current user: public

If you have questions about the server, please let us know.

Query: d3ci3a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]}, from SCOP207

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# E-value Template Links and tools%idFirst KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFRLast
1 4.000e-55UniRef50_A0A2H5XMJ9 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=28 Tax=cellular organisms TaxID=131567 RepID=A0A2H5XMJ9_9BACT  ali  40  2KIYTRTGDDGTTGLFGGDRVPKHHPRLEAYGTVDELNSFLGLARTYLAPDDHQAEALLVQLQRLLFEVGADLATPLHSRARI-TRITPEHTEALEQEIDRLETALPPLRHFILPGGTPAAAMLHVARTVCRRAERCVSALAEQEAINPELLRFLNRLSDLLFVLARWVNHTHGMAETPWKSS..... 182
2 4.000e-49UniRef50_A0A1G2B4T8 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Kerfeldbacteria bacterium RIFCSPHIGHO2_12_FULL_48_17 TaxID=1798542 RepID=  ali  41  3KIYTKTGDQGETGLFGNQRVRKNHPRLVAYGEVDELNSFIGFLISRIN--DDGINKKLMAVQENLFIIGAELATPK-DSPLHTPHIQPHHVQTLEQEIDAWQHDLPPLAHFILPGGDRSAAVAHICRTICRRAERSIISVDQQEEIDPEILKYMNRLSDWFFILARILNKHYNQTEHTWNGKQKIEQ 186
3 6.000e-49UniRef50_A0A2D0A6F1 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Bacteria TaxID=2 RepID=A0A2D0A6F1_9FLAO  ali  36  2KIYTKTGDKGETALYGGIRVSKASARVESYGNIDELNSFIGFAKSEIS--DEKVLAQLKKIQFDLFTVGSESATPTNGKSRLSLMISETEIEELENWMDEFEKELEPLQYFILPGGGKSATALHLCRTVCRRAERSLVFLNETEEVRPELIKYLNRLSDYLFVLARYISKINGETEEYWNPNER... 189
4 1.000e-48UniRef50_A0A2H5VDI1 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=6 Tax=cellular organisms TaxID=131567 RepID=A0A2H5VDI1_9ARCH  ali  38  5RIYTRTGDKGETGLIGGIRVPKNSPRIEAYGSIDELNSLLGLVRSLSKLQ--EINNLIKDIQRDLFTISAELAAPKGAEGLKIPQIRKEAIDRLEREIDNLDKDLEPLTRFIIPSGSSLASYLHLARSVCRRAERNLVTLAQKEGVRDEILAYMNRLSDLLFMMARWVNKKEGYSEEIWE....... 182
5 5.000e-48UniRef50_A0A2E1Q5I8 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2E1Q5I8_9PROT  ali  42  2KIYTKSGDQGETSLVDGSRVKKNHPRVEAYGTLDELNSSLGVCRSAEAFQNNSHFQALQSIQNDLFNLGSQLACPTEDWRAKMPEVSETRVLYLEAEMDAMTDVLPPLKEFILPGGHPFAAALHQARSLCRRAERRVFELESSSNLENRALIYLNRLSDYLFVLARYANHVSQVPELTWKK...... 186
6 6.000e-48UniRef50_F9Z826 ATP/cobalamin adenosyltransferase n=52 Tax=Bacteria TaxID=2 RepID=F9Z826_ODOSD  ali  43  2KIYTKTGDKGMTSLIGGKRVPKNSARLESYGTIDELNSFLGMIRSF--PLEQVIAEELVEIQSRLFDVGGNLATDPEASAKVPIGVTEEDIALLENGIDRMDAEVPPMKYFVLPGGNQCVSFCHMARTICRRAERRILDLAAETEVDGSVMKYVNRLSDYLFILARKIAYDSGCEEMKWVPRK.... 184
