAIAGE-DFAELAKQYGQDGTKDTGGDLGYFTRDRMVKEFSDAAFALNIGEISKPVKTQWGYHIIKLVD 292
242 7.000e-42UniRef50_A0A2N6E4M0 Peptidylprolyl isomerase n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6E4M0_9DELT  ali  41  317..EQVRASHILIKVDPDAEPSVL---------EERRSVAEQVLADAKSGQ-DFAELARTWSDDASAARGGDLDFFGRGSMVPEFERAAFNMDPGEISDLVKTNFGYHIIKV.. 416
243 8.000e-42UniRef50_UPI000893E492 hypothetical protein n=1 Tax=Burkholderia sp. JS23 TaxID=1770053 RepID=UPI000893E492  ali  35  270..EQVRARHILITVAKDAPAAE---------QEKAKQKAQAVLDELHAHPDRFAELAKQNSQDPSAAKGGDLGFFGHGMMVKDFEDEAFKLQPGQTSGLVHSDFGYHIIQVTE 372
244 8.000e-42UniRef50_G9X012 Peptidylprolyl isomerase n=8 Tax=Peptostreptococcaceae TaxID=186804 RepID=G9X012_9FIRM  ali  43  115..ETVEASHILVG---------------------DLKKAEELYEKIING-ADFAEIAKENSTCPSSRQGGDLGFFGKGQMVKEFEDVAFSLNIGDVSKPVKTQFGYHIIKLTD 203
245 8.000e-42UniRef50_A0A1G6P836 Peptidylprolyl isomerase n=5 Tax=Bacteria TaxID=2 RepID=A0A1G6P836_9BACT  ali  41  112KPESIKASHILLKTE---------------------EKANEIKEKLDNGE-SFEELAREYSTCPSKEQGGDLGFFTKGQMVPEFENVAFNMEEGNISGPVKTQFGYHVIKLTD 202
246 8.000e-42UniRef50_W8TCL6 Peptidylprolyl isomerase n=2 Tax=Peptoclostridium acidaminophilum TaxID=1731 RepID=W8TCL6_PEPAC  ali  38  180...QVRASHILIKTVDDS-----MNPLSEDKIKEQEKLANEVLQKAKAGD-DFAELAKTYSQDGSAKNGGDLNFFGKGVMVPEFEEAAFKLEKGQISELVKSQFGYHIIKVTD 284
247 9.000e-42UniRef50_UPI000CFC8B07 peptidylprolyl isomerase n=2 Tax=Vallitalea TaxID=1348611 RepID=UPI000CFC8B07  ali  43  114.PEEVRASHILI-----------------ADEEEARKVADDVKA-----GKDFAEAAKEHSICPSKERGGDLGFFSRGKMVPAFEEAAFALEVGEISHLVKSDFGYHIIKVE. 202
248 1.000e-41UniRef50_A0A1V4XF84 Peptidylprolyl isomerase n=8 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V4XF84_9DELT  ali  40  211.PESIRVRHILVGKKPEDDD---------KARAEKRDKAENIRKQIL-GGADFAEVARNQSDCPSKQAGGDLGTFVRGQMVKPFEDAAFSQKKDEIGPVVETDFGYHIIQVLE 312
249 1.000e-41UniRef50_A0A2G6FVB7 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2G6FVB7_9DELT  ali  44  265.PETVRARHILVQLAPDASADA---------QKKAESKIKDLRNKVLKGEP-FEEVASKYSEGPSASRGGDLGVFKRGDMVKPFSDAAFALKKGEVSQPVKTRFGWHIIKVEE 366
250 1.000e-41UniRef50_A0A1L8I6C5 Foldase protein PrsA n=1 Tax=Bacillaceae bacterium G1 TaxID=1836462 RepID=A0A1L8I6C5_9BACI  ali  44  152EPEQVKARHILV---------------------ETEEQAHEILAKLKQGE-SFEDLAKQYSTDASKDNGGDLGYFGRGEMVAEFEEVAFSLKPGETSKPVKTQFGYHIIKVED 243
251 1.000e-41UniRef50_A0A2G6MH71 Peptidylprolyl isomerase n=1 Tax=Desulfobulbus propionicus TaxID=894 RepID=A0A2G6MH71_9DELT  ali  39  264.PEKRHARHILLKLGQNNTAEQ---------KKELEEKARIILAKAQKGE-DFAALAQQYSEGPSKSSGGDLGFFTKGQMVPAFDKAVFSIQPGEVTGPVLTSFGYHIIKLEE 365
252 1.000e-41UniRef50_A0A2D5QQR0 Peptidylprolyl isomerase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2D5QQR0_9DELT  ali  33  222..EQVRARHILLKTAKDAPPAKI---------AEVKAKADQLAAKAKKNNTDFAELAKANSEGPTAPKGGDLSFFARNRMVKEFDEKAFSMKVGEVSDPVKTRFGWHIIRVVE 325
253 1.000e-41UniRef50_UPI00041C1373 hypothetical protein n=1 Tax=Chitinimonas koreensis TaxID=356302 RepID=UPI00041C1373  ali  36  247.PEERQVRHILIQADKSATAEQ---------KAAARKKAEGILAELKQNPAKFAELAKQHSQDPSAAQGGDLGFFGRGAMVKPFEDVAFKLAKGELSDVVETDFGYHVLQLE. 349
254 1.000e-41UniRef50_UPI000B800486 hypothetical protein n=1 Tax=Candidatus Entotheonella palauensis TaxID=93172 RepID=UPI000B800486  ali  43  72..ETVTASHILVKTEP-----------------EAKALLEEL-----KGGKDFAELAKEKSTGPSGPQGGSLGSFGRGRMVPAFEKAAFSLKAGEVSEPVKTRFGWHVIKVTE 160
255 1.000e-41UniRef50_A0A1E7JE24 Peptidylprolyl isomerase n=4 Tax=unclassified Desulfobacterales TaxID=1403365 RepID=A0A1E7JE24_9DELT  ali  40  262KPKEVRASHILFKVKQGAKPEAI---------DKARKKALDVLEQARSG-ADFAGLARKYSDDPSRDKGGDLGFFAGDRMVKPFSDAAFAMKSGEISEPVRTPFGWHIIRVE. 364
256 1.000e-41UniRef50_A0A1T2XPD2 Foldase protein PrsA n=1 Tax=Paenibacillus selenitireducens TaxID=1324314 RepID=A0A1T2XPD2_9BACL  ali  47  252.PEQVRASHILVK-----------------TKAEAEAIIKEL-----KGGADFAALAKEKSTDGSKENGGDLNFFSKGQMVPSFEEAAFKLKVGELSDPIQSDYGYHIIKVTD 342
257 1.000e-41UniRef50_A0A2M7AK90 Peptidylprolyl isomerase n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_40_9 TaxID=1973916 RepID=A0A2M7AK90_9BACT  ali  36  187EYEQVRVRHILFQLPALGNTEEEKKKNQKRQEENLKKKGEEVLLELKAG-ADFAELAKRDSDCPSKDKGGDLGFFGRGRMDPAFEKAAFSLKIGEVSGLVKTKFGYHIIKSEE 299
258 1.000e-41UniRef50_A0A2H0PYG7 Peptidylprolyl isomerase (Fragment) n=2 Tax=Candidatus Berkelbacteria TaxID=1618330 RepID=A0A2H0PYG7_9BACT  ali  36  222.PVQIRARHILIRVDKDAPADKV---------AEAKARIDKVLAEIR-GGLDFAEAAKKYSEDGSAQNGGDLDFFSRGQMDADFEKAAFATTVGQISDPIRTEFGWHIIKVEE 324
259 1.000e-41UniRef50_R1CH19 Peptidylprolyl isomerase n=5 Tax=Clostridiaceae TaxID=31979 RepID=R1CH19_9CLOT  ali  42  113.PETVKASHILVKDE---------------------NKVDEILNELNNG-LSFEEAAEKYSSCPSKTNGGDLGYFSRGKMVPEFENAAFNMEKGEVKGPVKTQFGYHIIKLTD 202
260 1.000e-41UniRef50_A0A2V8HQE6 Signal peptide peptidase SppA n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8HQE6_9BACT  ali  38  416.PEQVRASHILLKTEGKDDAAV-------------KKQADDLLKRAK-GGEDFAALATKYSEDESAKKGGDLDYFGHGQMQPEFDQAAFAMQPGQISDLVKTQYGYHIIKLVD 514
261 1.000e-41UniRef50_A0A1E5X5N1 Peptidylprolyl isomerase n=5 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A1E5X5N1_9PSED  ali  41  168KPEQVWARHLLLKASDPADPEA---------DEASRQELLALREQIEAG-ADFSEVAEQHSQDSTAAEGGDLGYFSRGTMVPAFENAAFALKPGEVSQPVRTVFGWHLIKLE. 269
262 1.000e-41UniRef50_A0A2H3EH06 Peptidyl-prolyl cis-trans isomerase n=7 Tax=leotiomyceta TaxID=716546 RepID=A0A2H3EH06_9HELO  ali  56  132.PGKIRAGHLLVKHKDSRRPSSWREAEIKRTKDDAMSIILGHEQRIRSGQSSLGDLATSESDCSSARKRGDLGFFGRGDMQKEFEEAAFQLKPGEMSHVVETASGLHLIERLE 243
263 2.000e-41UniRef50_A0A1F9BZN6 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RBG_16_49_23 TaxID=1797840 RepID=A0A1F9BZN6_9DELT  ali  40  138.PEQVKARHILIKVP---------FGTTGEARKKGREKAEAMIEWLKRGE-SFERLAEKNSEDPSAKKGGDLGYFARGRMPKPFEEAAFSLKPGQISGIVETDFGYHVISVED 240
264 2.000e-41UniRef50_A0A1G1DZU0 Peptidylprolyl isomerase n=1 Tax=Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22 TaxID=1801687 RepID=A0A1G1DZU0_9BACT  ali  41  268.PKRLKARHILLKLPSELKPEE---------EAKAKKLAQDLIERIKKGE-DFAELAKKHSQDPSASQGGDLGYFQSGEMIAPFEEAAFSLKRGEISPPVRTPFGYHIIKLED 370
265 2.000e-41UniRef50_A0A1F7WJ50 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Woesearchaeota archaeon RBG_13_36_6 TaxID=1802470 RepID=A0A1F7WJ50_9ARCH :_  ali  47  138.PEMVRASHILVNSS---------------------EEAENLLSMLKNG-SDFAELAATYSLDSTAKNGGDLGYFAKGVMVPEFEDAVFSLKVGEISDVVKTDYGYHIIKLTD 227
266 2.000e-41UniRef50_Q39XG7 Peptidylprolyl isomerase n=9 Tax=Geobacteraceae TaxID=213422 RepID=Q39XG7_GEOMG  ali  43  192..EAVRASHILVSADQKASPXXXXXXXXXXXX---------LLKQLK-GGADFAELAKKESSCPSSAQGGDLGFFGKGQMVPEFEKTAFNLKPGEVSDVVETQFGYHIIKLAE 292
267 2.000e-41UniRef50_A0A1T4JLY4 Foldase protein PrsA n=1 Tax=Selenihalanaerobacter shriftii TaxID=142842 RepID=A0A1T4JLY4_9FIRM  ali  40  189QPAQIKASHILVKT---------------------KEKAEKVKSELEAG-ANFAKLAKKYSTGPSGKNGGSLGYFGKGQMVPAFEKAAFNLEVGKISNPVKTKFGYHIIKVTD 279
268 2.000e-41UniRef50_A0A2V7UVH2 Uncharacterized protein n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7UVH2_9BACT  ali  36  202..ERVRASHILLRVPEGAGPDV---------RQAQKAKAESALARVRKGE-DFAAVAREVSQDPSAPRGGDLGLFGKGQMVPAFEQAAFALPPGQVSDLVESPFGFHIIKVQE 303
269 2.000e-41UniRef50_A0A1Y3PT72 Foldase protein PrsA n=1 Tax=Bacillus thermozeamaize TaxID=230954 RepID=A0A1Y3PT72_9BACI  ali  41  154EPEQVKARHILV---------------------ETEAQAKEIRAKLDQGE-SFEELAKQYSTDASKANGGDLGYFKRGDMVPEFEEVAFSLKPGETSQPVKSQFGYHIIRVED 245
270 2.000e-41UniRef50_A0A1X9M904 Foldase protein PrsA n=1 Tax=Bacillus krulwichiae TaxID=199441 RepID=A0A1X9M904_9BACI  ali  46  157..EQIRASHILV---------------------EDEKTALEVLDKLEAGE-DFADLAQEYSTDGSAARGGDLDFFGKGQMVEPFEKAAFALEIGEISDPVESDFGYHIIQLTD 245
271 2.000e-41UniRef50_A0A1D2JMR7 Uncharacterized protein n=2 Tax=Paracoccidioides brasiliensis TaxID=121759 RepID=A0A1D2JMR7_PARBR  ali  56  158...KIRASHLLIKHQGSRRPSSWREAEITRSKEEALEILRRHEESIRSGEKTLGDIAMSESDCSSARKRGDLGFFGRGEMQAEFEEAAFALEPGQLSGIVETASGVHLIER.. 265
272 2.000e-41UniRef50_A0A1V5HE02 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium ADurb.BinA179 TaxID=1852872 RepID=A0A1V5HE02_9DELT  ali  41  143.PERVKARHILV---------------------EKQDRARELLEQLRKG-ADFKELAKKNSTCPSAEKGGDLGWFGRGKMDPEFEKAAFAMKKGETSDVVKSSFGYHIIRLDD 232
273 2.000e-41UniRef50_A0A2W0C801 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2W0C801_9BACT  ali  35  155QFEQIHARHILVRVKGSVAP--VKAGEKDLTEDEALARVEQLRKQLLSG-ADFAALAAKESDDASAARGGELDVFGHGQMVPEFDRAVFALKVGEISEPVRTPFGYHLIRV.. 263
274 2.000e-41UniRef50_A0A0K9IFH9 Peptidylprolyl isomerase n=1 Tax=Desulfocarbo indianensis TaxID=1348163 RepID=A0A0K9IFH9_9DELT  ali  38  263KPERVHARHILYALPEKPTAAQ---------EEAAQKLAEKTLELAKQPGQDFAALAKEHSQGPTATNGGDLGWFGRGQMVKPFEDLAFTLKPGEM-GVVQTRFGWHVIKVED 365
275 2.000e-41UniRef50_A0A1G1DNT4 Peptidylprolyl isomerase n=2 Tax=unclassified Nitrospinae TaxID=1449243 RepID=A0A1G1DNT4_9BACT  ali  42  265.PKRVKAGHILIAVSPDADE---------KVEVEGRAKAVKVLQELK-GGGDFAELAKRYSDDPNKGKGGDLGFFSKGQMVKQFEDAAFALKEGELSEPVRTPFGYHIIKVE. 365
276 2.000e-41UniRef50_C5E0C4 Peptidyl-prolyl cis-trans isomerase n=4 Tax=Saccharomycetales TaxID=4892 RepID=C5E0C4_ZYGRC  ali  50  52.PVRVRALHILAKHSESRRPASHRSDHITLPKEQAIQELEQLQNRIESGE-SFESLAKERSDCSSFKRGGDLGWFGKGEMQPTFEKTAFHLNVGQVSSIVESDSGVHLIKRV. 161
277 2.000e-41UniRef50_D3PD53 Peptidylprolyl isomerase n=1 Tax=Deferribacter desulfuricans (strain DSM 14783 / JCM 11476 / NBRC 101012 / SSM1) TaxID=639282 RepID=D  ali  40  262EKEKVAAKHILIRVKDWNNKKEVAEAKKK---------IENILQKIKKG-AKFEDLAKKYSDDPTAKNGGDLGYFTKGQMIKEFEDVVFKLKPGDISDIVKTKFGYHIIKV.. 362
278 2.000e-41UniRef50_A0A1G1A2X7 Peptidylprolyl isomerase n=1 Tax=Lentisphaerae bacterium RIFOXYC12_FULL_60_16 TaxID=1798582 RepID=A0A1G1A2X7_9BACT  ali  37  183.PENVQARHILISFEPTDDDA---------TKTIKRNQLEDIRKQILEG-ADFAEMARQHSKCPSASMGGDLGMFRRGQMVKPFEDAAFSQKVNEVGPVIETTFGYHLIQVLE 284
279 2.000e-41UniRef50_A0A1W9GX57 Peptidylprolyl isomerase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1W9GX57_9PROT  ali  31  261QPEERKASHILISVTADAPDDE---------RHAAIAKAEKILEQVRQDPDRFAEIAKEQSDDPSAIQGGDLGYFGRGVMVKSFEDKIFSMQPDEISDLVETDFGFHVIKLTD 365
280 2.000e-41UniRef50_A0A1J5U0G3 Peptidyl-prolyl cis-trans isomerase D n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5U0G3_9ZZZZ  ali  39  265..EQRRASHILIGFGVNATPEQ---------KQQAKAKAEEILAAIKKDPSKFESLAIKNSQDPSAAKGGDLGSFGRGAMVKPFEDAVFSMKVNDVSGLVQSEFGYHIIKLT. 366
281 2.000e-41UniRef50_A0A1C0ALK2 Peptidylprolyl isomerase n=3 Tax=Peptostreptococcaceae TaxID=186804 RepID=A0A1C0ALK2_9FIRM  ali  46  114...MVKASHILV---------------------EDLEEAKKIKSELDDG-ADFADLAQEYSSCPSKDKGGDLGFFGKGAMVKEFEDAAFAMEVGEISEPVKTQFGYHIIKVTD 201
282 2.000e-41UniRef50_A0A2M7GEE9 Peptidylprolyl isomerase n=1 Tax=Rhodospirillales bacterium CG15_BIG_FIL_POST_REV_8_21_14_020_66_15 TaxID=1974092 RepID=A0A2M7GEE  ali  40  250QQVEVHARHILLK-----------------TEDEAKAVIKEL-----SGGADFADLAKKKSTGPSGPNGGDLGYFGKGQMVPEFEKAAFALDKGAVTKPVQTQFGWHVIKVED 341
283 2.000e-41UniRef50_A0A2V8UQ06 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8UQ06_9BACT  ali  38  45..ETVHSRHILIRMKGS--PLAQRAGKQELTEEEALAKAQELRKKILAGG-DFAALAKTESDDASGANGGDLGSFKHGQMVAEFDQAAFNLPVGQVSEPVKTRYGYHLIKVE. 152
284 2.000e-41UniRef50_UPI00048424F2 hypothetical protein n=1 Tax=delta proteobacterium PSCGC 5342 TaxID=1286375 RepID=UPI00048424F2  ali  39  263.PKTVEARHILIKVGPDAAPEEV---------AQAKEKIEDILKKAK-GGQDFAELAKQYSEGPSKDKGGHLGSFRRDAMVKPFADKAFGMQAGEISDPVQTRFGWHIIKVE. 363
285 2.000e-41UniRef50_A0A1U9JK10 Peptidylprolyl isomerase n=3 Tax=Chromobacteriaceae TaxID=1499392 RepID=A0A1U9JK10_9NEIS  ali  37  246.PEQRRASHILLTVAKDADAA---------TRSKTREQAEALLKDLKANPGRFAELARSRSQDPSASQGGDLGFFGRGMMVKPFEDTAFKLAKGELSGVVETDFGYHILRLDD 349
286 2.000e-41UniRef50_V6F2P1 Peptidylprolyl isomerase n=2 Tax=Magnetospirillum gryphiswaldense TaxID=55518 RepID=V6F2P1_9PROT  ali  43  107.PEQIRASHILLMYEGS------MHSSAERSKAEALAQINAIKADIAAG-ADFAKQAIDHSDCPSGREGGDLGDFGRGQMVGEFETAAFALDVGQISDVVETPFGYHLIQRT. 211
287 3.000e-41UniRef50_A0A1W9VQX6 Peptidylprolyl isomerase (Fragment) n=1 Tax=Candidatus Atribacteria bacterium 4572_76 TaxID=1972458 RepID=A0A1W9VQX6_9BACT  ali  41  183EPEQVHARHILLETEEEANNLLLLLKEGLT---------------------DFAELAKEKSIGPSAPSGGDLGFFARGQMVKEFEDAAFSLEPGEISDVVQTQFGYHIIKCEE 274
288 3.000e-41UniRef50_A0A1F9M9K7 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11 TaxID=1797896 RepID=A0A1F9M9K7_9DELT  ali  39  293EPEMVRARHILFKTEEGADNA------------AVLAKAQEVLSKLRAG-ADFADMAKLHSDDASARDGGDLGFFGRDKMVKVFEEAAFALQPGALSEPVQSDFGYHLIKVEE 393
289 3.000e-41UniRef50_A0A2N2QND2 Peptidylprolyl isomerase n=2 Tax=Betaproteobacteria TaxID=28216 RepID=A0A2N2QND2_9PROT  ali  39  263QPEERRASHILVASE-------------KLGADKARLKAEELLAEIRKNPGSFAELAGKNSDDPSASKGGDLGYFARGMMVKPFEDSAFTLAEGEVSGVIESDFGFHIIKV.. 361
290 3.000e-41UniRef50_A0A0S8ADI8 Peptidylprolyl isomerase (Fragment) n=1 Tax=Desulfobacterales bacterium SG8_35 TaxID=1703400 RepID=A0A0S8ADI8_9DELT  ali  38  108.PEQRSARHILIKTSEADSEDILS---------EKQQRAAQVLELARSGE-DFAELAKQYSEGPTGPRGGDLGSFTRGRMVKPFEDAAFSLNEGEISDIVESQFGFHIIKLE. 208
291 3.000e-41UniRef50_A0A2V8UE05 Peptidylprolyl isomerase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8UE05_9BACT  ali  37  145..EEVKARHILIRMQGSRVPLKPNQKDI--TDAEALAKANEVRAKIVAG-TDFAAVAKAESDDGTGANGGELGSFTRGRMVPEFEKAAFSLPIGELSEPVKSPFGYHLIQVE. 252
292 3.000e-41UniRef50_A0A2E6GJM8 Peptidylprolyl isomerase n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E6GJM8_9PROT  ali  40  157QPEEVRARHILVKT---------------------KAEAEAIIAQLKKG-ADFIKLAKEKSTGPSGKNGGDLGFFGPGQMVPPFSKAAFALDKGQITEPVKTQFGFHVIKVED 250
293 3.000e-41UniRef50_A0A0F2N6R8 Peptidylprolyl isomerase n=4 Tax=root TaxID=1 RepID=A0A0F2N6R8_9DELT  ali  37  264EPEQRHARHILFQAEEGDSAQVH---------EEKAKKAEEVLQLAGKGE-DFTSLASEYSEGPSKSTGGDLGFFARGRMIPEFEDTVFSMQPGEISEVVKTSFGYHIIKLVE 366
294 3.000e-41UniRef50_A0A1V4S4P4 Peptidylprolyl isomerase n=1 Tax=Desulfobacteraceae bacterium 4484_190.3 TaxID=1956169 RepID=A0A1V4S4P4_9DELT  ali  42  180.PEEVRASHILIKVDEKAD-------------EKTKAKA----------GEDFAKLAKEYSQGPSGVKGGDLGFFRRGQMVPPFEKAAFSLKKGKVSDIVVTRFGYHLIKVTD 268
295 3.000e-41UniRef50_A0A2V8A5T7 Peptidylprolyl isomerase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8A5T7_9BACT  ali  37  8QDESVHASHILIAASENAAPAQ---------KAEARSKAQSLLRKVR-GGADFATVARAESQDPTAQNGGDLGFFAKGRMTPAFEAAAFKLKAGEISGVVETPFGFHIIRVHE 111
296 3.000e-41UniRef50_A0A0K1E895 Peptidyl-prolyl cis-trans isomerase n=5 Tax=Sorangiineae TaxID=80812 RepID=A0A0K1E895_CHOCO  ali  38  70QPQKIGARHVLIMHKQSKSRAD----EMTRSRDEAKKLAQEVLLQVR-GGAKFEELVAKYSDEPGAERGGDLGVFDRNTMVKSFSDAAFSLKVGEISEVVESPFGFHIIQRTE 178
297 4.000e-41UniRef50_UPI0004136510 hypothetical protein n=1 Tax=Paenibacillus taiwanensis TaxID=401638 RepID=UPI0004136510  ali  44  216.PEQVRASHILVKT---------------------KEEADAIVKQLKEG-ADFATLAKEKSSDGSKDKGGDLGFFGAGAMVPEFEKAAFALKTGEVSEPVKSQFGYHVIKTTD 305
298 4.000e-41UniRef50_G2J8S7 Peptidylprolyl isomerase n=2 Tax=Candidatus Glomeribacter gigasporarum TaxID=132144 RepID=G2J8S7_9BURK  ali  33  271..DQIRARHILIALP---------SKPASEARNKALAEARAMLAQVRAQPERFAEMARAHSQDPSAKQGGDLGYFSAGMMVKPFEEAAFKLKKDEISDLVESEFGYHIIQVTD 373
299 4.000e-41UniRef50_UPI0009DCBD8E peptidylprolyl isomerase n=1 Tax=Thiomicrospira pelophila TaxID=934 RepID=UPI0009DCBD8E  ali  36  277QPEMRRARHILIRAED---------------EEVALAEIKDIQAKLDSGE-DFSELAKEHSQDPSAMNGGDLDFFEAGMMVPEFDEVVFNMQVGDISDVVKTDFGWHLIQLTD 374
300 4.000e-41UniRef50_A0A2G6LTK0 Uncharacterized protein n=1 Tax=Candidatus Fermentibacteria bacterium TaxID=2044591 RepID=A0A2G6LTK0_9BACT  ali  45  95.PDTVRARHILVCYDGCA-----VNETFNRTQDEALELITSLESRIQNEEIPFVQAAIDYSDCPSGADGGMLGEFGRGEMVPPFEEAAFALPVGGMSGVVETQFGYHLILRE. 200
301 4.000e-41UniRef50_A0A2C5ZFY8 Uncharacterized protein n=1 Tax=Ophiocordyceps camponoti-rufipedis TaxID=2004952 RepID=A0A2C5ZFY8_9HYPO  ali  60  62...KIRAAHLLVKHSGSRRPSSWRESQITRSKDEAMAIIKDHEQKIKSGSISLGELALNESDCSSARKRGDLGFFGRGDMQKEFEDAAFILNPGNMSGVVETASGLHLIERT. 170
302 4.000e-41UniRef50_A0A2N9M2U7 Peptidylprolyl isomerase n=1 Tax=Candidatus Sulfopaludibacter sp. SbA3 TaxID=2043164 RepID=A0A2N9M2U7_9BACT  ali  34  159EFEEAHARHILVRIQGAPMPVRPGQKELSDT--DAFAKAQDLEKQLQSG-ADFAALATKESDDGSGAKGGDLGTFHHGQMVPSFDQAAFALEPGKISEPVKSQFGYHIIKLE. 268
303 4.000e-41UniRef50_A0A2V2G894 Peptidylprolyl isomerase n=1 Tax=Desulfovibrionaceae bacterium TaxID=2049043 RepID=A0A2V2G894_9DELT  ali  38  263.PERVRAAHILILVPENASADEVK---------KAEDRIKAIEERIRSGE-DFAAVARETSQDPSAAKGGDLDWFERGQMVPEFADVAFALTPGELSGPVRSPFGFHLIKVED 365
304 4.000e-41UniRef50_A0A1Q6DMU5 Peptidylprolyl isomerase n=1 Tax=Desulfobulbaceae bacterium DB1 TaxID=1920419 RepID=A0A1Q6DMU5_9DELT  ali  47  264.PEKRRASHILLQTTEENRAAR-------------RQEIDAILARVKSGE-DFASLARQFSEDGSASRGGDLDFFTRGQMVKPFEDAVFALAKGAISDVVTTQFGYHIIQLTD 361
305 5.000e-41UniRef50_A0A2M6X7X5 Peptidylprolyl isomerase n=1 Tax=Bdellovibrionales bacterium CG10_big_fil_rev_8_21_14_0_10_45_34 TaxID=1973927 RepID=A0A2M6X7X5_9  ali  34  237..EQIKARHILIKFDANNS----------QSKDVARKQIDEIHPRAV--GENFEALAKEFSQDGSKEQGGDLGYFGQGRMVPEFEKVAFSLKPGQVSEPVETQFGFHIIKVED 336
306 5.000e-41UniRef50_E4TG10 Peptidylprolyl isomerase n=1 Tax=Calditerrivibrio nitroreducens (strain DSM 19672 / NBRC 101217 / Yu37-1) TaxID=768670 RepID=E4TG10_C  ali  39  167.PEMVKASHILIKVDDKQND------------KDAKSKIDSIYKELKSG-KSFEELAKKYSQDGSAANGGDLGFFPRGAMVKEFENVAFSTPAGKFSEPFKTQYGYHIVKVTE 265
307 5.000e-41UniRef50_A0A1W1XFG6 Peptidylprolyl isomerase n=4 Tax=Syntrophobacteraceae TaxID=213465 RepID=A0A1W1XFG6_9DELT  ali  36  265..KQVRARHILFRLDENAPEDEVK---------KVESQARDVLAKARKGE-DFARLAEQYSQGPSASQGGDLGYFKKDQMVPAFTDAAFALKPGEISDLVRTRFGYHIIKSED 365
308 5.000e-41UniRef50_A0A1M6C276 Peptidylprolyl isomerase n=7 Tax=Desulfuromonadaceae TaxID=213421 RepID=A0A1M6C276_MALRU  ali  38  272..EEVKAAHILLRVSEDATDE---------IRGKRKELAADLLKQLQEG-ADFAELAKAHSDDGTAENGGDLGTFGRGIMVKAFEAAAFALKPGELSDIVETPFGYHIIKVEE 373
309 6.000e-41UniRef50_A0A272ETX4 Peptidylprolyl isomerase n=3 Tax=Rhodocyclales TaxID=206389 RepID=A0A272ETX4_9RHOO  ali  39  278.PEKLRASHILVQSAEGDKSED---------RAAARKKAEDLLTQVKAQPGKFAELAQKSSDDPSASKGGDLGFFGRNVMAKPFEDAVFALKPQEISGIVETQFGFHIIQLTD 381
310 6.000e-41UniRef50_A0A0F2QVN4 Peptidylprolyl isomerase n=2 Tax=Desulfatitalea TaxID=1303912 RepID=A0A0F2QVN4_9DELT  ali  39  173.PEEVHAQHILIKSEADAEEKQ---------KKASRQTLVDIKKKIDAGE-DFGALAKAHSQCPSAQNNGDLGSFSKGKMVPAFETAAFALKPGQVSDIVETNFGYHLIKVLE 274
311 6.000e-41UniRef50_A0A2L2BDG7 Peptidylprolyl isomerase n=41 Tax=Proteobacteria TaxID=1224 RepID=A0A2L2BDG7_9NEIS  ali  32  247..EQRRASHILLTVAKDAK---------LEQKAKVKAEAEAILKDVRANPAKFAELAKAKSQDPSAEKGGDLGFFGHGMMVKPFDDAVFKLKPGQISDLVETEYGFHIIRL.. 347
312 7.000e-41UniRef50_A0A2V8TAE5 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8TAE5_9BACT  ali  34  150..EMVHARHILRKFPPNVTDEQ---------KKAERAKIEEALAKLKKGE-DFAQVARTYSSDNTAAKGGDLGYFPRGRMVPQFEEAAFSLKPGQISGIVESRFGYHLIRCED 250
313 7.000e-41UniRef50_A0A1H2DMY9 Peptidylprolyl isomerase n=4 Tax=Desulfobacula TaxID=28222 RepID=A0A1H2DMY9_9DELT  ali  43  187..EEVQASHILIKLDADANPAQ---------KINAKKEIEKILRQINEG-KDFATLAKALSQCPSSSEGGDLGFFKRGVMEKSFEDAAFALKPGQISGIISTSFGYHIIHVT. 286
314 7.000e-41UniRef50_A0A1V5DSK7 Peptidylprolyl isomerase n=2 Tax=Syntrophus TaxID=1671858 RepID=A0A1V5DSK7_9DELT  ali  36  215.PETVHVRHILIARAPGDNE---------KTLAEKKAKAENLRKQIMAG-ADFAELAKNNSDCPSKNNGGDLGNVPRGQMVKPFEDAVFALKKNQIGPVVQTEYGFHVVQVLD 316
315 7.000e-41UniRef50_A0A2E4E1I9 Parvulin peptidyl-prolyl isomerase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2E4E1I9_9RICK  ali  49  3...KVSASHILIMHNESRD------SRSAITKDEALKRIIEIKDQYIKGKKDFKELAVHNSDCSSGKSGGYLGEFGKGVMVKPFEDAVFDLDVGELSDPVETEFGYHIILR.. 104
316 7.000e-41UniRef50_W4L6D8 Peptidylprolyl isomerase n=5 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4L6D8_9BACT  ali  37  267QPERVQARHILLKVPSNVSDER---------EAEIRQQAEELLQQLRDG-ADFAELAMEHSEDASAEKGGDLGTFPQGQMVAPFDEAVFALEVGALSEPVRTTFGFHIIRLDD 370
317 7.000e-41UniRef50_A0A2A4RPR7 Peptidylprolyl isomerase n=1 Tax=Thiotrichales bacterium TaxID=2026796 RepID=A0A2A4RPR7_9GAMM  ali  35  268.PEERRARHILVNVVDGASEADV---------DAARAKAVDLRARVKAGE-SFEMLAKENSDDGSAIDGGDLGYFGRGMMVTAFDDVVFEMQVGDVSELVKTPFGFHIIKLEE 370
318 7.000e-41UniRef50_A5G5L2 Peptidylprolyl isomerase n=4 Tax=Geobacter TaxID=28231 RepID=A5G5L2_GEOUR  ali  50  194QEPSVKASHILCGVEASATXXXXXXXXXXXXX---------LLKKIKAGE-DFATLAKSESTCPSSKQGGDLGFFSKGQMVAPFEKAAFALKPGEVSDVVETQFGYHIIKLTE 296
319 7.000e-41UniRef50_A0A1V4MRI0 Peptidylprolyl isomerase n=1 Tax=delta proteobacterium ML8_D TaxID=1775672 RepID=A0A1V4MRI0_9DELT  ali  39  264..ERRRARHILLKIPEGADEDNI---------EEIRKKAQKIRGQIEKGD-DFAKLARENSEDGSAAKGGELGFFSKGMMVKPFEEAVFSMKEGEISSPVLTRFGWHIIQLEE 365
320 7.000e-41UniRef50_A0A1F4CSH9 Peptidylprolyl isomerase n=6 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A1F4CSH9_9PROT  ali  36  263EKEQRQASHILISVKAAASDAE---------KAKAREKAQSLLEQVRKSPASLGELAKKHSDDPSASKGGDLGTFSRGMMVKAFEEAAFRLKAGEVSGLVESEFGFHIIRVT. 366
321 9.000e-41UniRef50_A0A2C9DB28 Peptidylprolyl isomerase n=1 Tax=Hartmannibacter diazotrophicus TaxID=1482074 RepID=A0A2C9DB28_9RHIZ  ali  39  144.PEEVHARHILVKTED---------------------EAKDIIAQLDKGG-DFAELAKEHSLDGSKANGGDLGFFTRGQMVPEFENAAFELEPGKYTEPVKSQFGYHIIKVEE 234
322 9.000e-41UniRef50_A0A1E3W110 Peptidylprolyl isomerase n=2 Tax=Methyloceanibacter methanicus TaxID=1774968 RepID=A0A1E3W110_9RHIZ  ali  47  656...RIHARHILVKTE---------------------AEARDLIAKLKAG-ADFADLAKKNSIGPSAPQGGDLGYFERGQMVPAFEDAAFALKPGEISEPVKTQFGWHVIVVEE 743
323 9.000e-41UniRef50_A0A2E3UWN8 Peptidylprolyl isomerase n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2E3UWN8_9PROT  ali  37  246..EKVHARHILVGHNESKNATASAQ---KRTKQQAYTKAQALLQKVLAAKENFAAVAKKESDDPSGKNGGDLGFFLREDMVKEFSDVAFKLDVNEVSQIVETPFGYHIIK... 351
324 9.000e-41UniRef50_A0A1M6QTH6 Foldase protein PrsA n=1 Tax=Caminicella sporogenes DSM 14501 TaxID=1121266 RepID=A0A1M6QTH6_9CLOT  ali  46  183.PIKVRARHILVKDE---------------------KLAKDLLKRIKAGE-DFAQLAKEYSEDPSKEKGGDLGYFSRGVMVPEFEEAAFSLKKGEVSDLVKTRFGYHIIKTEE 273
325 9.000e-41UniRef50_A0A1G4A0H2 Peptidylprolyl isomerase n=1 Tax=Verrucomicrobia bacterium GWF2_62_7 TaxID=1802432 RepID=A0A1G4A0H2_9BACT  ali  37  183KPAQIRASHILVTVPQDASDDV---------KKAKRAAIDKARERVTTGKEDFAKVAAEVSDCPSKQKGGDLEFFGKGQMVAEFDKAAFALKPGDISDVVTTQFGYHVIKHT. 285
326 9.000e-41UniRef50_A0A2N1PIP6 Peptidylprolyl isomerase n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1PIP6_9BACT  ali  45  424.PDMVSASHILIAWNGADRA------KATRTREEALKLIKELKADIAKGEK-FEDLAKKHSDCPSGAQGGSLGPFGKGDMAKPFEESAFSLKIGQISDIVETKFGYHLIRR.. 526
327 9.000e-41UniRef50_A0A2N6FDX3 Peptidylprolyl isomerase n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6FDX3_9DELT  ali  40  271..EQVDAAHILIKVEKDAEEDV---------RAEKRKLAEKVLEQAKAGE-DFAKLARQYSDDGSAAKGGDLGYFSRGTMVPAFEQAAFALKPGKISDIVESPFGFHIIK... 369
328 1.000e-40UniRef50_A0A2K2VS62 Peptidylprolyl isomerase n=1 Tax=Desulfobacteraceae bacterium TaxID=2049433 RepID=A0A2K2VS62_9DELT  ali  36  263EPKKVHARHILFRISEKAKTAEI---------QEILDRAKKVLDLARKGD-NFAELARKYSDDSTASKGGDLGYFKSGDMVKPFADSAFSLKKGEISDLVRTRFGVHIIKVED 365
329 1.000e-40UniRef50_I1PQL2 Peptidyl-prolyl cis-trans isomerase n=24 Tax=Poaceae TaxID=4479 RepID=I1PQL2_ORYGL  ali  51  111..KKLRASHILIKHEGSRRKASWRDPEGVATRDDAADLARALREKIVAGERKFEDVATEESDCNSAKRGGDLGPFERGKMQKAFEKAVLALKVGEISDVVDTDSGVHIILRT. 224
330 1.000e-40UniRef50_A0A2H6ELL8 Peptidylprolyl isomerase n=1 Tax=bacterium BMS3Abin04 TaxID=2005712 RepID=A0A2H6ELL8_9BACT  ali  41  340....IRASHILVKGGGN--------------EEAAKKEAYDIYKQLKAG-ADFAKLAKEKSEDASAKDGGELGWFTKGQMVPEFEKAAFRGKIGEILKPVKTRFGYHIIMVT. 432
331 1.000e-40UniRef50_A0A0N0JWE9 Peptidylprolyl isomerase n=1 Tax=beta proteobacterium AAP99 TaxID=1523428 RepID=A0A0N0JWE9_9PROT  ali  37  266..EQRKASHILVKADKGTAADE---------QAKAKTRAEALLAQVKANPASFAKIARESSQDGSAPSGGDLGFFGRGAMVKPFEDAVFAMKEGEISTVVQSDFGFHIIQLT. 367
332 1.000e-40UniRef50_A0A1V5RGI6 Peptidylprolyl isomerase n=1 Tax=Chloroflexi bacterium ADurb.Bin325 TaxID=1852859 RepID=A0A1V5RGI6_9CHLR  ali  42  225..EQVHVRHILVAERTPAPTATPLPEGEPRDEAQALARIIEIQQRIGAGE-DFAELAREFSDDPSKDAGGDLGWFPRDSLVKEFEDAAFALQPGEVSGPVKTQFGYHLIKMEE 353
333 1.000e-40UniRef50_A0A2L0PJN9 Peptidylprolyl isomerase n=4 Tax=Vitreoscilla TaxID=59 RepID=A0A2L0PJN9_VITS1  ali  38  130.PEKRRVAHILLAFEQGADEA---------SKAQTKKKAEALLAKVKAKPADFAALAKENSQDPSAQNGGDLGFFAKGTMVKPFEDASFGLKKDEISGLVETEFGYHILKVLE 234