7 2.000e-47UniRef50_C6X2N7 Cob(I)alamin adenosyltransferase PduO n=461 Tax=root TaxID=1 RepID=C6X2N7_FLAB3  ali  36  2KIYTKTGDSGETALYGGTRVSKASARVEAYGNIDELNSFIGFAKAEIS--DDLVLTQLKKIQFDLFTVGSESATPTNGKSRLSLMISETEIEELENWMDAFENELEPLQYFILPGGGKGATSLHICRTVCRRAERSLVYLNESEEVRPELIKYLNRLSDYLFVLARYVSKFNGDTEEYWNP...... 186
8 2.000e-47UniRef50_A0A2H6EQ36 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=8 Tax=Bacteria TaxID=2 RepID=A0A2H6EQ36_9BACT  ali  44  2KIYTKTGDGGQTSLFGGKRVSKDDARIEAYGTVDELNALVGVAIS--ETTDKSAEKVLRNIQSGLFVLGSDLATPADESKVKLPRTTEEMVKDLENEIDTYESKIPELKIFILPGGTKASALLHLSRTVCRRAERRVINLSNVEQINLEVVKYLNRLSDLLFVLARFENNINDIPDDGWYP...... 180
9 2.000e-47UniRef50_T2KJE2 ATP:cob(I)alamin adenosyltransferase 7 n=645 Tax=root TaxID=1 RepID=T2KJE2_9FLAO  ali  37  2KIYTKTGDKGTTALFGGTRVPKHNIRIDSYGTVDELNSYIGLIRD--QDINPAYKDVLIIIQDRLFTVGAMLATPPEKERLNIPKIDDANVTLLETEMDTMNAELPPMTHFVLPGGHQTVSFCHIARCICRRAERLASELNEIEPLDPQTLIYLNRLSDYLFVLARKLSNDLHADEVKWIPEK.... 189
10 3.000e-47UniRef50_A0A2E5F1X9 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5F1X9_9CHLR  ali  38  5KIYTRTGDTGETGLFGGGRVSKDHLRIECYGTIDELNSSLGIVTSSLN--DQDISNCLTKIQSTLFDIGGELATPNIEKRKVGPQVADMDIKEIEKLINQFDEEIEPLQAFILPGGHQHAAQIHLSRTICRRAERRLVQLNKVEEISSEIIRYINRLSDLLFTLARVINKRHGIEEPQWQGK..... 189
11 3.000e-47UniRef50_A0A292YJY5 ATP--cob(I)alamin adenosyltransferase n=1 Tax=Effusibacillus lacus TaxID=1348429 RepID=A0A292YJY5_9BACL  ali  44  2KIYTRTGDKGMTSLIGG-RVRKDAVRVEAYGTLDELNSFVGQAKVLMDPERHKMLEDLTEIQHELFDAGGDLAYVQAPKQEITYKVNKDMVSRLEQWIDRYDAECPPIKRFVLPGGSPVSAALHVCRTVSRRAERRVVKLSEQEAINEDVQKYLNRLSDFFFAIARAANVRDGVGDVEYKRGGEVFR 189
12 3.000e-47UniRef50_A0A090Q364 Cob(I)alamin adenosyltransferase PduO n=41 Tax=Bacteroidetes TaxID=976 RepID=A0A090Q364_9FLAO  ali  37  2KIYTKTGDKGTTALFGGTRVPKHNLRIDSYGTVDELNSWIGLLRDQPVTVS--TKKVLIDIQDHLFTVGAILATPPEKEKLKNGKDRDEDILMLEQEMDRMNEDLPPMTHFILPGGHQSVSFCHITRTVCRRAERLASELNENTPIEEQVLRYLNRLSDYLFVLARKLSFDLQAEEIKWVPKK.... 189
13 9.000e-47UniRef50_A0A2E3HVP7 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E3HVP7_9BACT  ali  38  2RIYTRTGDEGETGLYGNTRLDKDSQRIKAIGDVDELNAFLGYAHSLIS--DTDIANLLNQMQSELFDLGADLAVLETHYQSESLRISNDLVIEQERMIDNFQQELAPITHFILPGGSTSASVLHLARTVCRRAERSVVSLKKSHPINPEILHYLNRMSDLLFVLARTVNHRAGKPETHWKSP..... 181