334 1.000e-40UniRef50_A0A2D6D7P9 Peptidylprolyl isomerase n=1 Tax=Parcubacteria group bacterium TaxID=2026774 RepID=A0A2D6D7P9_9BACT  ali  40  82.................................EARKKAEEILTKLKDEGGSFIELAKEFSEDVTSIQGGDLGYFSKGQMVEEFEKVAFSLEPGEISDIVKTQFGYHIIKVEE 161
335 1.000e-40UniRef50_A0A2E4XUE2 Peptidylprolyl isomerase n=2 Tax=unclassified Rhodospirillaceae TaxID=41296 RepID=A0A2E4XUE2_9PROT  ali  38  138..EEIRARHILLKTED---------------------EAKKVIAELQKGG-DFAEAAKKHSTGPSGAKGGDLGFFSKGMMVPEFQDAAFAMKDGEISAPVKTQFGWHIIKVEE 227
336 1.000e-40UniRef50_A0A2I0V8W0 Peptidyl-prolyl cis-trans isomerase n=3 Tax=Epidendroideae TaxID=158332 RepID=A0A2I0V8W0_9ASPA  ali  53  32..ERIRASHILLKHEESRRKSSWRDPDGRTSRVKAAEQLRELREEIAAGRSLFEDVAARHSHCSSAKRGGDLGQFGKGQMQKPFEQAAFALRVGELSDIVDTDSGVHIILRT. 145
337 1.000e-40UniRef50_A0A2S4K0Y2 Peptidylprolyl isomerase n=4 Tax=Alkalispirochaeta TaxID=2024958 RepID=A0A2S4K0Y2_9SPIO  ali  40  200.PEQVAARHILLATDEGADT------------DELRARLGQIRQQLLEG-ADFGALAREYSDCPSSAQGGDLGAFGRGQMVPAFEEAAFALEAGELSEIVETQFGLHLVQVTE 298
338 1.000e-40UniRef50_UPI000C068F9D peptidylprolyl isomerase n=2 Tax=Tepidibacter mesophilus TaxID=655607 RepID=UPI000C068F9D  ali  34  180KKEEAKASHILFKSVDDS-----MQPLSDQDKKIAKKKAEDILVRAKNGE-DFASLAKKYSEDTSGINGGNLGYFGKGVMVPEFEKATFELKAGEISDLVETEFGYHIIKVMD 287
339 1.000e-40UniRef50_A0A2P6VPN5 Parvulin-type peptidyl-prolyl cis-trans isomerase n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6VPN5_9CHLO  ali  57  4...QVRASHLLVKHRGSRRPASWKEPVVTRSEEEALAMVQAFRAQIAASPSAFASLASTESHCGSARAGGDLGWFGPGQMQKAFEDATFALAVGELSQPIHTDSGVHIILRT. 115
340 1.000e-40UniRef50_UPI00040E0E9E hypothetical protein n=1 Tax=Desulforegula conservatrix TaxID=153026 RepID=UPI00040E0E9E  ali  38  264...KAKARHILVKVDEKADAAKI---------DEAKKKAEGILAELKAGG-DFAKLADKYTEDPSGKNGGDLGEFTKNKMVKPFSDAAFALKPGEISDLVKTNFGWHIIKLE. 363
341 1.000e-40UniRef50_K2AN82 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2AN82_9ZZZZ  ali  39  246QKTEVQASHILIGWDESQLASD-------RTKDEAYTLISDIREKALNGE-DFASLATEYSEDGTGANGGDLGFFGKGAMVPEFETAAFETEIGELSEIVETQYGYHLIKVTD 351
342 1.000e-40UniRef50_UPI0006859067 hypothetical protein n=1 Tax=Desulfatiglans anilini TaxID=90728 RepID=UPI0006859067  ali  42  200KPEMVRASHILIKVPADADEE---------TKAAARKKLEAVQERLKKGE-DFGALAKEVSECPSAANGGDLGPFPADKMVKPFSEAAFALEPGNVSGIVETQFGYHLIR... 299
343 1.000e-40UniRef50_A0A1F8YEL5 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium GWC2_42_11 TaxID=1797816 RepID=A0A1F8YEL5_9DELT  ali  46  263KPKEVKARHILFRAQGS--------------KEEAKKKADEILQLIKKGE-DFGELAKRHSDDPSAKNGGDLGYFRAGMMVKSFEDAAFALQKGAVSSVVETEFGFHIIKIED 361
344 1.000e-40UniRef50_Q31GN2 Peptidylprolyl isomerase n=15 Tax=Piscirickettsiaceae TaxID=135616 RepID=Q31GN2_HYDCU  ali  39  263QPEKRQASHILVKVDAESQDA------------EAQKTIKEIQAKLADGE-DFAALAKTYSDDPSANMGGDLGLFQQGMMVPAFDKAVFSMKLNEISDPVKTEFGYHLIKLT. 362
345 2.000e-40UniRef50_A0A2V0PBX3 Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0PBX3_9CHLO  ali  55  154...QVRASHLLVKHCGSRRPASWKEDPVTRSPGEALALIEAFRSQLVAGQPSFAELAAVESHCNSAKRGGDLGFFGRGQMQPSFEGPAFALAVGELSGPVESDSGVHLILRT. 269
346 2.000e-40UniRef50_A0A1V5QY41 Peptidylprolyl isomerase n=1 Tax=Betaproteobacteria bacterium ADurb.Bin341 TaxID=1852821 RepID=A0A1V5QY41_9PROT  ali  36  262QSEERRASHILFRVEEESKKDKDKKRARA----------EALLEQVRKSPASFADLAKKYSDDPSAQKGGDLGFFGREAMVKPFEDAAFALKEGEISGLVESDFGFHIIKLT. 364
347 2.000e-40UniRef50_UPI00089FBF40 peptidylprolyl isomerase n=1 Tax=Thauera chlorobenzoica TaxID=96773 RepID=UPI00089FBF40  ali  42  132QPEQVHAQHVLIKSEG-------------RSKDEALALAKQVAAQANKDGQDFAKLAAEFTEDPSGKNGGDLGFFARGRMVKPFEDAAFGLEPGEIVGPVESPFGYHVIRLVE 233
348 2.000e-40UniRef50_A0A2H0LZ44 Peptidylprolyl isomerase n=1 Tax=Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_42_13 TaxID=1974746 RepID=A0A2H0  ali  48  149.PERWRASHILVK-----------------TEEEAKAILDEL-----AGGASFEELAKEKSQDTSAKRGGDLGYFTKGQMVPEFEEAVFKLDVGQTSGIVKSQFGYHIIKLT. 237
349 2.000e-40UniRef50_A0A1F8ZX84 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RBG_13_43_22 TaxID=1797825 RepID=A0A1F8ZX84_9DELT  ali  40  139.PEKIRVKHILIKVAASASDEE---------KKKASQKAEEVLIKIK-GGEDFSKLASEISDDPTKEKGGDLDFFSKGTMVPAFEEAAFSLKPGEISGIIETEYGYHIIKMEE 241
350 2.000e-40UniRef50_T2G8A4 Peptidylprolyl isomerase n=1 Tax=Desulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) TaxID=1121448 RepID=T2G  ali  44  264QEERVRARHILLRVEQNATAAEAG---------AVLEQIREIKTRLDSGEE-FAALAQELSDDTSNIVGGDLGWFGRGQMVPAFEAAAFALNPGEISDPVRTDFGYHLIK... 363
351 2.000e-40UniRef50_A0A1W9M982 Peptidylprolyl isomerase n=2 Tax=Desulfobulbaceae bacterium A2 TaxID=1934250 RepID=A0A1W9M982_9DELT  ali  41  265..ETRRARHILLKAGGEASAL--------------RRQAEGLLQQLKAG-ADFAELAQKNSQDGSAVRGGDLGFFGRGSMVPPFEQAAFALKPGEISPIVESDFGLHIIKLEE 361
352 2.000e-40UniRef50_A0A285GIE6 Peptidylprolyl isomerase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A285GIE6_9FIRM  ali  41  113KPESVQASHILVKEE---------------------EKAEEILDQLKEGLA-FAEAAKKYSTCPSKARGGDLGDFTKGKMVPEFEQAAFAMEEGEVSEPVKTQFGYHIIKVT. 203
353 2.000e-40UniRef50_B6G0K0 Peptidylprolyl isomerase n=1 Tax=[Clostridium] hiranonis DSM 13275 TaxID=500633 RepID=B6G0K0_9FIRM  ali  35  174KKDEVEASHILIKTTDDQNK-----PLPEADQKKAKAKAKKVLKEVKAGG-DFAELAKKYSQDPSAANGGALGAFGKGMMVQEFEDAAFGMEPGEVSDLVKTDFGYHIIKVTD 281
354 2.000e-40UniRef50_A0A2N1UZS6 Peptidylprolyl isomerase n=1 Tax=Ignavibacteriae bacterium HGW-Ignavibacteriae-4 TaxID=2013811 RepID=A0A2N1UZS6_9BACT  ali  36  367....VKASHILINFDNN--------------KDSAKAEATRILKEAKSG-KNFAELATKYTKDPSAANGGDLGFFGKGQMVPEFEAAAFGAKVGDIVGPVETSFGYHIIKVDD 461
355 2.000e-40UniRef50_A0A1B9F8Z1 Peptidylprolyl isomerase n=1 Tax=Dissulfuribacter thermophilus TaxID=1156395 RepID=A0A1B9F8Z1_9DELT  ali  36  265..ERRRARHILIKVPPGADNA---------TTAKKREKALEILKKAKAGE-DFAELAKKYSEDPTAKSGGDLGFFTKGMMVKPFEEKVFSMKEGEIAGPIRTQFGFHVVKLE. 365
356 2.000e-40UniRef50_A4IKU2 Foldase protein PrsA n=81 Tax=Bacillaceae TaxID=186817 RepID=PRSA_GEOTN  ali  44  135...KVRASHILV---------------------EDEKTAKEVKAKLDKGE-DFAKLAKEYSQDPSASNGGDLGWFGAGKMVKEFEEAAYKLKVGEVSDPIKTDYGYHIIKVTD 223
357 2.000e-40UniRef50_A0A2E5J1X9 Peptidylprolyl isomerase n=1 Tax=Candidatus Magasanikbacteria bacterium TaxID=2026717 RepID=A0A2E5J1X9_9BACT  ali  34  240..EQRKARHILFRVNE------------EITDDQAKTQAEQVQKKLADGE-DFAELAKEFGGDSTKENGGDLGWFGRGTMVPEFEQAIFALEPGQVSDLVKTQFGYHIVKLDD 338
358 2.000e-40UniRef50_A0A2N6BW61 Peptidylprolyl isomerase n=1 Tax=Desulfobulbaceae bacterium TaxID=2053307 RepID=A0A2N6BW61_9DELT  ali  33  141..EMIKAQHILIKVDDADNKEEV---------AAARRKIADIKSRLDKG-ASFADLAKEFSDDPSSMNGGDLGFFSRGSMVPAFEEAAFNTKKGDISEPTLTQFGWHLIRVTD 242
359 2.000e-40UniRef50_C5D6L9 Foldase protein PrsA n=86 Tax=Bacillales TaxID=1385 RepID=PRSA_GEOSW  ali  46  135...KIRASHILVKDE---------------------KTAEEIKTKLDKGE-DFAKLAKQYSQDPSAPNGGDLGWFGPGKMVKEFEDAAYKLKVGQVSDPVKTDYGYHIIKVTD 223
360 2.000e-40UniRef50_A0A2E9L0D5 Peptidylprolyl isomerase (Fragment) n=4 Tax=unclassified Deltaproteobacteria TaxID=45456 RepID=A0A2E9L0D5_9DELT  ali  33  289.PPEVRARHILLRVPGDANDEA---------KAERRQQLQEVRERIVAG-ADFAEEAKEVSQDMTKEKGGDLGWFKPGEMVPAFESAAFGLQPGEMSDIVESPFGLHLIKVEE 390
361 2.000e-40UniRef50_A0A1D2THU0 Peptidylprolyl isomerase n=3 Tax=Burkholderiales TaxID=80840 RepID=A0A1D2THU0_9BURK  ali  39  264..EQRRASHILITVDEGASDAD---------KSAARDKALALREKI-AGGADFAELAKAESQDPSAPSGGDLGYFSASMMVKPFADAAFALKEGEVSQVVETEFGYHVIKLT. 364
362 3.000e-40UniRef50_UPI0009DC1037 hypothetical protein n=1 Tax=Paenibacillus pinihumi TaxID=669462 RepID=UPI0009DC1037  ali  43  241.PEQVRASHILVASE---------------------KEAEDILKELKQG-ADFATLAKEKSTDPSKENGGDLNFFGRGQMVPEFEEAAFALKKGELSGIVKTMHGFHIIKLTD 331
363 3.000e-40UniRef50_UPI0004071933 peptidylprolyl isomerase n=2 Tax=Bacillales TaxID=1385 RepID=UPI0004071933  ali  41  142..DEVKASHILVK---------------------DKKTAEEVKAKLDKGE-DFAKLAKKYSQDTSKDKGGDLGYFHKGQMVPEFDKVAFSLKKGEISDPVKTQFGYHIIKVTD 231
364 3.000e-40UniRef50_A0A1V5YKH5 Peptidylprolyl isomerase n=1 Tax=Chloroflexi bacterium ADurb.Bin180 TaxID=1852857 RepID=A0A1V5YKH5_9CHLR  ali  41  226..EQVHARHILVATED---------------------EANKVLERLHAGE-DFAALAKELSTDGSKEEGGDLGWFPRGMMVTEFENAAFALQPGQTSEPVKTSFGYHIINVIE 315
365 3.000e-40UniRef50_T0Y8A9 Peptidyl-prolyl cis-trans isomerase (Rotamase D) (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T0Y8A9_9ZZZZ  ali  35  267..EMRRARHILLTVPNGASPAQ---------RQSIKQHAQQLLVRLQAHPEQFAAVAKVESQDPSASQGGDLGFFARGTMTPPFEKAVFALNKGEFSGPVETDFGYHVIQVTD 369
366 3.000e-40UniRef50_A0A1M5WQG5 Peptidylprolyl isomerase n=1 Tax=Desulfofustis glycolicus DSM 9705 TaxID=1121409 RepID=A0A1M5WQG5_9DELT  ali  42  266..ESRNARHILLKAAPDADEAIHQQQ---------RSLAEEVLTKARAGE-DFAALASEYSDDATAESGGELGFFNRGQMIKPFEDAVFAMQEGEISDIVQTDFGYHIIKLV. 365
367 3.000e-40UniRef50_A0A1G0XTF5 Peptidylprolyl isomerase n=1 Tax=Lentisphaerae bacterium GWF2_45_14 TaxID=1798572 RepID=A0A1G0XTF5_9BACT  ali  40  213EPEQIKASHILIRPADDKP----------ESKVAARKKAEEILAKITGNDKLFEELAAEESACPSGKRKGDLGYFPKGGMVKEFEDAAFALEPGKISGIVETQYGYHIIKVTD 316
368 3.000e-40UniRef50_UPI000DAB9808 hypothetical protein n=1 Tax=Bradymonas sediminis TaxID=1548548 RepID=UPI000DAB9808  ali  32  209...QVHARHILLNVKKDADEA---------TVADAKKRADAIAAEAKKPGADFEALAKEKSEGPTASRGGDLGYFEKSRMVPEFAEAAFAMKAGEISDPVRSDFGFHIIQVVD 309
369 3.000e-40UniRef50_R1CTL4 Foldase protein PrsA n=10 Tax=Firmicutes TaxID=1239 RepID=R1CTL4_9CLOT  ali  42  163..EQVKASHILV---------------------ESEEQAREIKEKLDANE-DFAKLAKEYSIDTSAENGGDLGFFKRGEMVPEFEEAAFSLEVGEISEPVKSQFGYHIIKVED 252
370 3.000e-40UniRef50_A0A1V5Q8J4 Peptidylprolyl isomerase n=1 Tax=Verrucomicrobia bacterium ADurb.Bin345 TaxID=1852930 RepID=A0A1V5Q8J4_9BACT  ali  35  206.PETVSARHILVAVE---------TTDTQEQRDAKKAKAEELREKLVAG-SDFAEVAAESSDCPSKTRGGDLGTFGRGQMVQPFEEAAFTQKIDEIGPVVETQFGYHIIQV.. 305
371 3.000e-40UniRef50_A0A254VPP8 Peptidylprolyl isomerase n=1 Tax=Xenophilus sp. AP218F TaxID=2014876 RepID=A0A254VPP8_9BURK  ali  33  246..EQRRASHILLAVSKDAKPDQ---------RAKVKAEADALLKEVRANPAKFAEIAKQKSQDPSAANGGDLGFFDRGMMVKPFDDVVFRMKPGQISEVVQTEYGYHIIRLDE 348
372 3.000e-40UniRef50_A0A2V8GHZ1 Peptidylprolyl isomerase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8GHZ1_9BACT  ali  41  207...RVRASHILIQVPQGADAATKAAAKTKA---------EGILKDLKAG-KDFAAAAKENSQDPSAVNGGDLGFFEQGQMVPPFEQAAFALKPGQMSEIVETQFGFHIIKVAE 307
373 3.000e-40UniRef50_A0A1F9M4Q7 Peptidylprolyl isomerase n=5 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9M4Q7_9DELT  ali  33  180QPEMAHARHILIAAKEAEPKAD---------KDRKRAKLVQIKKQLK-GGADFAELAKQSSDCPSKERGGDLGFFPRGQMVKAFDQVVFKMMPGDVSDVVETEFGFHLIRLEE 282
374 3.000e-40UniRef50_A0A2V8UZM4 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8UZM4_9BACT  ali  37  163EYESVHARHILIRMKGSSVP--ILLGKKELTDEEALAKAQEVRAKLLAGG-NFADLAKGESDDASAKEGGDLGTFKHGQMIPQFDQSAFSLPIGQVSEPVKTPFGYHLIKVE. 272
375 4.000e-40UniRef50_A0A1F4DLM0 Peptidylprolyl isomerase n=2 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A1F4DLM0_9PROT  ali  36  264QQEERRASHILISVKSGANDAE---------KAKAREKAQSLLDQITRSPAVFGELAKKNSDDPSAAKGGDLGYFALGMMVKAFEDAAFRLGVNETSGLVESEFGFHIIRVT. 367
376 4.000e-40UniRef50_A0A1G6AUH4 Peptidylprolyl isomerase n=5 Tax=Desulfonatronum TaxID=66848 RepID=A0A1G6AUH4_9DELT  ali  37  265.PEQVWARHILITPSDATEEA----------ENQARDQLLALLVRIQ-GDENFEDLAREYSEDASAAQGGDLGWFGRGEMIAEFEDAAFELQAGQISSPVRSPFGWHLIQVEE 365
377 4.000e-40UniRef50_A0A1E7IHS6 Peptidylprolyl isomerase n=6 Tax=Desulfuromonadales TaxID=69541 RepID=A0A1E7IHS6_9DELT  ali  35  272..EQIKAAHILLRIDRDADE---------KTVQKRRELAAELLKQLREGG-NFAQLAKAYSDDGTADNGGDLGYFGRGTMVSSFEDTAFKLKPGQLSGIVQTPFGFHIIKVTE 373
378 4.000e-40UniRef50_A0A1F9F4X3 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_40_11 TaxID=1797858 RepID=A0A1F9F4X3_9DELT :_  ali  39  241...QVRARHILIKGKTD----------------EARKKIEEIQAKTTA--QNFEQMAKEHSQDGSAAQGGDLGFFGKGKMVKAFEDVAFKLKPGEVSDSVESPFGYHLIKVEE 332
379 4.000e-40UniRef50_A0A162X2N3 Peptidyl-prolyl cis-trans isomerase n=32 Tax=Eukaryota TaxID=2759 RepID=A0A162X2N3_PHYB8  ali  68  42EHERVRASHLLVKHKDSRRPSSWKEENITRTXXXXXXXXXXXXXXXXXXXXXLSALATNHSDCSSAKRGGDLGHFERGQMQKPFEDTAFGLKVGELSQPIWTDSGVHLILRTE 154