14 1.000e-46UniRef50_A0A2G6JKA0 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2G6JKA0_9BACT  ali  41  2RIYTKTGDEGQTGLFNGSRVAKEDLRVQAYGCCDELNSWVGVIRA--EGVNADSDQELAEIQHDLFEIGSILATP---GESPQVKQVPGRTKALENWMDRMDAALPALKSFILPGGSKAAAHCHVARTVARRAERQAWICARQHPVASEVLIYLNRLSDTLFLLGRWLNHSSNTADVEWQPRDS... 180
15 1.000e-46UniRef50_A0A2S6IDT1 Cob(I)alamin adenosyltransferase n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A2S6IDT1_9FLAO  ali  37  22KIYTKTGDKGTTALFGGTRVPKHNLRIDSYGTVDELNSWMGLIRD--QEISVHTSKIINLIQHHLFTLGAILATPPEKERLNISKISDEEINMLETEMDDMDKELPPMTHFILPGGHPSVSYCHITRTVCRRAERLASELNEITPIDPQVLRYLNRLSDYLFVLARKLSKDLQAEEIKWIPNK.... 209
16 2.000e-46UniRef50_A0A1G2VF12 ATP:cob(I)alamin adenosyltransferase n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A1G2VF12_9BACT  ali  37  4.IYTKTGDSGTTGLIGGERVPKHDARIHAIGDIDELNALLGVIISIIKDDAPLFSECIETTQHHLFTVGALLADPHTSS---YLIIKSEWISAIEQWIDEYNDALPPLSHFILPNGTAVATHLQFARAVCRRAERSLSALHQISPLPAELLQYINRLSDFLFMAARYINIEQGHEETEWDKSK.... 182
17 2.000e-46UniRef50_Q50EJ2 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=483 Tax=Bacteria TaxID=2 RepID=Q50EJ2_LACRE  ali  100  2KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFR 188
18 3.000e-46UniRef50_A0A1F3B288 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A1F3B288_9BACT  ali  41  44RIYTRTGDRGETGLIGGQRVPKDDPRVEAYGAVDELNASLGAARALTRETD--LVEVFDRIQHRLFDLGAELAAPKPGAETPSAVTEAE-VKVLEGVIDLYQETLPPLREFILPAGSPLGAALQVARTVCRRAERRAVTLARREAVNPEIVRYLNRLSDLLFVLARVGNERAGTADIPWKK...... 221
19 3.000e-46UniRef50_A0A2W4J2H5 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2W4J2H5_9PROT  ali  37  16RIYTRTGDRGDTGLFGGGRVRKDDPRVEAYGTVDELNAIVGLAAAFTD--DAQVRGWLGAIQSELFFLGAELATPDPHVKKQIVHLDEDTISRWEGVIDAISAEVPPLQHFVLPGGHPAAAHLHVARTVCRRAERRLLTLARTANVRPECVAYLNRLSDLLFMLARLVNHRESTAEPIWEP...... 195
20 3.000e-46UniRef50_A0A2D6JJ70 ATP:cob(I)alamin adenosyltransferase n=65 Tax=Bacteria TaxID=2 RepID=A0A2D6JJ70_9PROT  ali  38  2KIYTKTGDNGQTSLLNGTRVAKYHPNIEAYGSIDELNSNIGMLIHLCENYQSDDFDLLGEISKNLFSIGSALACEDPKEGEKYLNLKASDIEKLESAIDHFSKDLKELKNFILPGGGMPASQSHICRSVCRRAERRLLQL--QEEEHSLILGYLNRLSDYFFVLARYLNFLDKREDIIWKS...... 180
21 5.000e-46UniRef50_A0A1Q9N2Y5 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 RepID=A0A1Q9N2  ali  43  2KIYTKSGDEGQTSLFGGLRVSKNDLRVQAYGELDELNSSISISLHYVKT--EKIKFFLQNLQHLLFSIGSDLATPFSEKKESIHLDCKGLTKKLEDEIDFWETQLSPLKSFIVPGGSIGASHLHFLRTNCRRAERIIIQLSKSEDINKSIIPYINRLSDLFFVLARAENHSLDINDVVW........ 180