380 4.000e-40UniRef50_A0A0M7AS18 Peptidylprolyl isomerase n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M7AS18_9RHOB  ali  41  141.PEEINARHILV-----------------EDKAAAEALITEL-----DGGADFAELAKEKSTGPSGPNGGDLGYFAKGQMVPPFEEAAFALEPGSFTEPVETQFGWHIIKVED 231
381 4.000e-40UniRef50_R6U0J8 Peptidylprolyl isomerase n=1 Tax=Firmicutes bacterium CAG:272 TaxID=1263015 RepID=R6U0J8_9FIRM  ali  42  107.PEQVNASHILV---------------------DSEDKANGIKAQLENGEVTFEEAAKRYSTCPSKENGGNLGEFGKGQMVKEFEDAAFALEPGKVSDPVKTQFGYHIIKV.. 201
382 4.000e-40UniRef50_A0A2E7BRM2 Peptidylprolyl isomerase n=3 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E7BRM2_9DELT  ali  40  234QSEEVKARHILAKVSKGADLDEKKKAKAK---------IEAVIGKLKDG-ADFVELAKTESEGPSASKGGDLGWFGRGAMVKPFEEAAFALEPGGLSGVVESSFGFHVIKVEE 336
383 4.000e-40UniRef50_A0A0S7Y2J0 Peptidylprolyl isomerase n=1 Tax=Syntrophobacter sp. DG_60 TaxID=1703361 RepID=A0A0S7Y2J0_9DELT  ali  39  246QPKTVRASHILFRVPLDASPQRV---------EDTRKKAIKVLEKAK-GMEDFSKLAKKYSEDANAAKGGDLGWFGRGTLLKPFEDAAFSLKKGQISDLVRTNFGFHIIKVED 349
384 4.000e-40UniRef50_A0A0G4IM54 Uncharacterized protein n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4IM54_PLABS  ali  53  181.PEQIRASHILVKHVGSRNPSSWREKDITRSEDDALRAITSFRKAIVSGDRTFEDIARSESDCSSHSRSGDLGKFAKGKMQKAFEEVAFSLKISELSGPVFTNSGIHLIKRT. 291
385 4.000e-40UniRef50_A0A1F9UG09 Peptidylprolyl isomerase n=1 Tax=Elusimicrobia bacterium RIFCSPLOWO2_01_FULL_59_12 TaxID=1797946 RepID=A0A1F9UG09_9BACT  ali  38  194..ERVRARHILVRVGPNASKED---------KSTAMNRAKDVQRQLKGG--DFAELAKKYSEDPSRERGGDLGYFSRGDMVPAFDKAAFALNVGQTSDVVTTDFGHHLIRVEE 294
386 4.000e-40UniRef50_A0A2G6EF50 Peptidylprolyl isomerase n=12 Tax=Ignavibacteriae TaxID=1134404 RepID=A0A2G6EF50_9BACT  ali  41  339....VRASHILIRMDND--------------EKEAKKKIDEIYKELKNG-ADFEKLAKEKSQDGSASKGGDLGWFGKGQMVKEFENASFRGKIGVVQKPIKTQFGYHIVKVT. 431
387 4.000e-40UniRef50_A0A1I3SDN9 Peptidylprolyl isomerase n=3 Tax=Peptostreptococcaceae TaxID=186804 RepID=A0A1I3SDN9_9FIRM  ali  44  177..DTVTASHILLKTQDSEGKELSXXXXXXXXXXXXXX-----LAKVKSGE-DFAKVAKKYSQDSSASKGGELGTFGRGQMVSEFEKAAFNMKKGEISDIVETEYGYHIIKVT. 280
388 5.000e-40UniRef50_A0A0G0YIB3 Peptidylprolyl isomerase n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0YIB3_9BACT  ali  37  172...........LKAKMLRQKVAEKVTGDDVLNKEAKTKAEQVLAEVKNGG-DFAELAKKYSQDTSAAEGGDLGFFGKGKMVKEFEDAAFALKKDEVSGVVKTVYGYHIIKVTD 272
389 5.000e-40UniRef50_A0A1W9I0C9 Peptidylprolyl isomerase n=1 Tax=Proteobacteria bacterium SG_bin7 TaxID=1827384 RepID=A0A1W9I0C9_9PROT  ali  39  231KDEEVRARHILVKAEKGNKKA----------EEEALKKIKDIAAEVKT--KDFGDLAQKYSDDPSKAKKGDLGFFGRGRMVPEFDEAAFSLPVNKISEPVKTDYGYHLIQVME 332
390 5.000e-40UniRef50_A0A1V4QYN7 Peptidylprolyl isomerase n=1 Tax=Candidatus Cloacimonas sp. 4484_140 TaxID=1956163 RepID=A0A1V4QYN7_9BACT  ali  43  172.PKMVKIAEIAIK-----------PAMGSETLDQALQEIEDIQEELNKG-ADFEELARKYSDCPSAAQGGDLGYFSRGQMVPEFEEAAFALEIGEVSEPVLTEFGYHLIRVDD 271
391 5.000e-40UniRef50_Q2Y6J4 Peptidylprolyl isomerase n=14 Tax=Nitrosomonadales TaxID=32003 RepID=Q2Y6J4_NITMU  ali  36  262QPEERRASHILISAPASASD-----------RATARAKAEELLAEVRKSPQRFTELAKQHSQDPSAPTGGDLGFFARNMMTKSFEDAVFRMKPGEISDIVETEHGFHIILLAE 364
392 5.000e-40UniRef50_A0A1F9VGE3 Peptidylprolyl isomerase n=1 Tax=Elusimicrobia bacterium RIFCSPLOWO2_12_FULL_59_9 TaxID=1797952 RepID=A0A1F9VGE3_9BACT  ali  40  239..ERIRARHILIELPPKASVVE---------KSQALNKIKDIQKDLEDGE-DFAELARAHSEDPSAQRGGDLGPIIRGMMVPEFEKAAFALAVGEISDIVQTDFGYHIIRVEE 340
393 5.000e-40UniRef50_U5NAH5 Peptidylprolyl isomerase n=1 Tax=Candidatus Symbiobacter mobilis CR TaxID=946483 RepID=U5NAH5_9BURK  ali  37  269..EERRASHILIRADKDAAQRAQARARA-----------EELLQTLRKAPTRFAELAKQHSQDPSATKGGDLGHFGRGMMVKPFEDAVFALKVGELSDVVESDFGFHLIMLTD 369
394 5.000e-40UniRef50_A0A0G0N0H9 Multifunctional fusion protein n=7 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A0G0N0H9_9BACT  ali  49  256EDKEVKASHVLIAYQGS----SKADESITRTKEEAQALTEEIHQKALNGE-DFGELAIQYSDEPGAKDSGDLGFFKPGVMSKPFEDAAFALEKGQISDVVETEFGFHVIKVTD 364
395 5.000e-40UniRef50_A0A2V7XZY0 Uncharacterized protein n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7XZY0_9BACT  ali  36  150EYEQVKAKHILIAFKGS---PAAPKGKKELTDAEAKAKAETLRAEIVAGKAKFEDVAKKESDDTTGKNGGELGAFSRGQMVPEFEQAAFSAKVGDMTPVVRTQFGYHIIKVEE 260
396 6.000e-40UniRef50_A0A2G4JIQ3 Peptidylprolyl isomerase n=4 Tax=Acidobacteria TaxID=57723 RepID=A0A2G4JIQ3_9BACT  ali  37  272.PAQVRASHILFKLEGKD-------------EKVVQALAEDVLKKATAPSADFAALAKQYSEDDSNQNGGDLDYFGRGRMVAEFEQAAFGMKAGEISNLVKTAFGFHIIKVVD 371
397 6.000e-40UniRef50_A0A2V7W4P3 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7W4P3_9BACT  ali  35  35EYEQVTAKHILIAFKGSPAAQSGKPEL---TEEQAKAKATELRKQILAG-ASFEELAKKESDDGSGANGGELGDFNHGQMVPEFEQAAFAAKAGDITEPVRTQYGYHIIKVE. 143
398 6.000e-40UniRef50_A0A258ZJR5 Peptidylprolyl isomerase n=1 Tax=Gallionellales bacterium 24-53-125 TaxID=1970510 RepID=A0A258ZJR5_9PROT  ali  36  263.PELRKAAHILIAVDAKASDAE---------KQAARVNAEQILQQVREAPAQFSQLARKYSQDPSAENGGDLGMFGRGMMVKPFDEAVFKLIVGEVSGLVQTDFGFHIIKL.. 364
399 6.000e-40UniRef50_A0A1Q6DKN6 Peptidylprolyl isomerase n=1 Tax=Desulfobulbaceae bacterium DB1 TaxID=1920419 RepID=A0A1Q6DKN6_9DELT  ali  40  140QGEQVEAQHILIRVDATAPAED---------QEKARKTIETIRQELKKGE-SFSRLAQKHSEDPSAAKGGNLGFFGRGQMVKEFEDAAFATKPGETSEPVLTNFGWHLI.... 239
400 7.000e-40UniRef50_A0A2V8TZJ8 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8TZJ8_9BACT  ali  36  265.PERIKVRHILIKTMGKPDSE----------KKQLQAKAEDVLKQLKNGG-DFAALAKKYSDDTSAQKGGDLDWIVRGQTVPEFEKVAFSLKPNEMSGVVTTEFGYHIIQVTD 366
401 7.000e-40UniRef50_A0A1X7R5L7 Peptidyl-prolyl cis-trans isomerase n=4 Tax=Eukaryota TaxID=2759 RepID=A0A1X7R5L7_9SACH  ali  54  59.PLRVRCLHILIKHSGSRRPSSRINAKITIDKEEAIKELQAIHDKLTSQDESFEAIAKERSDCSSFKRGGDLGWFGKGEMQPSFEKAAFALTVGEISDIVETDSGVHIIKRV. 174
402 7.000e-40UniRef50_G9WY45 Peptidylprolyl isomerase n=4 Tax=Peptoanaerobacter stomatis TaxID=796937 RepID=G9WY45_9FIRM  ali  38  181..EKVKASHIIILTTENGKDMS------AEKQEEAKKKIDEIYEKIQAGE-SFEELAKQYSQDGSKNSGGDLGYFSKGEMVKEFSDVAFNMNIGEISKPFKTQFGYHIVKVTD 284
403 7.000e-40UniRef50_R5IX75 Peptidylprolyl isomerase n=1 Tax=Clostridium sp. CAG:1193 TaxID=1262771 RepID=R5IX75_9CLOT  ali  42  153....IKASHILIKSDASSSATDDEKKKA---EEKALEKAKEIIKKLDDGEK-FEDLAKKYSEDSSASDGGNLGYFNRGEMAAEFEDAAVNLKVGEYTEPVKTKFGYHIILKTD 258
404 7.000e-40UniRef50_A0A074LM47 Foldase protein PrsA n=1 Tax=Tumebacillus flagellatus TaxID=1157490 RepID=A0A074LM47_9BACL  ali  39  151.PEQVHARHILVKDE---------------------AKAKELYEKLKANPADFEKLAKENSEDPSKDKGGDLGTFGKGAMVPEFETAAFAAKPNEIVGPVKSEFGYHIIQVLE 242
405 7.000e-40UniRef50_A0A2V2YPA8 Parvulin-like peptidyl-prolyl isomerase n=1 Tax=Paenibacillus cellulosilyticus TaxID=375489 RepID=A0A2V2YPA8_9BACL  ali  40  221.PEQVHASHILVAT---------------------KDEADAIYTQLING-TDFAALAKEKSIDGSGANGGDLGYFARGVMVSEFEDAAFSLKVGEISLPVQSQYGYHLILVTD 311
406 7.000e-40UniRef50_A0A1F6M7G2 Peptidylprolyl isomerase n=2 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A1F6M7G2_9BACT  ali  36  209QTEEAHARHILFRVEQENEDATV------------KAQAQEVLNRVKSGE-DFAKLAQEFGSDGTSQVGGDLGWFGRGVMVKEFEDAAFALEPGQVSDLVKTEFGYHIIRVDE 309
407 7.000e-40UniRef50_UPI000DAC00CD peptidylprolyl isomerase n=1 Tax=Acuticoccus sp. PTG4-2 TaxID=2184697 RepID=UPI000DAC00CD  ali  43  202..EQVTASHILV-----------------ETEDEAKDIIKQL-----DDGADFAELAEENSKDPSAQKGGSLGKFTRGQMVKPFEDAAFALEPGQITEPVQSQFGWHIIKLED 292
408 7.000e-40UniRef50_UPI000A05CA1F hypothetical protein n=1 Tax=Anaerovorax odorimutans TaxID=109327 RepID=UPI000A05CA1F  ali  39  177..DEIRASHILI--------------GDKEHKPEDKALAEEVLQKIKDG-ASFEEMAKEYGTDGTKDKGGDLGWFGKGDMVSEFENAAYALKKGELSGVVETEFGYHIIKLTD 272
409 7.000e-40UniRef50_UPI00097DCEB6 hypothetical protein n=1 Tax=Mailhella massiliensis TaxID=1903261 RepID=UPI00097DCEB6  ali  37  261EQEQIQARHILIRVPANAPEAEVK---------KAEEQIRSLEARIR-GGEDFAELAKQFGQDGTAPQGGDLGWFAAGQMVPEFSKAAFALKDGEVSAPVRTQFGFHLIKKE. 362
410 7.000e-40UniRef50_UPI000988923E hypothetical protein n=1 Tax=Caenibacillus caldisaponilyticus TaxID=1674942 RepID=UPI000988923E  ali  44  142...EVKASHILVK---------------------DKKKADEILQKLKNGE-DFAKLAKTYSDDATKNKGGDLGWIKKGQMVAAFEKAAFSMKKGELSGPVKTEYGYHIIKVTD 230
411 8.000e-40UniRef50_A5DWT3 Peptidyl-prolyl cis-trans isomerase n=3 Tax=Debaryomycetaceae TaxID=766764 RepID=A5DWT3_LODEL  ali  42  66...KVRASHILVKNATSRKPKSWKSPEILISRDEAISIAKKHLAQILSGEAKFADVAQAESDCSSHARGGDLGFFGKREMQPAFESTVYSMHVGEISDVIETDSGIHLVQRT. 175
412 8.000e-40UniRef50_A0A1V8TR82 Uncharacterized protein n=4 Tax=Rachicladosporium TaxID=470018 RepID=A0A1V8TR82_9PEZI  ali  59  675...KIRCAHLLVKHRDSRRASSWREAQITRSKDEAREIIEAHEGRIKSGESSLGDLATTESDCSSARKRGDLGFFGHGDMQKEFEEASFALKPGEISPIVETASGLHIIERLE 784
413 9.000e-40UniRef50_A0A2E8Q2R1 Peptidylprolyl isomerase n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2E8Q2R1_9BACT  ali  42  219.PESVHAAHILIKVDNKFSDKD---------KEIARKKIDDILIKAQEGE-DFAELAKQYSEGPSASRGGDLNNVTRNQMVKEFEDAVFKLNEGEISDVVETQFGFHIIKAYE 320
414 9.000e-40UniRef50_A0A0A1PQJ5 Peptidylprolyl isomerase n=4 Tax=Bacteria TaxID=2 RepID=A0A0A1PQJ5_9BACT  ali  38  167QPEEVRARHILV-----------------ETEEEARAIIAQLR-----GGADFAALAKEKSKDPGGAEGGDLGFFTKSQMVPEFANAAFAMQPGQVSDPVKSQFGWHVIKLEE 259
415 9.000e-40UniRef50_A0A2N2UVY9 Peptidylprolyl isomerase n=1 Tax=Betaproteobacteria bacterium HGW-Betaproteobacteria-11 TaxID=2013702 RepID=A0A2N2UVY9_9PROT  ali  34  294..EMRRASHILILAPKNAGEAVVK---------AAREKAEKILAQLKKSPAEFDKLAKESSQDPSAEKGGDLGWFARGAMVKPFEDVAFTLKEGAISDLVRSDFGFHVIRV.. 394
416 9.000e-40UniRef50_A0A1Q7V1X6 Peptidylprolyl isomerase (Fragment) n=5 Tax=Acidobacteria TaxID=57723 RepID=A0A1Q7V1X6_9BACT  ali  30  277.PEQVNVRHILIKTPLPGADGKIDPKAV----DTARAKAQDVLKQVKAGG-NFADLAKKYSDDPSAKNGGSYGWIGKGRMVPEFEKAAFSLPKGGTSELVQTSYGFHIIHVDD 384
417 9.000e-40UniRef50_C3X4B2 Peptidylprolyl isomerase n=2 Tax=Oxalobacter formigenes TaxID=847 RepID=C3X4B2_OXAFO  ali  36  268.PEERRAQHILIAVAKNASDSEKAEAKKKAEELL---------AQLKADPSRFAELAKAHSQDPSARNGGDLGFFTRGKMVKPFNDAVFGMKKGEISDPVQTDFGYHLIAVTD 371
418 9.000e-40UniRef50_A0A0K9P6U6 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Zostera marina TaxID=29655 RepID=A0A0K9P6U6_ZOSMR  ali  50  97..EKVTACHILVKHSESRRKASWKDPEGVEIKKTALEKLTGARKEIVDRKKKFEDVARKLSDCSSAKRGGSLGSFGRGKMQKSFEEVVFALKVGEISEIVNTDSGFHIILRT. 210
419 9.000e-40UniRef50_A0A1Q7CJH6 Peptidylprolyl isomerase n=2 Tax=Acidobacteria TaxID=57723 RepID=A0A1Q7CJH6_9BACT  ali  31  110.PEQVNVRHILIKTPLPGPDGKVDTKGA----EEARKKAEDVLKQIKAGG-NFAELAKKYSEDPSAKNGGSLGWIGKGRTVPEFEKAAFSLPKGGTSDLVQSSYGFHIIHVDD 217
420 9.000e-40UniRef50_UPI0003FB9F4E foldase n=1 Tax=Bacillus kribbensis TaxID=356658 RepID=UPI0003FB9F4E  ali  40  154QAEQVKASHILVK---------------------DKKTADEVKKKLDEGG-SFEELAKKYSTDTTKDKGGDLGYFSKGKMTKAFEDKAFSLKKGEISDPVKTEYGYHIIKVVD 244
421 1.000e-39UniRef50_A8ZS60 Peptidylprolyl isomerase n=1 Tax=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) TaxID=96561 RepID=A8ZS60_DESOH  ali  33  264..ETVEARHILISLEQDADEARV---------EEARQKAADIYVMVTDGGKDFAETARQYSEGPSAGEGGYLGAFTREDMVAPFSEKAFSMAPGEISEPVRSQFGWHIIKVE. 364
422 1.000e-39UniRef50_A0A2J6JBJ3 Peptidylprolyl isomerase n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2J6JBJ3_9DELT  ali  40  280..EQVKASHILIKAEAESSDEV---------KEEKRAFAEKLLVDLDEG-ADFAELARKHSDDPSASRGGELGFFTRGTMVAPFEEAAFTLKPGELSGVVETSYGFHIIRADE 381
423 1.000e-39UniRef50_A0A1V6J2Z3 Peptidylprolyl isomerase n=1 Tax=Verrucomicrobia bacterium ADurb.Bin018 TaxID=1852925 RepID=A0A1V6J2Z3_9BACT  ali  42  212QGETVTASHILVKVDPDETGDA---------KEAKRARIAELRQQLLDG-ADFAEVAKANSDCPSASAGGDLGSFGRGQMVAPFEDAAFAQPVGSVGDIVETQFGFHLIKVT. 313
424 1.000e-39UniRef50_G7W9M5 Peptidylprolyl isomerase n=5 Tax=Desulfosporosinus TaxID=79206 RepID=G7W9M5_DESOD  ali  42  155EPEQVKASHILVSTE---------------------EIANEIEAKLAAGE-DFAELAKEYSTDNSKDSGGELGYFKKGDMVQEFEDVAFSLEVGKISEPVKTDYGYHIIKVED 246
425 1.000e-39UniRef50_A0A2D6RTQ5 Peptidylprolyl isomerase n=8 Tax=Bacteria TaxID=2 RepID=A0A2D6RTQ5_9BURK  ali  32  275.PEERRARHILL-----------DAEKEGASADELKAAAEKVLAELKANPSRFAEIAKQYSIDPSSNQGGDLGFFGKGAMVPEFEQAVFSQKKGELSGLVKSQFGYHIVEVTD 376
426 1.000e-39UniRef50_A0A2V9BYT8 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9BYT8_9BACT  ali  36  264.PNRVRASHILFKTVGKTDAEV----------EEIRKKAEEALKKAKRPGAKFDELAKQYSEDTSKDKGGDLGWILQGQTVPEFEKVAFSLAPGAISDLVKTQYGFHIIKVME 365
427 1.000e-39UniRef50_A0A011PTX8 Peptidylprolyl isomerase n=1 Tax=Candidatus Accumulibacter sp. BA-94 TaxID=1454005 RepID=A0A011PTX8_9PROT  ali  36  35QPEERRASHILI-----------LAATGDADKDSARAKAEEVLKEVQKAPARFADLARKYSQDPSAAKGGDLGVVARGTMVKPFEEAVFSLRENELSGLVQSEFGYHIIMVT. 136
428 1.000e-39UniRef50_L0K9R7 Peptidylprolyl isomerase n=1 Tax=Halobacteroides halobius (strain ATCC 35273 / DSM 5150 / MD-1) TaxID=748449 RepID=L0K9R7_HALHC  ali  42  200....VTASHILIKTD-------------KRTTKEAKAKANEILAKIKNGQE-FSKMAKKYSEGPSGKKGGRLGSFAHGQMVPAFEKKAFSMSVGEVSKPVKTRFGYHLIKVTD 294
429 1.000e-39UniRef50_A0A2D9M2Y6 Peptidylprolyl isomerase n=9 Tax=Bacteria TaxID=2 RepID=A0A2D9M2Y6_9GAMM  ali  40  274.PEQVRASHILFNSQGAD-------------EVALREKAESVLAEAQAG-ADFANLAEQYSDDGSASLGGDLNYFGRGQMVPAFETAAFGLMPGEISGLVQSDFGLHIIKVVD 372
430 1.000e-39UniRef50_A0A2H0YGD2 Peptidylprolyl isomerase n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A2H0YGD2_9BACT  ali  34  193QKESVKASHILIKVAKDATKED---------DAKAQKKIKELLKRAKKGE-DFAKLAKENSEDPTAANSGELGYFSTEEMVPEFAKAAFALKPGEISDVVKTSFGYHIIKSED 296
431 1.000e-39UniRef50_Q1DF35 Peptidylprolyl isomerase n=19 Tax=Cystobacterineae TaxID=80811 RepID=Q1DF35_MYXXD  ali  34  179...EVHARHILVQVDAKATAEQV---------EAAKKRAEAIATEARRPGMDFASLARARSEGPSAADGGDLGWFKRGVMVPAFEKAAFGLPEGGVSEPVRTNFGWHVLKVEE 279
432 1.000e-39UniRef50_N6USB7 Peptidylprolyl isomerase n=21 Tax=Bartonella TaxID=773 RepID=N6USB7_BARVB  ali  41  156KEDEVKARHILVKT---------------------KKEAETIIKRLNKGE-NFEEIAKKNSTDGSAAVGGDLGYFSHGQMVKPFEDAAFGLKVGEYTKPVESPFGWHVIKVED 247
433 1.000e-39UniRef50_I3THF5 Peptidylprolyl isomerase n=5 Tax=Rhodospirillaceae TaxID=41295 RepID=I3THF5_TISMK  ali  38  145QPEEVHARHILVATED---------------------EAKAIKAELDKG-ADFAKLASEKSTDPGAANGGDLGFFTADRMVKPFADAAFAMKPGQISDPVQTQFGWHVIKLEE 236
434 1.000e-39UniRef50_A0A2V2YL85 Foldase protein PrsA n=1 Tax=Paenibacillus cellulosilyticus TaxID=375489 RepID=A0A2V2YL85_9BACL  ali  44  229..EQVRASHILVAT---------------------KEEADAIEKQLKEG-ADFAALAKEKSDTGSKENGGDLDFFSKGSMVAEFEDAAFSLKVGEVSEPVKSDYGYHIIKVTD 318
435 1.000e-39UniRef50_A0A2V8I8A1 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8I8A1_9BACT  ali  44  250.PERVKAQHILFKTQEKTPEEI----------EKIKDKARQVLERAKKGE-DFGSLAKQFSEDSTAEAGGDLGDFGRGQMVPEFERVAFSLGVGAISDLVQTQFGIHIIKVT. 349
436 1.000e-39UniRef50_A0A1M4NA71 Peptidylprolyl isomerase n=2 Tax=Clostridium TaxID=1485 RepID=A0A1M4NA71_9CLOT  ali  37  113QEESINARHIL---------------------NGDLEKAKEAYDKVKEG-MDFAEVAKEYSVCPSKAKGGELGYFTKGRMVPEFEKAAFGLEVGEISEPVKTEFGYHIIQVID 203
437 1.000e-39UniRef50_A0A2G6MBJ0 Peptidylprolyl isomerase n=2 Tax=Desulfobulbus TaxID=893 RepID=A0A2G6MBJ0_9DELT  ali  31  264.PEERHVRHILFKVEATDSSEQ---------KAAQKKKAEEVLDLAKNG-KDFAELAGTYSEGPTKDRGGDLGFFPQGQMVPEFDRVVFSMHPGEISDLVQTSFGYHIILLED 365
438 1.000e-39UniRef50_A0A267MDL0 Peptidylprolyl isomerase n=1 Tax=Anaeromicrobium sediminis TaxID=1478221 RepID=A0A267MDL0_9CLOT  ali  42  185..EQVRARHILVSEED---------------------KAKEILEKLKAGE-DFAALATEFSKDPSATKGGDLGFFPKGVMVPEFEQTAFSLKPGEISDLVKTQFGYHIIKVEE 274
439 1.000e-39UniRef50_A0A221KGI7 Peptidylprolyl isomerase n=2 Tax=Vitreoscilla filiformis TaxID=63 RepID=A0A221KGI7_VITFI  ali  30  251..EERRANHILISVPKDAPAAD---------RDKAKAQAEALLAEVRKNPASFGDVARKHSQDPSASRGGDLDFFGRGAMTKPFDEAVFAMKPGEISNLVSTEFGYHIIQLV. 352
440 1.000e-39UniRef50_A0A1U9Z627 Peptidylprolyl isomerase n=6 Tax=Rhizobiales TaxID=356 RepID=A0A1U9Z627_9RHIZ  ali  40  138KQEEVHARHILV-----------------ESEDEAKEIIKEL-----DNGADFAELAKEHSTGPSGPDGGDLGYFAKGQMVPPFEEAAFALEPGKYTEPVKTDFGYHVIEVED 229
441 1.000e-39UniRef50_A0A1H0NLA4 Peptidylprolyl isomerase n=7 Tax=Burkholderiales TaxID=80840 RepID=A0A1H0NLA4_9RALS  ali  34  270..EQRRASHILITVPKDAKDAD---------RKAAKDKAQKLLEDVRKHPETFADVAKKNSQDPSAEKGGDLGFMGRGALVKPFEDAMYALKDGQISDLVETDYGYHIIKLT. 371
442 1.000e-39UniRef50_A0A1E9AIP5 Peptidylprolyl isomerase n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1E9AIP5_9FIRM  ali  46  114EPESRSASHILV---------------------DNEAKAKDIKAKIDKGE-DFASLAKEHSACPSKANGGDLGTFHRGQMVKEFDDKVFSMNIGEISEPVKTQFGYHIIKL.. 202
443 2.000e-39UniRef50_A0A1M3L2B5 Peptidylprolyl isomerase n=1 Tax=`Candidatus Kapabacteria` thiocyanatum TaxID=1895771 RepID=A0A1M3L2B5_9BACT  ali  42  368....VRASHILINLDGG--------------KDSAKAAAEKIMARAKKGE-DFATLARENSKDPSAMNGGDLGFFAKGRMVKPFEDAAFGAAIGSVVGPIETQFGYHIIKVTD 462
444 2.000e-39UniRef50_M1YNN1 Peptidylprolyl isomerase n=1 Tax=Nitrospina gracilis (strain 3/211) TaxID=1266370 RepID=M1YNN1_NITG3  ali  30  270..KRYKARHILVRTEGDTLSTDEKEKRLNESDAKAKAKAEDILKQIKEGGKTFEEMAKEHSDDMSGAKGGDLGQFPKGTMVPEFEAALETMKPGAISGPVQTAFGFHLIKLEE 386
445 2.000e-39UniRef50_A0A1V5XVL1 Protein translocase subunit SecD n=18 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V5XVL1_9BACT  ali  40  261...EVKARHILIQYAG----ASQASADITRTKEQALEEIERIQGELS--GADFAELAKKYSEEPKAESGGDLGWFDKGVMVEEFEQAVFALSKGEVSEPVETAFGYHLIYKED 365
446 2.000e-39UniRef50_A0A1F9GRL4 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_43_9 TaxID=1797867 RepID=A0A1F9GRL4_9DELT  ali  30  136...QIRASHILLRVPPNAD---------QKSQDEIEKKIGTIYKQAIADKKSFPELAKKYSEDPTGKRGGDLDYFSKDRMVPAFSEAAFSLKIGDVSQPVKTQFGWHIIQLT. 236
447 2.000e-39UniRef50_A0A2P1G632 Peptidylprolyl isomerase n=1 Tax=Peptostreptococcaceae bacterium oral taxon 929 TaxID=2081703 RepID=A0A2P1G632_9FIRM  ali  46  30EPESRSASHILV---------------------DNEAKAKDIKAKIDKGE-DFASLAKEHSACPSKANGGDLGTFHRGQMVKEFDDKVFSMNIGEISEPVKTQFGYHIIKL.. 118
448 2.000e-39UniRef50_A0A1Z9T8R9 Peptidylprolyl isomerase n=4 Tax=unclassified Kiritimatiellaceae TaxID=2020000 RepID=A0A1Z9T8R9_9BACT  ali  34  198.PEQVTASHILVKPAEGADEAAKAASKAE---------LETIRASIIAGETSFAEAAAAHSSCPSSAQGGSLGTFGKGQMVPEFEIAAFTQEIGEVGDIVETQFGYHIIQVSE 300
449 2.000e-39UniRef50_A0A134ABV0 Peptidylprolyl isomerase n=3 Tax=Peptoniphilus TaxID=162289 RepID=A0A134ABV0_9FIRM  ali  42  114KPESVHAAHILV---------------------DNEDKAKEIAQKLDEG-ADFEELAKEHSTCPSSERGGDLGSFGRGQMVPEFDEKVFAMKDGTISEPVKTQFGYHIIKR.. 202
450 2.000e-39UniRef50_A0A2D5EWL2 Peptidylprolyl isomerase n=3 Tax=Myxococcales TaxID=29 RepID=A0A2D5EWL2_9DELT  ali  39  257..EQVRARHILIKASQDAAEEV---------RTAARQRAESLLRRARAGE-DFEALASEFSEDGSARRGGDLGYNPRGRMVPPFDEAQFGLEVGAISDLVETRFGFHIIKVV. 357
451 2.000e-39UniRef50_A0A1F8ZKC7 Peptidylprolyl isomerase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F8ZKC7_9DELT  ali  37  265..KEVSARHILIKPDAKESD-------RKKAQEDAKKKTEDIFSLARKGE-DFANLAKKYSQDPSAKQGGSLGYFKQGDMVKPFEDAAFSLKKGEISGVIESDYGFHIIKLDD 368
452 2.000e-39UniRef50_A0A2N2DRX6 Peptidylprolyl isomerase n=1 Tax=Firmicutes bacterium HGW-Firmicutes-11 TaxID=2013772 RepID=A0A2N2DRX6_9FIRM  ali  44  175..DEVTASHILV---------------------EDEELAKELIADLKAG-ADFAELAKEHSIDGSAPDGGSLGTFGRGAMVPEFETAAFALEAGEISDVVQSQFGYHIIKVTD 263
453 2.000e-39UniRef50_A0A1Q3C2K4 Peptidyl-prolyl cis-trans isomerase (Fragment) n=3 Tax=Pentapetalae TaxID=1437201 RepID=A0A1Q3C2K4_CEPFO  ali  52  47...QVRASHILIKHQGSRRKASWKDPETNTTRDSAVSQLKAFRDDIVSGKAKFEDIASRYSDCSSAKRGGDLGHFGQGQMQKPFEKATYALKDGEISEIVDTDSGVHIIMRT. 160
454 2.000e-39UniRef50_A0A2E6QAJ9 Peptidylprolyl isomerase n=2 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E6QAJ9_9PROT  ali  45  140...KIRASHILVKS---------------------KKEAEAILADIKAGKK-FADLAKAKSIGPSGARGGDLGEFGRGQMVPAFEKAAFALEKGAVGGPVKTQFGYHIIKVTE 227
455 2.000e-39UniRef50_A0A2S0KUA5 Peptidylprolyl isomerase n=1 Tax=Victivallales bacterium CCUG 44730 TaxID=2094242 RepID=A0A2S0KUA5_9BACT  ali  38  221KPDQIRASHILIAPDGKDDAAD----------KKAQEKAAALLKQLKENPKLFEELAKENSTCPSSARGGSLGAFGKGQMVPEFEKATLALKPGEISEPVKTQFGYHIIRR.. 322
456 2.000e-39UniRef50_A0A1F7U4Q8 Protein translocase subunit SecD n=8 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1F7U4Q8_9BACT  ali  40  285...EVQASHILICFEGAERCEQ------KRTKDQAKALAENLKGRATA--ANFADLAKANSDDGSAASGGDLGWFGRGAMVGPFEDAAYALKDGEISDIVESPFGFHIIR... 384
457 2.000e-39UniRef50_A0A2H5X6Y5 Peptidylprolyl isomerase n=1 Tax=bacterium HR16 TaxID=2035411 RepID=A0A2H5X6Y5_9BACT  ali  37  155....IQARHILIQPQMPTISPDQNVSAEERQKEEAKAKAQKVYEEIKAG-KDFAEAAKEYSDDRSKDKGGDLGAFARGMMVPEFERAAFALKPGEISEPVKTPYGWHIIKVE. 272
458 2.000e-39UniRef50_A0A1Q7QZU4 Peptidylprolyl isomerase n=14 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7QZU4_9BACT  ali  43  274.PARVSAQHILFKTQGKKPEEI----------EAIRQKALQVLERAKKGE-DFASLAKQFSEDTSASNGGDLGSFGRGQMVPEFEQVAFSLSPGAISDLVQTQFGIHIIKVNE 374
459 2.000e-39UniRef50_A0A2N6BC36 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2N6BC36_9DELT  ali  42  150KPERVRASHILVKSDGGEG------------REAALEATEKLKERL--GEESFEDIAKTHSACPSGAKGGDLGWFGRGDMVASFEEAAFSSTVGEVGDIVETPFGFHILKVTD 248
460 2.000e-39UniRef50_C1DAY7 Peptidylprolyl isomerase n=3 Tax=Laribacter hongkongensis TaxID=168471 RepID=C1DAY7_LARHH  ali  33  248..EQRQVAHILIAVPKGASAAD---------KARLKTEAEAIVKEVRSNPARFAALAQEKSADPSAAKGGDLGWFGRGVMVKPFEDSAFKLAKGQVSDPVETEFGYHIIKVE. 349
461 2.000e-39UniRef50_A0A0K1J4P3 Peptidylprolyl isomerase n=5 Tax=Zoogloeaceae TaxID=2008794 RepID=A0A0K1J4P3_9RHOO  ali  35  263QPEERGARHILISAAADASADAVT---------KANEKAAGILKQLRADPKRFAELATAESQDPSASRGGDLGFFGRGAMVKPFEDAVFGLGKGQISEVVRSDFGFHIIEVTD 367
462 2.000e-39UniRef50_A0A173ZCW3 Peptidylprolyl isomerase n=5 Tax=Turicibacter TaxID=191303 RepID=A0A173ZCW3_9FIRM  ali  45  106KEEMIRAAHILV---------------------EEEEQANELLAAI-EGGADFHELASANSKCPSGSRGGDLGDFGRGQMVPEFEQAAFALNIGEISGVVKTQFGYHLIKLLD 196
463 2.000e-39UniRef50_A0A1F9DN93 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RBG_19FT_COMBO_46_9 TaxID=1797851 RepID=A0A1F9DN93_9DELT  ali  33  267...EVRARHIMFSLPSDAPAEQ---------EEKVKEKALSVLEKAR-GGQDFSELAKEYSEDSTKDQGGDLGYFSKGRMIEPFEEAAFNMEKGQISDLVKTTYGYHIIKVED 367
464 2.000e-39UniRef50_A0A1F9G5R5 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RBG_16_71_12 TaxID=1797848 RepID=A0A1F9G5R5_9DELT  ali  39  238QPKKVKARHILVKAADDAPQAD---------KDKAKAKLEEAIKRL-DGGEDFAKVAAAVSEDTSAKDGGDLGWFGPGAMVKPFEDAAFALAKGKRSGVVESRYGYHVIQVDD 340
465 2.000e-39UniRef50_A0A142LJR1 Peptidylprolyl isomerase n=1 Tax=Betaproteobacteria bacterium UKL13-2 TaxID=1690485 RepID=A0A142LJR1_9PROT  ali  37  267..EERKASHILISVXXXXXXXXXXXX---------EAKANQLFAQLQKNPKDFADLAKKNSQDPSAANGGDLGFFGRGMMVPPFDKAAFEGKKDELIGPVQTDFGYHIIRVTD 369
466 2.000e-39UniRef50_L7U0U4 Peptidylprolyl isomerase n=6 Tax=Cystobacterineae TaxID=80811 RepID=L7U0U4_MYXSD  ali  34  176...EVHARHILVSVDPKATEEQV---------AAARKKAEGIAQEARREGMDFSALARARSEGPSAADGGDLGWFKRGVMVAAFEKVAFNLKQGEVSEPVRTNFGWHVLKVEE 276
467 2.000e-39UniRef50_A0A1C5PVD0 Peptidylprolyl isomerase n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1C5PVD0_9CLOT  ali  40  224...KVKASHILIKTTDDDG-----NELSDEEKEKAKLKAEEILKKAKDGE-DFASLAKEYSEDSSATDGGDLGFFKSGDMVEEFEKAAFSLGNGQIYDVVETDYGYHIIIKTD 328
468 2.000e-39UniRef50_A0A1I4HT73 Peptidylprolyl isomerase n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1I4HT73_DESNO  ali  35  266..EQVRARHLLVRVDENADDAAVK---------KAMQTIEAAQKDLAAG-KSFAEVAAKYTEDPSGTQGGELGWFGRGRMVKPFEDAAFALEKGAVSEPVRTQFGFHLISVED 367
469 2.000e-39UniRef50_A0A1Q7K9S1 Peptidylprolyl isomerase (Fragment) n=10 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7K9S1_9BACT  ali  35  202QGDTVHASHILIGLPQNPTPEQ---------KTQAKTKAQAVLKQVRSGG-DFAALARAESQDGSAQNGGDLGFFPKGQMTPAFEEAAFKTKPGAVTAVVETPFGFHIIKVHE 305
470 2.000e-39UniRef50_D0MV79 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Phytophthora infestans (strain T30-4) TaxID=403677 RepID=D0MV79_PHYIT  ali  56  14..EQVRASHLLIKHSGSRRPASRLSDNITRSKEEAIAKLLELRALIVSGQAKFEELATQYSDCNSGTRGGDLGPFGRGMMQKPFEDATFALKVG................... 105
471 2.000e-39UniRef50_A0A031WHW1 Peptidylprolyl isomerase n=53 Tax=Clostridiales TaxID=186802 RepID=A0A031WHW1_CLODI  ali  41  176KKDEVEASHILLKTVDDNNKPLSDXXXXXXXXXXXXX-----LKEVKSGE-DFAKVAKKYSQDTSASDGGKLGFFSRGQMVAEFEDAAFSMKKGEVSDLVETQYGYHIIKVTD 282
472 2.000e-39UniRef50_UPI000DE47812 hypothetical protein n=1 Tax=Vallitalea guaymasensis TaxID=1185412 RepID=UPI000DE47812  ali  36  265..KKVRARHILIKTVDDSN-----QPLSEDKKVEAKKEAEKILVKAKAGE-NFAALAKEYSQDPSKDNGGE-YTFARGEMISEFEEAAFNLKPGEISKVVETGYGYHIIKLEE 369
473 2.000e-39UniRef50_A0A1G0DLF1 Peptidylprolyl isomerase (Fragment) n=2 Tax=root TaxID=1 RepID=A0A1G0DLF1_9PROT  ali  35  144.PEERQAAHILIAVAAAAPQAEQDAAKV---------KAEQLLQQARKNPAGFAELAKQNSQDPSAANGGSLGFFGRGMMVKPFDDAAFTLKQGEISGLVKSDFGYHIIKL.. 245