22 8.000e-46UniRef50_M7NA79 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=46 Tax=cellular organisms TaxID=131567 RepID=M7NA79_9BACL  ali  42  2KIYTRTGDKGQTSLIYGKRVSKTDPLVDAYGTCDEANSAIGLGLSHLHQEFFDGKDDLHQIQTVLFHVGAELATP--EGKEVKWKLEKPEIERLEQWIDRYDAELPPLKNFILPGGHPAAAGLHYARTVVRRAERAA--LLVGDHVNPDVLAYLNRLSDFLFVAARYVNMRLGRSE........... 177
23 1.000e-45UniRef50_A0A1V5YSA7 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=35 Tax=Bacteria TaxID=2 RepID=A0A1V5YSA7_9BACT  ali  39  2KIYTKTGDKGKTSLIGGTRVWKNDVRLEAYGTIDELNAFIGMLVSG--KLPDDVRKFLPGIQHRLFTIGSFLATDRSKTAKPASIVHEADVQALEQEIDRLNELLPPIRKFILPGGSHAGSIAHVCRAITRRAERKILHLVQTFEIDALLLQYVNRLSDYLFVLSRYLTVSEGNKEIFWES...... 182
24 1.000e-45UniRef50_UPI000980D00C cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Prevotella ihumii TaxID=1917878 RepID=UPI000980D00C  ali  36  3KVYTKTGDKGTTSLIGGTRVKKCDPRIDSYGTIDELNAQIGLLSTYI--TEEETLTLIAEMQNVLFNIGCNLAGEDFKKELKESSVPPVLIEHVEQSIDRMQGIIPELHCFVIPGGSRSASIAHVCRTVCRRAERLIIALDETSPVDANVLTYINRLSDYFFILSRYLNFIEKVDEKKWENPCK... 185
25 1.000e-45UniRef50_A0A2H3NXD6 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A2H3NXD6_9BACT  ali  37  3KIYTRTGDDGTTALFGGDRVGKGHPRIRAYGTVDEVNALVGVARAHLADTDAPLHDIFQEIQEDLFVVGADLATPE-NAKPVVPRITEAHIDGIEQHIDTLEDDLAPLKHFVLPGGSPAAAALHNARTVCRRAERLSVEASASTPLNEHALVYLNRLSDLLFVMARWANHAVGASEHTWVP...... 184
26 1.000e-45UniRef50_A0A0P6AJS1 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=5 Tax=Daphnia TaxID=6668 RepID=A0A0P6AJS1_9CRUS  ali  38  51KIYTKTGDSGMTSTFTGERRAKDDNIFQALGAVDELASLLGLSREFGLDNSHPYTDHLQRIQCILQDVNACIATPFSSAREAHTEFDSSHVGELEEWIDSYSTHLPPLENFILPGGGKASSSLHVARTVCRRAERAVVPLVREQEINPETLKYLNRLSDLLFTLARFAAKLDKRQETVYLRPGK... 237
27 2.000e-45UniRef50_M1Z243 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Nitrospina gracilis (strain 3/211) TaxID=1266370 RepID=M1Z243_NITG3  ali  39  6KVYTKQGDKGETSLVGGVRVPKDHPRVQAYGTVDELNSLVGLVRSTLDQIPAEQEQTLAAIQQWLFDLGSELATDPKTGREMKIGVKAEQVAWMESWMDTMNRDLEPLKSFTLPGGRLPLAFLHQCRTVCRRSEREIIALGRKEEIGSQVGPFINRLSDAFYVLGRWLAKVSGDDEILWKPG..... 192
28 2.000e-45UniRef50_A0A1W9HZC6 Uncharacterized protein n=1 Tax=Proteobacteria bacterium SG_bin7 TaxID=1827384 RepID=A0A1W9HZC6_9PROT  ali  37  2KIYTKTGDLGKTSLGSGKRVDKFHPRIECYGTLDELNSILG--LAAAYMQSKEDKELTYRIQNQLFNLGSLFASDSTADQKKLPQITDYHILLLEKNIDSFTEKLPPLKNFILPGGSNAASALHLARCVCRRAERLAFQLHKKSKINKTHLIYLNRLSDFLFVFARSVNQRELISDVEWNK...... 180