474 3.000e-39UniRef50_A0A0B0EMV0 Peptidylprolyl isomerase n=1 Tax=Candidatus Scalindua brodae TaxID=237368 RepID=A0A0B0EMV0_9BACT  ali  40  93...KVKASHILI---------DTRNLKTDAEKEEAKKMIEIVKIEIDKG-TDFAKMAKKYSNCPSAENGGDIGFFQRGSIVEEFAQVAFAMKVGEISEPVKTQFGYHIIKVTE 193
475 3.000e-39UniRef50_A0A2N6C4U0 Peptidylprolyl isomerase n=1 Tax=Desulfobulbaceae bacterium TaxID=2053307 RepID=A0A2N6C4U0_9DELT  ali  35  263KPEQRTARHILIKADGTND-------------DESKARAEEILAQLRNG-ADFSELARKFSEDPTAGQGGALGTFSRGQMVPAFDEAVFGLAEGEISDLVKTRFGYHIIEV.. 360
476 3.000e-39UniRef50_UPI000415E7C4 hypothetical protein n=1 Tax=Desulfatirhabdium butyrativorans TaxID=340467 RepID=UPI000415E7C4  ali  31  262KPKTVEARHILFRVEKDTSEADV---------EKAKQKALDVMKQAKAG-KDFAELAKKYSEDPAKANGGYLGAFKKEDMVAPFSEKAFSMKPGEISDPVRTTYGWHIIKVE. 363
477 3.000e-39UniRef50_A0A1F6PSR6 Peptidylprolyl isomerase n=11 Tax=root TaxID=1 RepID=A0A1F6PSR6_9BACT  ali  44  7...QVRASHLLVK-----------------TEEEVKKLREEILA-----GKDFAEVAKEVSMCPSGAKGGDLGYFGRGQMVPEFDKAAFSLPVGEISEPIKTQFGWHLLVVT. 93
478 3.000e-39UniRef50_A0A0K0SVP9 Peptidylprolyl isomerase n=18 Tax=Proteobacteria TaxID=1224 RepID=A0A0K0SVP9_9PROT  ali  39  266..EQRQASHILIGFNSTASXXXXXXXXXXXXX---------ILKQVKANPKSFEKLAIENSQDGSASNGGDLGSFGRGAMVKPFEDAAFSMKVGEISDLVESEFGYHIIKLT. 367
479 3.000e-39UniRef50_S7TWZ3 Peptidylprolyl isomerase n=3 Tax=Desulfobacteraceae TaxID=213119 RepID=S7TWZ3_DESML  ali  32  264..KTVKARHILFRLENDSSPEEVATQ---------RKKAETVLALAREGQ-DFGELAKTYSEDPGKDRGGDLGTFTRETMVKPFADQAFSMKAGEISDPVRTQFGWHIIKVE. 363
480 3.000e-39UniRef50_Q0U3A1 Uncharacterized protein n=1 Tax=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) TaxID=321614 RepID=Q0U3A1_PHANO  ali  52  277..DKIRAAHLLVKHRDSRRPASWREPKITRSKSEAEELIKKYQSQILANPKSLSELATTESDCSSARKGGDLGFFGHGDMQKEFENAAFDLKPGGVSEIVDTASGLHLIQR.. 395
481 3.000e-39UniRef50_A0A1G2XAL1 Peptidylprolyl isomerase n=1 Tax=Planctomycetes bacterium GWB2_41_19 TaxID=1801950 RepID=A0A1G2XAL1_9BACT  ali  45  206...ERRASHVLV---------DTREMKTDAELAQALEKIKKIKAEVDSG-KDFAEVAKQYSDCPSKDKGGDLSFFKRGQMVEPFAAAAFALKVGQVSEPVKTPFGYHIIKVTE 306
482 3.000e-39UniRef50_A0A1V5CIJ7 Peptidylprolyl isomerase n=3 Tax=Syntrophorhabdaceae TaxID=513556 RepID=A0A1V5CIJ7_9DELT  ali  41  188QPEQVRASHILIKAEPGWDAGK---------KGAARKKIEEIRQKIQQ-KQDFESLARTYSEDPSASKGGDLGYIRTGQVLKPFEEALFVLKPGEVSDIVETSLGYHLIKASD 290
483 3.000e-39UniRef50_A0A2M7RLT1 Peptidylprolyl isomerase n=1 Tax=bacterium (Candidatus Howlettbacteria) CG_4_10_14_0_8_um_filter_40_9 TaxID=2014279 RepID=A0A2M7R  ali  41  32.................................DAKKSAEDVLAQIKKGG-DFAALAKKYSQDTSAANGGDLGFFGKGKMVPEFEKAAFALKKGTVSELVKTVYGYHIIQVTD 110
484 3.000e-39UniRef50_D6V0E6 Peptidylprolyl isomerase n=34 Tax=Rhizobiales TaxID=356 RepID=D6V0E6_9BRAD  ali  36  148...EVHARHILVGTE---------------------AEAKEIIAELKKG-ADFAELAKKKSKDPGASDGGDLGYFTKDQMVPEFSAAAFALEPGKISEPVKSQFGWHVIKVED 235
485 3.000e-39UniRef50_A0A2N1VPU6 Peptidylprolyl isomerase n=1 Tax=Ignavibacteriae bacterium HGW-Ignavibacteriae-1 TaxID=2013808 RepID=A0A2N1VPU6_9BACT  ali  37  371..EVVKASHILISFDNN--------------KDSARAEANRILREAKSNPNNFAILAMQYSKDPSGQRGGDLGFFGKGRMVPPFEEAAFAAKVGDIVGPVESDFGFHIIKVDD 468
486 4.000e-39UniRef50_A0A2A2JV67 Uncharacterized protein n=2 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2JV67_9BILA  ali  63  656...EVRCAHILVKHSGSRNPSSWRSDHITRSKEDAINILNGYIEQIKASAKEFQTIAKEFSDCSSAKRGGDLGLFGRRKMQKPFEDASFALDVGEMSPIVDTDSGVHIIWRIE 768
487 4.000e-39UniRef50_A0A1V5J4V1 Foldase protein PrsA n=1 Tax=Firmicutes bacterium ADurb.BinA052 TaxID=1852896 RepID=A0A1V5J4V1_9FIRM  ali  43  152QPEMVKASHILV---------------------EAEDKAKEIQKKLAEG-ADFAELARSESTDPSAAQGGDLGFFARGHMVAEFEKAAFAMSPGQTSAPVKSEYGYHIIRVTE 243
488 4.000e-39UniRef50_A0A1M6H972 Foldase protein PrsA n=11 Tax=Firmicutes TaxID=1239 RepID=A0A1M6H972_9FIRM  ali  40  170QPEQVEASHILVYEE---------------------ETAKEVKRKLDEG-ADFAQLAAEYSKDGNAQYGGELGYFGRGEMVEEFEEAAFSMKVGEISDPVKTKFGYHIIKVTD 261
489 4.000e-39UniRef50_A0A2T5V5W3 Peptidylprolyl isomerase n=1 Tax=Breoghania corrubedonensis TaxID=665038 RepID=A0A2T5V5W3_9RHIZ  ali  37  152.PEEVHARHILVK-----------------TEDEAKAIIKEL-----DTGKDFAELAKEKSTGPSGPNGGDLGYFTKDRMVAEFADAAFDMKPGTYSEPVKTQFGWHVIKVED 242
490 4.000e-39UniRef50_A0A202DPQ8 Uncharacterized protein n=1 Tax=bacterium F16 TaxID=1932694 RepID=A0A202DPQ8_9BACT  ali  40  282...EVRASHILISYKGASR------SQQTRTEAEAKELAEKVLKEVNAKDASFAKLAAQYSDGPSKDNGGDVNFFRRGQMAEPFANAAFKLKRGEISDLVKSDFGYHIIKKT. 385
491 4.000e-39UniRef50_A0A1S2R1Y0 Foldase protein PrsA n=7 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1S2R1Y0_9BACI  ali  36  138QPE-IKARHILVNDE---------------------KTAKEIKKQLDAG-AKFEDLAKKYSQDPSAQNGGDLGWFGTGKMDPAFEKAAYALKVNEISDPVKSQFGYHIIQVTD 228
492 4.000e-39UniRef50_A0A2D9F432 Peptidylprolyl isomerase n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2D9F432_9PROT  ali  39  143...EIHARHILLK-----------------TEDEAKAVIKDL-----AGGADFAETAKKKSTGPSGPNGGDLGYFGQGQMVPEFEKAAFALDKGGMTDPVKTQFGWHVIKVED 231
493 4.000e-39UniRef50_A0A1V5H0B4 Peptidylprolyl isomerase n=1 Tax=Lentisphaerae bacterium ADurb.BinA184 TaxID=1852901 RepID=A0A1V5H0B4_9BACT  ali  39  184..EQVKASHILVRVKEDAKDDE---------KAAARTKAEGIRDRIVKG-ADFAAVARAESEDGSGFQGGDLGFFGRGKMVKPFEDAAFALEKEALSELVETPFGLHIIKVTD 285
494 4.000e-39UniRef50_S6BYR4 Peptidylprolyl isomerase n=1 Tax=endosymbiont of unidentified scaly snail isolate Monju TaxID=1248727 RepID=S6BYR4_9GAMM  ali  39  267...ERRVRHILIPVEGD--------------EDKARQQAEQLVEQLRQG-ADFAALAKEHSKDPSAADGGDLGWVNRGVMVKPFEDAVFAAKPGEITGPVKTEFGYHIIEVTD 362
495 4.000e-39UniRef50_A0A069RB34 Peptidylprolyl isomerase n=8 Tax=Peptostreptococcaceae TaxID=186804 RepID=A0A069RB34_PEPLI  ali  35  180...QVKASHILIKTVDGS-----LNPLAEEEIAKKKEIAQDILKKAKDGE-DFAQLAKDYSEDGSAPNGGDLGFFKKGVMVPEFENAAFGLEKGQMSELVQSQFGYHIIKVYD 284
496 4.000e-39UniRef50_A0A1Z4VRL0 Peptidylprolyl isomerase n=1 Tax=Thiohalobacter thiocyanaticus TaxID=585455 RepID=A0A1Z4VRL0_9GAMM  ali  36  266..EQLRARHILIELPEDAGAAAEAAARDRARA---------IRQQLQEG-ADFAELARAESDDPSAAQGGDLGFFSRGFMVPEFETAAFALEPGQISEPVRTPFGFHVIEVTD 367
497 5.000e-39UniRef50_G1M101 Peptidyl-prolyl cis-trans isomerase n=29 Tax=Euteleostomi TaxID=117571 RepID=G1M101_AILME  ali  98  51EPTRVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGE.................. 145
498 5.000e-39UniRef50_A0A1F5YIH5 Peptidylprolyl isomerase n=1 Tax=Candidatus Gottesmanbacteria bacterium RBG_13_37_7 TaxID=1798369 RepID=A0A1F5YIH5_9BACT  ali  40  224.PEQIRISHILIKFN-----IPSGGTITDQIKTEALKKITEVNQKLKNGQ-DFAELAKANSEDTSAVNSGDIGYISKGQTVPEFENVAFSLKVGEVSGIVETGYGYHIIKVTD 330
499 5.000e-39UniRef50_W4QG99 Foldase protein PrsA n=8 Tax=Bacillus TaxID=55087 RepID=W4QG99_9BACI  ali  46  163..EQVEASHILV---------------------EDEETAEEVLEKLEEGE-DFAELAMEYSMDGSAAMGGDLGYFGRGQMVEPFDEAAFALEVGEISDIVESEFGYHIIMKT. 250
500 5.000e-39UniRef50_A0A1V5PZ31 Peptidylprolyl isomerase n=1 Tax=Actinobacteria bacterium ADurb.Bin346 TaxID=1852788 RepID=A0A1V5PZ31_9ACTN  ali  40  243.PEQVKVSHILIKFN-----IPEGQELNDAIKAEAKEKILSIQKQLKDG-ADFAELAKKYSDDASAPNGGDIGFISRGQTVPEFEKAAFDLGVGQVSDIAETTFGYHIIKCVE 349
501 5.000e-39UniRef50_Q2J2S0 Peptidylprolyl isomerase n=16 Tax=Rhizobiales TaxID=356 RepID=Q2J2S0_RHOP2  ali  37  151...EVHARHILV-----------------ETEDEAKAIAEELKK-----GADFAELAKKKSKDPGASDGGDLGFFTKDQMVPEFSAVAFALEPGKISDPVKSQFGWHIIKVEE 238
502 5.000e-39UniRef50_A0A2H6ID22 Peptidylprolyl isomerase n=1 Tax=bacterium BMS3Bbin07 TaxID=2005730 RepID=A0A2H6ID22_9BACT  ali  45  139..DRARASHILVST---------------------KEEADSLLKKLKAGE-DFAALAKKNSIDGSAAKGGDLGFFGRGQMVPEFEKTVFSMKKGEISEPVKTQFGYHIIKLTD 228
503 5.000e-39UniRef50_A0A246H736 Peptidylprolyl isomerase n=5 Tax=Burkholderiales TaxID=80840 RepID=A0A246H736_9BURK  ali  38  266..EERRASHILIKAGSDMSXXXXXXXXXXXX---------ELLAEARKNPAGFGELAKKNSEDPSAANGGDLDFFGKGAMVKPFEDAVYALKKGEISNVVQSDFGYHIIMLTD 368
504 5.000e-39UniRef50_A0A1W9QDX1 Uncharacterized protein n=1 Tax=Sorangiineae bacterium NIC37A_2 TaxID=1970199 RepID=A0A1W9QDX1_9DELT  ali  40  52.PAEIGARHILISYKG----ASSASPFTERNKSEAREFAEELLDRILNGE-DLGKLAEEFSDDGSAQDGGALGIFKRTDMVKPFADAAFSLEVGEVSDIVESPFGFHIIERTD 159
505 5.000e-39UniRef50_G0VDW3 Peptidyl-prolyl cis-trans isomerase n=31 Tax=Opisthokonta TaxID=33154 RepID=G0VDW3_NAUCC  ali  61  55.PVRVRCLHILIKHKDSRRPASHRSEHITISXXXXXXXXXXXXXXXXXXXXSFESLAKERSDCSSYKRGGDLGWFGRGEMQPSFEEAAFALKVGEVSGIVESDSGVHLIKR.. 165
506 6.000e-39UniRef50_S6B4S1 Peptidylprolyl isomerase n=6 Tax=Proteobacteria TaxID=1224 RepID=S6B4S1_9PROT  ali  43  266.PEQRRASHILI---------------------AERTQAEQILKELKQNPAKFEDLARQYSKDPSAVKGGDLGYFARGAMVKPFEDAAFGMKGGEISGLVQSDFGFHIIKLT. 356
507 6.000e-39UniRef50_A0A1E3YEW2 Peptidylprolyl isomerase n=1 Tax=Acidobacteria bacterium SCN 69-37 TaxID=1660160 RepID=A0A1E3YEW2_9BACT  ali  37  274.PEQTRASHILFATQGKDP-------------AEVRKLAEEVLVRVKKGE-DFAALAKQYSDDGSKELGGDLNFFARGTMVPAFDEAVWALQPGQTTDLVQTEFGFHIIRVTD 372
508 6.000e-39UniRef50_D9SGJ2 Peptidylprolyl isomerase n=20 Tax=root TaxID=1 RepID=D9SGJ2_GALCS  ali  35  264..EQRQASHILLVVAATAPQAE---------QDAVKAKAEKLLAQVKQEPGKFADLARQNSQDPSAVNGGDLGMFGRGMMVKPFDEAVFSLKAGEISGLVKSDFGYHIIKLT. 365
509 6.000e-39UniRef50_A0A2L2X399 Peptidylprolyl isomerase n=1 Tax=Candidatus Gastranaerophilus sp. (ex Termes propinquus) TaxID=2029980 RepID=A0A2L2X399_9BACT  ali  41  65..DSVKASHILV---------------------DSKEKADELKARAAAGE-SFDDLAKEFSKCPSKERGGDLGYFGKGQMVPEFEQAAFATGVGEVSEPVQTQFGWHLIKVAD 153
510 6.000e-39UniRef50_A0A192IGX6 Peptidylprolyl isomerase n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A192IGX6_9RHIZ  ali  42  150....VHARHILLK-----------------TEDEARAVMKEL-----EGGADFAELAMQKSTGPSGPQGGDLGFFQKGQMVPEFEAAAFAMEPGEVSEPVKTQFGWHVIKVED 237
511 6.000e-39UniRef50_A0A2N6E5S2 Peptidylprolyl isomerase n=4 Tax=Desulfuromonadales TaxID=69541 RepID=A0A2N6E5S2_9DELT  ali  39  270.PEQVKASHVLIKVAKDADQD---------SRAKKRALAEKVLEEARSG-KDFAELADTYSDDGSAAKGGELGFFTRGTMVAPFEQAAFALKPGDISGIVESSFGFHIIK... 369
512 7.000e-39UniRef50_A0A1F7REQ9 Peptidylprolyl isomerase n=3 Tax=Candidatus Schekmanbacteria TaxID=1817811 RepID=A0A1F7REQ9_9BACT  ali  38  149EPEKVKARHILIKVDQNARDEDKKKAEEKA---------KGILARVKKSE-DFAKLAKELSEDGSKENGGDLGFFARGRMAKDFEEVAFKLKPGEISDLVKTRYGYHIIKTEE 252
513 7.000e-39UniRef50_A0A1M4Z4U6 Foldase protein PrsA n=1 Tax=Caldanaerobius fijiensis DSM 17918 TaxID=1121256 RepID=A0A1M4Z4U6_9THEO  ali  43  183KPDTVTASHILVNDE---------------------KTAEEVEQKLKKG-ADFAQLAKEYSIDATKDNGGDLGTFTYGQMDPDFEKAAFALKPGEISQPVKTKFGYHIIKVTD 274
514 7.000e-39UniRef50_D7N4U3 Peptidylprolyl isomerase n=1 Tax=Neisseria sp. oral taxon 014 str. F0314 TaxID=641149 RepID=D7N4U3_9NEIS  ali  42  164...QYKAQHILLKADSDNAVS------------AAESSIRKIYAQARSG-TDFSALARQYSQDTSAGNGGDLGWFSDGQMVAPFEDAVHKLKPGQVSPPVRTQFGWHIIKLNE 260
515 7.000e-39UniRef50_A0A0A1H2P6 Peptidylprolyl isomerase n=2 Tax=unclassified Burkholderiales (miscellaneous) TaxID=80841 RepID=A0A0A1H2P6_9BURK  ali  37  298...QVRASHILIAVRPGASAAE---------KDKAHRLAEKVLQAVRAHPGEFAALARKYSQDPSAAKGGDLGWFGHGVMPKPFEAVAFSLKDGETSGIVETPFGYHLIRVT. 398
516 7.000e-39UniRef50_S0FW70 Peptidylprolyl isomerase n=3 Tax=Desulfobacteraceae TaxID=213119 RepID=S0FW70_9DELT  ali  33  263.PEQVEASHILIQVDETADETAV---------ETAKNQAMAVYERAVKGE-DFAELAKETSQGPSKEDGGYLGKFDRNSMIPSFSEAAFAMQPGEISEPVKTRFGWHVIKVMD 364
517 7.000e-39UniRef50_A0A085MDF1 Uncharacterized protein n=3 Tax=Trichuris TaxID=36086 RepID=A0A085MDF1_9BILA  ali  62  69EPSRIKCSHILVKHKNSRRPSSWRQSVITRSKEDAINLIKNFREEIKAGRARFSDIAETQSDCSSAKECGDLGYFSRGQMQKQFEDAAFSLSVGELSGP.............. 167
518 8.000e-39UniRef50_A0A1H0UW88 Foldase protein PrsA n=1 Tax=Bacillus salsus TaxID=930152 RepID=A0A1H0UW88_9BACI  ali  42  123..EIVKASHILV---------------------EDEATAKEVLAKLEEG-KTFEELAAEYSSDGSAAQGGELGWFPKGQMVPEFEEAAFTLGKGEVSEPVKSQFGYHIIKVTE 211
519 8.000e-39UniRef50_A0A2H0V2U0 Protein translocase subunit SecD n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0V2U0_9BACT  ali  41  249...EVRASHILVCYEGSERCTSGY------TKEDARNRIDDIKNQAT--PDNFAELAKQNSIDASSSDGGDLGWFTREMMVKPFADAVFNLEKGKISDVVETQFGFHLIYKTD 350