29 3.000e-45UniRef50_A0A0K6C064 ATP:cob(I)alamin adenosyltransferase n=97 Tax=Bacteroidales TaxID=171549 RepID=A0A0K6C064_BACFG  ali  36  6.VYTKTGDKGTTGLIGGTRVPKTHIRLEAYGTVDELNSNLGLLATYL--MDEHDLNFVQSVQDKLFAIGSHLATDQEKVQNDVSIITPAEVEAIEREIDAADEILPPLHSFIIPGGSRGSAVCHVCRTVCRRAERRILALSESCTISADLLAYINRLSDYLFVLSRKMNFNEGKDEIFWNNSCK... 187
30 3.000e-45UniRef50_G1T6G1 Methylmalonic aciduria (cobalamin deficiency) cblB type n=51 Tax=Bilateria TaxID=33213 RepID=G1T6G1_RABIT  ali  39  51RIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMEFITEKGHPFAEELQKIQCTLQDIGSTLATPRSSAREAHLKHAEGPVLELERWIDEYTRQLPPLTAFILPSGGKSSSALHLCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYKRS..... 235
31 4.000e-45UniRef50_H0XCR3 Methylmalonic aciduria (cobalamin deficiency) cblB type n=9 Tax=Amniota TaxID=32524 RepID=H0XCR3_OTOGA  ali  39  47KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELIEEKGHTFAKELQKVQCMLQDVGSALATPRSSAREAHLKHTEGPILELEQWIDKYTSQLPPLTAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYKK...... 230
32 5.000e-45UniRef50_E0NQ70 ATP:cob(I)alamin adenosyltransferase n=27 Tax=Bacteroidales TaxID=171549 RepID=E0NQ70_9BACT  ali  36  5KVYTRTGDKGTTSLVGGVRVKKTNPRIEAYGTIDELSANLGLLIDYMKEGDE--RKFIVRIQHNLFVIGSYLATDQTKTEREFCMIDPTETEALEEAIDEALLNIPPLSGFILPGGCMAAAMAHICRTVCRRAERRILAVGEDTKVSPEILEYINRLSDYLFVLARKLNFVEGAREKLWKNNDK... 187
33 5.000e-45UniRef50_A0A128A3C4 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=68 Tax=cellular organisms TaxID=131567 RepID=A0A128A3C4_9ARCH  ali  40  2KIYTKTGDDGTTGLIGNKRVKKSSPRIASYGMVDELNAAIGIILS--SKLGKDITNLLTKIQNDLFVVGADLANPNMKSKSN--RVTSEMITYLEKEIDRLEEKLSPITYFILPGGDLVASQIHLARAICRRAETNMVNLSEVDKINNLCLIYMNRLSDLLFVLARTINKRKKISDVAWKK...... 178
34 6.000e-45UniRef50_A0A2P6NAE1 Uncharacterized protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NAE1_9MYCE  ali  36  52KVYTKTGDKGTSSLFNGERRPKTDPIFDALGDTDELNNAVGIAREFVSENETQIHQQLEQIQNVLLDVGANIATPRNRSDEKRLERTEGHVTDLEHWIDEMEKELPPLRNFILPSGGKGAVFLHSARSICRRAERAVVDLPEEVATDEAVKRYMNRLSDYLFVAARYSAFREGKKEIVHNKPTPVTR 241