520 8.000e-39UniRef50_A0A2E2MJW6 Peptidylprolyl isomerase n=3 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A2E2MJW6_9PROT  ali  40  214...EVHARHILLK-----------------TEDEAKAVIKDL-----AGGADFADTAKKKSTGPSGPNGGDLGYFGKGQMVPEFEQAAFALDKGAMTQPVKTQFGWHVIKVED 302
521 8.000e-39UniRef50_A0A0N1P7D7 Peptidylprolyl isomerase n=36 Tax=Clostridiales TaxID=186802 RepID=A0A0N1P7D7_CLODI  ali  41  112KPESATAKHILVDSD---------------------EKAKEILAQIKSEEISFEDAAVKHSSCPSKDMGGDLGTFGRGQMVPEFEEAVFSMAKGEVSEPVKTQFGYHIIKLED 203
522 8.000e-39UniRef50_Q029S0 Peptidylprolyl isomerase n=1 Tax=Solibacter usitatus (strain Ellin6076) TaxID=234267 RepID=Q029S0_SOLUE  ali  38  164...QVRARHILIRTPGSSLPLEPGQKEL--TDAEALTKAQELRAKIVAG-ADFADVAKIESNDISTNKGGDLGFFKRGQMAPSIEEAAFALKPGEISQPVKTSMGYTVIKVEE 271
523 8.000e-39UniRef50_A0A1F5P0R5 Peptidylprolyl isomerase (Fragment) n=1 Tax=Candidatus Delongbacteria bacterium GWF2_40_14 TaxID=1817817 RepID=A0A1F5P0R5_9BACT :  ali  40  139..EEVRASHILFG-------------------EADKDIALEIHELLLNGE-DFSEHAKTHSQCPSGQNGGDLGFFDRGKMVPEFEQAAFEMETGEISDLVQTQFGYHIIKLTD 229
524 8.000e-39UniRef50_A0A2E2VNX1 Peptidylprolyl isomerase n=1 Tax=Kangiellaceae bacterium TaxID=2026751 RepID=A0A2E2VNX1_9GAMM  ali  41  268QAEQRKARHILIASNDD--------------EAAAEQKAQEILAKLESGE-DFSELAKANSDDPSGKKGGDLGWFGRGAMVKPFEDAVFGMKPGERSGLVKTNYGYHIIELSE 367
525 8.000e-39UniRef50_A0A0D2MWY8 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 n=1 Tax=Monoraphidium neglectum TaxID=145388 RepID=A0A0D2MWY8_9CHLO  ali  58  384....VRASHLLVKHRNVRRPSSWKEPTVTRTPEEALRMIEAFRVQLVSGDPSFADLASSESHCSSAKRGGDLGHFGRGQMQAAFEGPAFSLAVGELSGPVSSDSGVHLILRT. 498
526 9.000e-39UniRef50_A0A2H0YDU4 Peptidylprolyl isomerase n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A2H0YDU4_9BACT  ali  37  261QPAKVHARHILIRVPDDAG---------KETEKASREKLISILKEARDG-ADFAGLAMKYSEDSTASRGGDLGFFGPGEMAANFERAAFALKPGEISPVVRTPFGFHII.... 359
527 9.000e-39UniRef50_A0A1I2N3V0 Peptidylprolyl isomerase n=4 Tax=Clostridium TaxID=1485 RepID=A0A1I2N3V0_9CLOT  ali  41  112EQEQVRAKHILV-----------------ENEEEAQKVAKEI-----NEGLSFEDAALKYSSCPSNAQGGDLGFFTRGRMVPEFEEAAFALELGKVSEPVKTQFGYHLIKVEE 202
528 9.000e-39UniRef50_K3WE84 Peptidyl-prolyl cis-trans isomerase n=17 Tax=Oomycetes TaxID=4762 RepID=K3WE84_PYTUL  ali  56  75..ESVQALHILVKHSGSRRPSSWRQESITRNKAVAIAKMEGIRDKLVACVKEFEQIAKEESDCSSAKRGGDLGRFTRGKMTPPFEAASFALKVGELSDLVESDSGIHVILRV. 195
529 9.000e-39UniRef50_A0A1G2Y4D7 Peptidylprolyl isomerase n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G2Y4D7_9BACT  ali  34  230EPEKIHAKHILIKAEDSNDPNQAKAAAKAKA--------EDLLKKIKEG-ADFDELAKEHSACPSGKNGGDLGEQPKGTFVPAFEKAAYALEPNQVSDVVETEFGYHIIKLV. 332
530 9.000e-39UniRef50_A0A1V5YHE7 Peptidylprolyl isomerase n=1 Tax=Chloroflexi bacterium ADurb.Bin180 TaxID=1852857 RepID=A0A1V5YHE7_9CHLR  ali  41  200EVEQVNARHILV---------------------DSEEKGQEVLKKLKEG-ATFADLAKEYSTDGSASSGGDLGWFPRGMMVTEFEEAAFTLPIGETSGLIKTDFGYHIIQVVD 291
531 1.000e-38UniRef50_E3I5R0 Peptidylprolyl isomerase n=3 Tax=Rhodomicrobium TaxID=1068 RepID=E3I5R0_RHOVT  ali  43  127KPEEVRARHILVKT---------------------KEEAADLVKQLK-GGADFNELAKKSADGPSANTGGDLGYFSKGQMVKVFEDTAFALQPGQISDPVQSEFGWHVIKVED 218
532 1.000e-38UniRef50_A0A2N2HKW3 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-19 TaxID=2013746 RepID=A0A2N2HKW3_9DELT :_  ali  35  256.PESVRARHILIAKATGDDEKVKAEKKAKAE---------DVRKQLLAGG-NFMELAKKYSECPSKEHGGDLGEFPRGQMVKPFDQAAFSQKVNEIGPVVETDFGYHIIQVQE 357
533 1.000e-38UniRef50_A0A1Q7RRC8 Peptidylprolyl isomerase n=7 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7RRC8_9BACT  ali  33  270..EQRCAAHILFKVGDQAAPDVA---------AKTETKARAILKRARTGE-DFAALARKYSEDSTAANGGDLGCFPRGQMVKEFEESAFTLPVGSISDLVRSRFGFHIIKVKD 370
534 1.000e-38UniRef50_A0A1F9M8C1 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11 TaxID=1797896 RepID=A0A1F9M8C1_9DELT  ali  31  139EFQEIRASHILLKNRPQKDDAATGKP--EEYQQAQRAKAEKILAELKAG-KDFAQLAQEHSEDTTAKNGGDLSFFTAKKMVEPFAEAAFALKIGDLSDLVETRFGFHIIKLTD 249
535 1.000e-38UniRef50_UPI0005A8854C peptidylprolyl isomerase n=1 Tax=Capnocytophaga canimorsus TaxID=28188 RepID=UPI0005A8854C  ali  40  350....VEASHILIAYQGS----QAANPNTSLTKEQAKAKAEELLAKAKVKDADFAALARENSDDPSASRGGDLGFFQRGMMVKPFENFAFSNPIGYM-GVVETDFGFHVIKIT. 453
536 1.000e-38UniRef50_UPI0008984D2C hypothetical protein n=1 Tax=Marinobacterium georgiense TaxID=48076 RepID=UPI0008984D2C  ali  41  133KPEQVQARHILLTFKDEA------------EKQEKMALLESIRERIASGETEFDKLAVEYSEDGSVAKGGDLGTFARGRMVKPFEDAVFALEPGELSGIVETRFGLHLIQL.. 233
537 1.000e-38UniRef50_J1KEP6 Peptidylprolyl isomerase n=3 Tax=Bartonella TaxID=773 RepID=J1KEP6_BARTA  ali  41  156KEDEVKARHILVKT---------------------RKEAEAVIKRLNKGE-SFEEIAKKSSTDGSAAVGGDLGYFSHGQMVKPFEDAAFGLKVGETTKPVESPFGWHVIKVED 247
538 1.000e-38UniRef50_A0A1F6UHL1 Peptidylprolyl isomerase (Fragment) n=1 Tax=Candidatus Muproteobacteria bacterium RBG_19FT_COMBO_61_10 TaxID=1817761 RepID=A0A1F6  ali  41  265.PEQRKASHILIRVSDKDGPDADK---------KALQKAQALRQQLASG-ADFAVLAKKSSDDPSAVKGGDLGFVTRGSMVKPFEDALFGLKQGELSQPIRTSFGYHLIRLVE 368
539 1.000e-38UniRef50_A0A2E2TY73 Peptidylprolyl isomerase n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E2TY73_9GAMM  ali  43  261....VRASHILVSMNPNASDTE---------EEIAKKALDEIYEKLSSGER-FEQLAIEYSDDISAREGGDLDWFGKGQMIESFENAAFKLKVGEISDPVRSDYGYHIIKVTD 360
540 1.000e-38UniRef50_UPI000D3B303F peptidylprolyl isomerase n=1 Tax=Mangrovicoccus ximenensis TaxID=1911570 RepID=UPI000D3B303F  ali  43  141...EYHAAHILV-----------------ETEEEAREIIDEL-----NGGADFAELAQKRSTGPSGPNGGDLGWFGAGMMVPEFEQAVMALETGAISEPVQTQFGWHVIKLEE 228
541 1.000e-38UniRef50_A0A1W9TDW6 Peptidylprolyl isomerase n=2 Tax=Desulfobacterales TaxID=213118 RepID=A0A1W9TDW6_9DELT  ali  44  183..EQVKASHILIKCDPKAEASV---------KDEAKRKIKDIQKKLADGE-SFSELAKQFSECPSKNQSGDLGFFEREKMVKPFADAAFALQTDAISDIVETDFGFHLIKITD 283
542 1.000e-38UniRef50_R9AGT6 Peptidyl-prolyl cis-trans isomerase n=20 Tax=Basidiomycota TaxID=5204 RepID=R9AGT6_WALI9  ali  55  57.PQKVRASHLLIKHNKSRRPSSWKEANITRSKEEALAQLRELLSQYHAHEAVFSKLAHEHSDCSSHAKGGDLGRFSRGQMQKPFEDASFNIGVLQLSDIIDTDSGVHLILRLE 173
543 1.000e-38UniRef50_A0A2N5NDU6 Foldase protein PrsA n=4 Tax=Paenibacillus TaxID=44249 RepID=A0A2N5NDU6_9BACL  ali  38  263.PEQVQASHILVAT---------------------KEEADAIEKQLKNGG-DFAAIAKEKSTDGSAANGGDLGFFGKGSMVPEFEEAAFGMKIGEISAPIKSDYGYHIIKLVD 353
544 1.000e-38UniRef50_A0A1B9F7N2 Peptidylprolyl isomerase n=1 Tax=Dissulfuribacter thermophilus TaxID=1156395 RepID=A0A1B9F7N2_9DELT  ali  32  138QREQVKARHILVKVPAGANEDAWKKAKKKALDIKARA----------EKGEDFAKLAKEFSDDPTKDRGGELGYFGKGRMVPEFEKVAFSLEPGVISDPVKTIFGWHLIQVED 241
545 1.000e-38UniRef50_A0A2H6JRX9 Peptidylprolyl isomerase n=1 Tax=bacterium BMS3Bbin14 TaxID=2005737 RepID=A0A2H6JRX9_9BACT  ali  33  264.PEQRHALHIFFKVSKKDS---------NQVREAEKKKAEAVLKLVR-GGMDFAAAARKYSEGPTAATGGDLGFFSRGRMVKSFDDVVFSLKPGEISGVVESPFGYHIIKLV. 364
546 1.000e-38UniRef50_UPI00047DB5E2 hypothetical protein n=1 Tax=Bacillus bogoriensis TaxID=246272 RepID=UPI00047DB5E2  ali  43  152QYTEVEARHILV---------------------EDMETANEVLDKLNEGE-DFADLAKEYSNDGSADQGGDLGTFGKGAMVPEFEGAAFALEPGEISDPVESQFGFHIINVTD 243
547 1.000e-38UniRef50_F0VGX1 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Neospora caninum (strain Liverpool) TaxID=572307 RepID=F0VGX1_NEOCL  ali  53  6.PDQVRCLHLLIKHNQSRNPISRRNQAVTKSKEQAHADLSALQSSVCQ--ENFAQLANQYSDCGSFQKGGDLGFFTRGMMQKPFEDASFALQVGEISDIVDTDSGLHLIYR.. 114
548 1.000e-38UniRef50_A0A1I3J2D0 Foldase protein PrsA n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A1I3J2D0_9BACL  ali  45  233QPEEVKASHILV-----------------ATKEEADAIIKQL-----EGGADFAALAKEKSTDGSKDNGGDLGFFGKGAMDPAFEKAAFALKVGEMTEPVKSQYGYHIIKVTD 325
549 1.000e-38UniRef50_A0A2G6FZD3 Peptidylprolyl isomerase n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2G6FZD3_9FIRM  ali  39  112EPAKVKASHILVPDE---------------------AKMAEVKAALDGGEA-FEAVAKAHSTCPSKERGGDLGFFGKGQMVPEFEQVAFAMNVGDVSEPVKTQFGYHVIKLDD 202
550 1.000e-38UniRef50_A0A059KLV0 Peptidylprolyl isomerase n=1 Tax=Sphaerotilus natans subsp. natans DSM 6575 TaxID=1286631 RepID=A0A059KLV0_9BURK  ali  33  265QAQERRARHILIKAEAGSPADAKAAARRKAEA---------LLAEVKKSPASFAEVAKKNSEDPSAPNGGDLDWFPRGAMVKPFEDTVFVMKKGEISGIVETDFGFHIIELTD 369
551 1.000e-38UniRef50_A0A1C6MZF9 Peptidylprolyl isomerase n=6 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1C6MZF9_9NEIS  ali  30  247..EQRDVSHILLAVNKGASAAD---------KAKVKAEAEAILKEVRANPAKFAELAKAKSQDPSAANGGDLGFFARGAMAKPFEDVAFRMQKGQISEVVETEFGYHILKLND 349
552 1.000e-38UniRef50_A0A1H0K451 Peptidylprolyl isomerase n=3 Tax=Desulfobacterales TaxID=213118 RepID=A0A1H0K451_9DELT  ali  32  266..EQRRARHIIFQAGPDDSKQVH---------QEKKQEAEAILKRAKDGE-DFAELAAGFSEGPSRQTGGDLGFFTKESMVPPFSDAVFSLAPGQISDVVKTQFGYHVIKLEE 366
553 1.000e-38UniRef50_A0A2M7G5A9 Peptidylprolyl isomerase n=1 Tax=bacterium (Candidatus Blackallbacteria) CG17_big_fil_post_rev_8_21_14_2_50_48_46 TaxID=2014261 R  ali  41  190EPEKIKAQHILIKAEEGKKDE----------EAKALKKAEGILAQLKAGG-DFAKLAKANSDDTSKDNGGDLGAFGKGMMVLPFEEAAWKLKEGELSGPVKTRFGYHIIKR.. 290
554 1.000e-38UniRef50_A0A2U0TDQ8 Peptidylprolyl isomerase n=6 Tax=Devosia TaxID=46913 RepID=A0A2U0TDQ8_9RHIZ  ali  44  147..EEVRASHILV---------------------ESEEEANSLKAEL-DGGADFATLAREHSIDPGAANGGDLGFFGRGMMVQPFEEAAFALDEGAISAPVQSQFGWHIIRLDE 235
555 1.000e-38UniRef50_A0A1F6QB12 Peptidylprolyl isomerase n=2 Tax=unclassified Candidatus Margulisbacteria TaxID=2211321 RepID=A0A1F6QB12_9BACT  ali  38  184..KEVKARHILIKFPEVKDATSIKEKEAAT--EVARKNAEDLLARAKTGE-DFAKLASEYSSDSSSKAGGDLGWFGVGMMVPEFEAAAFSLAPGEITGPVKTQFGFHIIKVDD 291
556 1.000e-38UniRef50_A0A2D6JHG1 Peptidylprolyl isomerase n=1 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2D6JHG1_9PROT  ali  36  236..EQVKARHILLKTE----------AKSAADKQALLKEMQEIKKTLT--PENFASVAKEKSEDPSARNGGDLGYFGKGQMVPAFEKVAFANGVGQISDIVETDFGYHIILVED 335
557 1.000e-38UniRef50_A0A2S9YWA8 Peptidylprolyl isomerase n=18 Tax=cellular organisms TaxID=131567 RepID=A0A2S9YWA8_9DELT  ali  47  4....VRASHILLMYKGSSXXXXXXXXXXXXXXXXX-------XXXXLDAGSDFAGLAREHSDCPSSAKGGDLGQFGRGQMVPAFEQAAFSMEVGGISGVVETDFGYHLITRT. 104
558 1.000e-38UniRef50_UPI000A02B6C5 hypothetical protein n=1 Tax=Desulfocurvus vexinensis TaxID=399548 RepID=UPI000A02B6C5  ali  35  266..ESVRARHILLELPADAPGAQA---------DKARVELLKLKARLAKGE-SFATLAEKHSDCPSSARGGDLGWFTRQAMVAPFAEAAFALEPGAVSDPVRTEFGWHLIKVEE 366
559 1.000e-38UniRef50_A0A238F548 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Microbotryum intermedium TaxID=269621 RepID=A0A238F548_9BASI  ali  63  137.PTKVRASHLLIKSEKSRRPSSWRQLHITRTXXXXXXXXXXXXXXXXXXPKQFARVAKAESDCSSAREGGDLGFFGRQQMQKPFEEAAFALKVGEMSPIIQTDSGLHLILRT. 250
560 1.000e-38UniRef50_K7EN45 Peptidyl-prolyl cis-trans isomerase (Fragment) n=10 Tax=Eukaryota TaxID=2759 RepID=K7EN45_HUMAN  ali  100  2........................QEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE 90
561 1.000e-38UniRef50_A9V341 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9V341_MONBE  ali  63  65.PSKVRASHILAKHRDSRRPSSWRQNTITRTKAEAIEIIKRHREAIAQG-ADFAKIAETESDCSSAKRGGDLGAFGRGQMQPCFEKAAFALKVGELSDLVDTDSGIHIILRTE 198
562 2.000e-38UniRef50_A0A263BWN6 Foldase protein PrsA n=1 Tax=Bacillus sp. SA5d-4 TaxID=1904753 RepID=A0A263BWN6_9BACI  ali  41  142KREEVRASHILV---------------------EDEEQAKEILAQINNG-ADFAALAEEHSIDGSAVKGGDLDFFTRGKMVPEFEKEAFTLEVGEVSDLVKTQFGYHIIKVTD 233
563 2.000e-38UniRef50_A0A2E7VGT5 Peptidylprolyl isomerase n=1 Tax=Opitutales bacterium TaxID=2026772 RepID=A0A2E7VGT5_9BACT  ali  42  535.PKEVSASHLLINYKGSARA----KPSITRTKAEAKALTEKLRKQIVDEGKDFAQVARDNSDGPSAPRGGDLGNFTFETMAKPFSEAAFALDVGGVSAVVETEFGFHVIKRT. 641
564 2.000e-38UniRef50_A0A0B5BFN5 Peptidylprolyl isomerase n=5 Tax=Desulfuromonadales TaxID=69541 RepID=A0A0B5BFN5_9DELT  ali  43  192QPETVRASHILVGADAKATXXXXXXXXXXXXXXXXXXXXX----------ADFAETAKKESSCPSSAQGGDLGVFGKGQMVPEFEKSAFSLKPGETSGVVETQFGYHIIKLAE 294
565 2.000e-38UniRef50_A0A1F6S5V5 Peptidylprolyl isomerase n=3 Tax=root TaxID=1 RepID=A0A1F6S5V5_9BACT  ali  41  76QYKEVRASHILV-----------------GTKQEALKLRKEILEN-KDFAKSFAKAAKETSKCPSGAQGGDLGYFEKGMMVPEFEKTAFDLPIGEISEPVKTEFGWHLIITTD 170
566 2.000e-38UniRef50_A0A149VYL5 Peptidylprolyl isomerase n=1 Tax=Ferrovum sp. Z-31 TaxID=1789004 RepID=A0A149VYL5_9PROT  ali  35  267..EMRRARHILLTIPNGASPAQ---------RQSIKQHAQQLLVRLQAHPEQFAAVAKVESQDPSASQGGDLGFFARGTMTPPFEKAVFALNKGEFSGPVETDFGYHVIQVTD 369