35 7.000e-45UniRef50_A0A1M4XI48 Cob(I)alamin adenosyltransferase n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1M4XI48_9FLAO  ali  33  2KIYTKTGDKGTTSLFGGSRVPKHHIRIESYGTVDELNAHLGMLKDH--EVSTQIEDDINQIQHQLFTVGAILATEAEEAKQNIQRITQDDINYLEHRIDEMNKNLPEMTHFVLPGGHKTVSQAHICRCVCRRAERNATALFELENFDTEVLQYLNRLSDYLFVVSRATAKELDANEVKWIPEK.... 185
36 7.000e-45UniRef50_A0A160F944 Cob(I)alamin adenosyltransferase n=46 Tax=Bacillales TaxID=1385 RepID=A0A160F944_9BACI  ali  48  2KLYTRKGDKGKTSLIGG-RVDKDHLRVEAYGTLDEVNSLVGQAMTLLEEEKQDIYSELQKIQHELFDCGGDLAIVNQKLPY---KVKAEMVTFLEQRIDEYIKEAPPLEKFILPGGSKAAAAIHVARTVTRRAERCIVSLSKAEPINEIVLQYVNRLSDYFFAAARVVNARLNVNDIEYERSAIVFR 185
37 7.000e-45UniRef50_A0A1Y1CFY4 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=28 Tax=Bacteria TaxID=2 RepID=A0A1Y1CFY4_9BACT  ali  35  5KVYTKTGDSGTTGLIGGTRVPKHHFRLEAYGTVDELNSYIGLIRSH--DIEAKSKEILLQIQNKLFLIGSRLATDDEKSDMKEKLPIVEDILLLENEMDRMDKELAELNNFVLPGGSLANGFCHVARTVCRRAERRAIQLSKDVDVNPLLLKYLNRLSDYLFVLSRKVLLDVGVDEIKWK....... 183
38 1.000e-44UniRef50_B6BWM1 ATP:cob(I)alamin adenosyltransferase n=26 Tax=cellular organisms TaxID=131567 RepID=B6BWM1_9PROT  ali  41  8.IYTKTGDNGETSLGNGQRVKKNSVRVECLGSIDELNSIIGLILTEA--VHEKIKTTLTEIQHDLFNIGGELSIPSHK------LLDSQRVDFLEIELDEMNQKLPPLKEFILPGGSKPAALAHVARTVCRRAERNCINLKEIEEINSSSLYYLNRLSDFLFVLARTLNQENNVPDTLWKRS..... 180
39 1.000e-44UniRef50_A0A1M9F6K1 ATP:cob(I)alamin adenosyltransferase n=808 Tax=Bacteria TaxID=2 RepID=A0A1M9F6K1_9MYCO  ali  46  2KIYTKTGDKGQTSIIGG-RVDKDDIRVEAYGTIDEVNCFVGQAAAELNDVFADVLADLEKIQHELFDCGGDLA---NVTAKRVPKLTEEAVQYLEQRIDVYTEEAPPLERFILPGGTKASATIHIARTVARRAERLIVSLSKADSTTPSVLQYVNRLSDYFFALARVINFRLGVKDVEYVRSAKVFR 186
40 2.000e-44UniRef50_A0A2H1EHZ7 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=52 Tax=cellular organisms TaxID=131567 RepID=A0A2H1EHZ7_9ARCH  ali  38  2KIYTKTGDDGTTGLIGNKRVKKSSPRILSYGTVDELNASIGIILSTGP--EKDIQDLLVQIQNDLFVVGADLANPNLENKSN--RITSEIILFLEKEIDRLEEKLSPITYFILPGGDSVAAHIHLARAICRRAETNIVSLAENEKINNNCLVYMNRLSDLLFVLARTVNKRKEISDIAWKK...... 178
41 2.000e-44UniRef50_Q9D273 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=56 Tax=Opisthokonta TaxID=33154 RepID=MMAB_MOUSE  ali  40  51KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELVTEKGHMFAEELQKIQCMLQDVGSALATPRSSAREAHLKHQEGPVLELERWIDKYSSQLPPLKAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEGSQEKIYKKH..... 235