567 2.000e-38UniRef50_A0A2G6MB96 Peptidylprolyl isomerase n=1 Tax=Desulfobulbus propionicus TaxID=894 RepID=A0A2G6MB96_9DELT  ali  32  263QAEERRARHILFRVEQGAEEAV---------RAAQEAKAKEVLALFKANG-DFAALATEYSEGPTKTNGGDLGFFPQGKMVQEFDDAVFAAAVGEVIGPVKTAFGYHLILVEE 365
568 2.000e-38UniRef50_A0A2C6KKF4 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Cystoisospora suis TaxID=483139 RepID=A0A2C6KKF4_9APIC  ali  48  23..EHVRCRHLLIKHNESRNPVSRRTNPITKTRAEAWREIHQLHRSLTT--VNFASFAQKYSDCGSYQKGGDLGRFTRGMMQRSFEDTAFRLEVGEISNVVETDSGFHIIVRVE 132
569 2.000e-38UniRef50_A0A1Z5KQ06 Peptidyl-prolyl cis-trans isomerase n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5KQ06_FISSO  ali  56  104.PQKVRTLHILRKHKDSRRPSSWRMPTITITKEEALEEMKGFQEILLESASDFEEIAKTESDCSSAKRGGDLGFFGPKKMTPEFEKASFALQIGEMSNIVETNSGFHIILR.. 220
570 2.000e-38UniRef50_A0A0J5GKL3 Peptidylprolyl isomerase n=3 Tax=Chromobacteriaceae TaxID=1499392 RepID=A0A0J5GKL3_9NEIS  ali  36  247..EERRVSHILLTVDAAAKPEAKAAVKA---------QAEALLQQLKTNPAGFAALAKARSQDPSAEQGGDLGFFGRGAMVKPFEEAAFALQPGQISAVVETEFGFHILKLDE 349
571 2.000e-38UniRef50_A0A1F9E7Q9 Peptidylprolyl isomerase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9E7Q9_9DELT  ali  37  127...EIRASHILFKLEANADAKKEEEIKKK---------AQEILDKIKKGE-DFTELAKKYSEGPSAKNGGDLDFFTRDSMVPEFSEVAFKLKVGDVSDLVRTKYGYHIIKLT. 226
572 2.000e-38UniRef50_A0A2H5XVE0 Peptidylprolyl isomerase n=1 Tax=bacterium HR20 TaxID=2035415 RepID=A0A2H5XVE0_9BACT  ali  41  371....VRASHILIGFGNN--------------KDSARKVAEQVLARVR-GGEDFAKVAQEVSEDGSASRGGDLDYFTRGRMVKPFEDAAFAAAVGSIVGPVESQFGYHIIKVTD 465
573 2.000e-38UniRef50_A0A1V4XWL9 Peptidylprolyl isomerase n=5 Tax=Syntrophus TaxID=1671858 RepID=A0A1V4XWL9_9DELT  ali  35  214.PESMHVRHILIALTPEDND---------KTVAEKKAKAENLRKQIISG-SDFTELAKNNSDCPSKNSGGDLGIIKRGDMVKPFEDAVFALKKNQIGPVVQTEFGFHVVQVLD 315
574 2.000e-38UniRef50_A0A1G0RLS8 Peptidylprolyl isomerase n=1 Tax=Ignavibacteria bacterium GWF2_33_9 TaxID=1798430 RepID=A0A1G0RLS8_9BACT  ali  38  371....VKASHILIKFNDN--------------QDSAFAVAQSLLARAKSG-SDFAELAREYSEDGSGTQGGDVGYFGKGQMVQPFEEACFAAKIGDIVGPVESQFGYHIIKLTD 465
575 2.000e-38UniRef50_A0A2S9XVQ2 Peptidylprolyl isomerase n=6 Tax=Myxococcales TaxID=29 RepID=A0A2S9XVQ2_9DELT  ali  37  198..ERVRAAHILVRVGPEERPTEPDEAQKKQWEAEALAKANELYAKATAEGADFDQLAIDASEGPSARKGGDLGIFSADRMVDEFSDAAFSLEPGEISKPIKTKFGFHIIKV.. 312
576 2.000e-38UniRef50_A0A2G6NE05 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2G6NE05_9DELT  ali  35  268.PKTVKARHILFKVGPTASDERI---------EAARKKAEDVLAKVRDGEE-FSALAKTYSEGPSAENGGELGEFRYEDMVEPFSEKAFSMAAGEVSEPVRTDFGWHIIKVE. 368
577 2.000e-38UniRef50_UPI0004B830D6 hypothetical protein n=1 Tax=Proteocatella sphenisci TaxID=181070 RepID=UPI0004B830D6  ali  32  178KKEEIKASHILITTLNDMGE-----PLSEEESAKKEAKAADILSKINQGE-NFEALAKEYSDDASAKNGGDLGYFAKGVMVPEFEKVAFELEKGQVSNVVKSSFGYHIIKVYE 285
578 2.000e-38UniRef50_E0IBM3 PpiC-type peptidyl-prolyl cis-trans isomerase n=1 Tax=Paenibacillus curdlanolyticus YK9 TaxID=717606 RepID=E0IBM3_9BACL  ali  45  223QPEQVRASHILV---------------------ETKAEADIIVKELNNGG-DFATIAKQKSDTGSKNAGGDLGYFERGVMDQSFEDAAFSLKVGEISKPVKSEFGYHIILVTD 314
579 2.000e-38UniRef50_A0A2W4K7N9 Foldase (Fragment) n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4K7N9_9FIRM  ali  40  32QEQQIHARHILV---------------------DNENLAREIYEKLKKGE-DFAELAKQYSTDATKDNGGDLGFFGKGEMVEEFEKAAFSLKVGEISSPVKTEYGYHIIKVEE 123
580 2.000e-38UniRef50_UPI00047C5E32 hypothetical protein n=1 Tax=Cohnella panacarvi TaxID=400776 RepID=UPI00047C5E32  ali  43  211..KKVRASHILVAT---------------------KEEADAIEADLKAGQ-DFAELAKSKSTDGSAVNGGDLDYFGSGQMVPEFEEAAFKLKVGEVSEPVKSDFGYHIIKVTD 300
581 2.000e-38UniRef50_A0A2N2DAM0 Foldase protein PrsA n=9 Tax=Firmicutes TaxID=1239 RepID=A0A2N2DAM0_9FIRM  ali  46  157QEKQVKASHILV---------------------ETEEKANEIKKKLDDGE-DFAKLAKENSNDTNKDSGGDLGFFGSGQMVKEFEDAAFTLKVGEISAPVKTEFGYHIIKVTE 248
582 2.000e-38UniRef50_UPI000D36CB0E hypothetical protein n=1 Tax=Limnohabitans sp. 2KL-51 TaxID=1977911 RepID=UPI000D36CB0E  ali  41  136EPEQVRASHILIRSGESN----------------AREKLLEIHGQLKKG-ADFAEMARTRSQDPSASKGGDLGYFSRGRMIKNFEDVVFAMKKGELSEVFESPFGFHIIQLTD 233
583 2.000e-38UniRef50_A0A1E3VXJ9 Peptidylprolyl isomerase n=3 Tax=Methyloceanibacter TaxID=1484898 RepID=A0A1E3VXJ9_9RHIZ  ali  48  126.PEQVHARHILVGTE---------------------EEAKEIAERLKKGE-DFAALAKEKSKDTNAE-GGDLGFFARGQMLKPFEDAAFALDVGEISDPVQTQFGWHIIKVEE 215
584 2.000e-38UniRef50_A0A2V7YRI1 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7YRI1_9BACT  ali  36  266QEEQVKARHVLVMVNDQRNDA------------QAQARIAEARSKI-EGGADFAAVAREYSDDASKANGGDLGWFGRNKMVKEFEDAAFSAQPGKLVGPVKSSFGYHLIEVTD 366
585 2.000e-38UniRef50_A0A2E4FED8 Chaperone SurA n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E4FED8_9DELT  ali  34  173...ERRASHILLKVDDYATEAQI---------QAAERKLQEIRARALAGETTFEELARANSQDGSAPSGGDLGWFGKGELDPTFEKAAFQLKVNEISVPVRTPFGVHLIKVV. 272
586 2.000e-38UniRef50_A0A1X0NPJ0 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Trypanosoma theileri TaxID=67003 RepID=A0A1X0NPJ0_9TRYP  ali  46  3..EKLRAEHLLIKFSGSRNPVSRRTGKSVESYEEARAELLQWAEKIRNGSITFEDAARQRSDCGSYASGGDLGYFGPGEMMKPFEDAVRALDIGQVSDIVQTDSGLHLIKR.. 113
587 3.000e-38UniRef50_A0A1H0D953 Peptidylprolyl isomerase n=1 Tax=Desulfonauticus submarinus TaxID=206665 RepID=A0A1H0D953_9DELT  ali  40  263QPERVKARHILIRLNPDASKKEXXXXXXXXXXXXXXXXXXXXX----------AELAKQYSEGPSKKNGGELGWFTKRDMVKPFADAAFALKVGEISKPVRTQFGLHLIKLED 365
588 3.000e-38UniRef50_G2IUX6 Peptidylprolyl isomerase n=38 Tax=Betaproteobacteria TaxID=28216 RepID=G2IUX6_PSEUL  ali  30  86.PEQFRASHILFPLGQGDDVANML----------AKAKAEGVLAEVQANPSRFADLAREHSTCPSGQQGGNLGQFGRGQMVPEFEQAVFSTEAGQITNLVETQFGYHIIQVND 194
589 3.000e-38UniRef50_A0A1F9I703 Peptidylprolyl isomerase n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_53_8 TaxID=1797882 RepID=A0A1F9I703_9DELT  ali  45  266.PEKVAAAHILLPIDPSA-------------KDKARTKAQELIKKIKAGEE-FAALAKKHSVDSSALRGGDLGWFQRGDMVGPFEEAAFSLKKGEVSGIVETAFGLHIIKVYD 364
590 3.000e-38UniRef50_A0A1B7XEV7 Peptidylprolyl isomerase n=4 Tax=Desulfovibrionaceae TaxID=194924 RepID=A0A1B7XEV7_9DELT  ali  39  266..DQADASHILIKLDENASEKEV---------AAATAKIEKVLKLARSG-KDFGKLAKKYSEGPSAPTGGELGTFGRGQMVKPFEDAVFSMKAGDISEPVRTRFGLHIIKL.. 364
591 3.000e-38UniRef50_A0A0B6WU39 Peptidylprolyl isomerase n=4 Tax=Acidobacteria TaxID=57723 RepID=A0A0B6WU39_9BACT  ali  35  224................DQEIDAYLAQHPELDPKRARAKAEEVLKRARAGE-DFATLAKEYSSDPSKDQGGDLGWFGRGVMVKPFEDAAFALQPGQISDIVETPYGFHIIKVE. 319
592 3.000e-38UniRef50_A0A1G1BWI4 Peptidylprolyl isomerase n=1 Tax=Lentisphaerae bacterium RIFOXYB12_FULL_65_16 TaxID=1798581 RepID=A0A1G1BWI4_9BACT  ali  40  198.PARFRVAHILVRVGPKDPETK---------RAEARKKAEALLRRAQAG-ADFALLARENSDCPSKANGGDLGLFTRGQMVPALERAAETLKPGELSGVVETPMGYHIIR... 296
593 3.000e-38UniRef50_A0A235EPS7 Peptidylprolyl isomerase n=2 Tax=Acidovorax kalamii TaxID=2004485 RepID=A0A235EPS7_9BURK  ali  33  93.PEQVHIRHILVSTREGDA-------------ETAKAKAQDILVKLRAG-ADFAALAKQHSADPSADKGGDLGFFAKGRMVPEFDEAAFALKAGDLTEVIKTQFGYHVLQLV. 191
594 3.000e-38UniRef50_A0A2S9XEC8 Peptidylprolyl isomerase n=2 Tax=Enhygromyxa salina TaxID=215803 RepID=A0A2S9XEC8_9DELT  ali  36  198..ERVRAAHILIRVGPDERPAEPTEDQKKEWEAAALAKANEIYAKATAEGADFEALAIELSEGPSARKGGDLGIFSADRMVDEFSDAAFGLDAGEVSKPIKTKFGFHIIKV.. 312
595 3.000e-38UniRef50_K0R9M8 Peptidyl-prolyl cis-trans isomerase n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0R9M8_THAOC  ali  51  144.PKEVRTLHILKKHRGSRRPASWRNPKITDTKEKAMSDLRELMSILDESKATFEELAKTESDCSSAKRGGDLGFFGRKKMQPAFEKASFGLKVGELSDIVDTSSGVHVILR.. 260
596 3.000e-38UniRef50_A0A2E3VZT5 Peptidylprolyl isomerase n=1 Tax=Halobacteriovoraceae bacterium TaxID=2026745 RepID=A0A2E3VZT5_9PROT  ali  34  234KPAQVKARHILLPVKEGEGD------------KEQKTKIEALRKRVS--PKNFASIAKKESKGPSASKGGDLGWFSKGSMVPEFESVAFGLKPGQISKPVKTNFGWHIIYVED 332
597 3.000e-38UniRef50_A0A2L2XB18 Peptidylprolyl isomerase (Fragment) n=1 Tax=Candidatus Gastranaerophilus sp. (ex Termes propinquus) TaxID=2029980 RepID=A0A2L2XB1  ali  37  173.PERVKASHILIEANPGILNAEQIDEKVKVELDKKLAVANEVRGKLLGNISDFEKLAKDYSADTSAKKGGDLGFFTKGDMVKPFSDAAFSLKPNTVSEVVETPFGYHIIMVTD 298
598 3.000e-38UniRef50_A0A2M9DK90 Peptidylprolyl isomerase n=3 Tax=Bacteria TaxID=2 RepID=A0A2M9DK90_9DELT  ali  41  33..EQVKARHILVKTEEAAAEVLAALAK----------------------GKDFAELAKEKSTGPSAPRGGDLGWFGAGQMVPAFEKAAFALKVGEVSQAVKTQFGYHIIKLEE 121
599 3.000e-38UniRef50_A0A1V5UZY0 Peptidylprolyl isomerase n=1 Tax=Lentisphaerae bacterium ADurb.Bin242 TaxID=1852900 RepID=A0A1V5UZY0_9BACT  ali  35  223KPETISASHILISTMPDPNASVKPDAAALAKLDEAKAKADKILVQLKQG-ADFGALAEKESACDSKKNKGSLGEFQRGQMVPEFEKAAFALKPGDLSAVVKTQFGYHIIKL.. 334
600 3.000e-38UniRef50_L8WT36 Importin-9 n=1 Tax=Thanatephorus cucumeris (strain AG1-IA) TaxID=983506 RepID=L8WT36_THACA  ali  55  55...QMRASHLLVKHSGSRRPS-----------KEAIQILEEYGAEIGTDRNKFAELASEHSDCSSHRNGGDLGWFGKGQMQKPFEDGVLALEVGGISGVVETESGVHLIMRT. 152
601 3.000e-38UniRef50_Q57YG1 Peptidyl-prolyl cis-trans isomerase n=8 Tax=Eukaryota TaxID=2759 RepID=Q57YG1_TRYB2  ali  52  3..EKLRAAHLLVKFSGSRNPVSRRTGDSTATYEDAIKELQKWSQRIASGEVSFEEAASQRSDCGSYASGGDLGFFSSGEMMKPFEDAVRALKIGDISPIVQTDSGLHIIKR.. 113
602 4.000e-38UniRef50_A0A1W9PU67 Peptidylprolyl isomerase n=1 Tax=Desulfococcus sp. 4484_241 TaxID=1968522 RepID=A0A1W9PU67_9DELT  ali  32  261KEKTVRARHILIKVDKDADE---------KTVEEKHKQALKIYDMIVNGQKDFAKMAEKYSEGPSAKDGGLLGTFKKDDMVAQFSEKAFSMKEGDVSKPVRTQFGWHIIKVE. 363
603 4.000e-38UniRef50_A0A117ME61 Peptidylprolyl isomerase n=1 Tax=Parcubacteria bacterium 32_520 TaxID=1641387 RepID=A0A117ME61_9BACT  ali  41  186QPEKRKISHILV---------------------ENREDAELFLKQLKDGLVQFDKLAQDKSICPSAEKGGDLGYITRGQMVSEFEEAAFSLEIGEISAIVETEYGYHIIKCDD 277
604 4.000e-38UniRef50_A0A2D5ZX76 Peptidylprolyl isomerase n=1 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2D5ZX76_9PROT  ali  33  238KKEAVRARHILIK----------AASEKEADVKKAFEKAKKIRSEVSD--SNFAELAKTHSEDPSKGNGGDLGFFERGQMVREFETAAFSQKVGEVSQPIKSNFGYHIIKVEE 339
605 4.000e-38UniRef50_Q02CZ7 Peptidylprolyl isomerase n=5 Tax=Acidobacteria TaxID=57723 RepID=Q02CZ7_SOLUE  ali  37  263.PERVKARHILLKTQG----------KPASEEAAIKAKGESLLKQIKAGG-DFAKLAKENSEDPSAVNGGDLGWITHGQMVAEFDKAIFALKPGEVSDLVKTQYGYHIVQ... 362
606 4.000e-38UniRef50_A0A0P1FAQ3 Peptidylprolyl isomerase n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A0P1FAQ3_THAGE  ali  39  137...EYSAAHILV-----------------ETEDAAQKLAEEARD-----GADFAELAKTHSTGPSAPNGGSLGWFGPGMMVPPFEDAVVAMEAGEVSDPVETQFGWHVIKLIE 224
607 4.000e-38UniRef50_A0A2M7FFU1 Protein translocase subunit SecD n=1 Tax=Candidatus Gracilibacteria bacterium CG17_big_fil_post_rev_8_21_14_2_50_48_13 TaxID=1974  ali  30  318..EVMKASHILFTTTDAGNAAATPEETANRD-AVAKKSAEELLVRIQADPSKFDELAKQNTQEPGKERAGDLGYFTKGMMVPEFETAAFALEPGQVSGVVKTQFGYHIIKAVE 428
608 4.000e-38UniRef50_V4YMB5 Peptidylprolyl isomerase n=1 Tax=Betaproteobacteria bacterium MOLA814 TaxID=1408164 RepID=V4YMB5_9PROT  ali  33  267.PEERRASHILLPLDAGADDAAVS---------AATTQAQTLLAQVRGNPDTFADVAKASSKDPSAQNGGDLGFFGKGAMVKPFEDAVFALNSNGISDVVRSDFGLHIIKLTD 370
609 4.000e-38UniRef50_A0A1F6N2I5 Peptidylprolyl isomerase n=1 Tax=Candidatus Magasanikbacteria bacterium RIFCSPLOWO2_01_FULL_40_15 TaxID=1798686 RepID=A0A1F6N2I5_  ali  32  196..EQVRARHILFTVNAPADDAKAKADATR------------VLKELQKG-ADFAELAKKYGTDGTKDQGGDLGWFGRGDMVKEFEDAAYALNKGEVKAPVKTQFGYHLIKTED 294
610 4.000e-38UniRef50_A0A2G9XMQ2 Peptidylprolyl isomerase n=1 Tax=Syntrophobacteraceae bacterium CG23_combo_of_CG06-09_8_20_14_all_50_8 TaxID=1974096 RepID=A0A2G9  ali  39  216.PETVHARHILVAKSPGDDDKIKADKKAKA----------ELLRKRVVDGADFAEVAAKNSDCPSKSSGGDLGTFSRGQMVKPFEDAAFSQKINVISPVVETGFGYHIIQVLE 317
611 4.000e-38UniRef50_A0A1U9NH80 Peptidylprolyl isomerase n=1 Tax=Phycisphaerae bacterium ST-NAGAB-D1 TaxID=1936003 RepID=A0A1U9NH80_9BACT  ali  34  213QPVQVQASHILIDTREKDEAAKAEAKKEIEAI----------LADVKDGG-DFAEIAKEKSDCPSGQRGGDLGFFTKEKMVPAFSNAAFAMEVGEVSDVVETQFGYHIIKVTD 314
612 4.000e-38UniRef50_UPI000997D58B hypothetical protein n=1 Tax=Bacillus alkalitelluris TaxID=304268 RepID=UPI000997D58B  ali  42  123..EIVKASHILV---------------------ADEETAKEVKEKLEAGE-SFEELAKEYSTDGSAANGGDLGWFTKGQMVPEFEETAFTLGKDEVSEPVQSQFGYHIIKVT. 210