42 2.000e-44UniRef50_A0A076W6D3 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=33 Tax=Bacilli TaxID=91061 RepID=A0A076W6D3_BACMY  ali  47  2KLYTKTGDKGQTSIIGG-RVDKDHIRVEAYGTIDEANSHIGYAMTMLEECFQDIHEELEKIQHELFDCGGDLAIVQQKSPY---KVTEEMVIYLEGRIDHYIEEAPPLECFILPGGSPASAVTHVARTVTRRAERYIVSLGKQEEINEVVLRYVNRLSDYLFAIARVINARLMVKDVEYKRSAIVFR 185
43 3.000e-44UniRef50_Q58D49 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=105 Tax=Gnathostomata TaxID=35060 RepID=MMAB_BOVIN  ali  39  51KIYTKTGDKGFSSTFTGERRSKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFVEELQKIQCSLQDVGSALATPRSSAREAHLKHEAGPILELEQWIDKYSRQLPPLTAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDANVVKFLNRLSDYLFTLARYTAMKEGNPEKIYKK...... 234
44 3.000e-44UniRef50_A0A174MIC0 ATP:cob(I)alamin adenosyltransferase n=165 Tax=root TaxID=1 RepID=A0A174MIC0_BACT4  ali  37  6.VYTKTGDKGTTSLVGGSRVSKTHIRLEAYGTIDELNSHLGWLHTYL--LDESDRDFILGIQHKLFAIGSHLATDQEKTQKPASIITLEDIERIEQEIDKLDEQLPELCAFIIPGGSRGAAVCHVCRTICRRAERRILTLSETCTISPEVLAFVNRLSDYLFVLSRKINFDEQNSEIFWDNS..... 185
45 3.000e-44UniRef50_G3HI80 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=24 Tax=Opisthokonta TaxID=33154 RepID=G3HI80_CRIGR  ali  40  51KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELITEKGHTFAKELQKIQCTLQDVGSALATPRSSAREAHLKYKEGPIVELEQWIDKYSSQLPPLTAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTIARYAAMKEGSQEKIYKKSDE... 237
46 3.000e-44UniRef50_A0A139KIP3 ATP:cob(I)alamin adenosyltransferase n=17 Tax=Bacteria TaxID=2 RepID=A0A139KIP3_BACUN  ali  36  2KIYTKTGDKGTTSLVGGTRVPKTHIRLEAYGTVDELNSNLGLLITYLLDGKDK--DFLQQVQDRLFAVGSHLATDREKMEKEASIISSEQVEMVEREIDRLDTLLPPLSAFILPGGSRGAAVCHVCRTVCRRAERRILALAEQVEIASELLAYVNRLSDYLFVLSRKMNQDDKKGEIFWNNSCK... 184
47 3.000e-44UniRef50_A0A1F5GZ33 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Microgenomates group TaxID=1794810 RepID=A0A1F5GZ33_9BACT  ali  44  4KIYTGIGDRGTTSLFGGRRVGKNSARIKAYGQIDELNSQIGIILSEIP--PPKISNKLLRVQDELFVLGADLSAPV-EIKVRIPRVKKNYITRLEKEIDAWEKDLPKLRNFILPGGNKVGARLHLARAITRRAERSIVALEQREKINKNVLIYTNRLSDWFFVAARYVNYLEKISETIWKGR..... 182
48 3.000e-44UniRef50_A0A0R2SGL6 Cob(I)yrinic acid a c-diamide adenosyltransferase n=4 Tax=Flavobacteriales TaxID=200644 RepID=A0A0R2SGL6_9FLAO  ali  36  2KIYTKTGDSGQTSLYSGQRVSKADLRLHAYGTLDELNAYVGLLR---DSAMPSLQTELQDIQSHLFSIGSHMANDNEAMQSKLPVIHASWVLSLEACIDRMDADLPPLRNFVLPGGHPLVSHAHIARTVCRRAERWCTQLETALPLPTEILPYLNRLSDYFFTLSRWFAQDLKAEEIPWKP...... 184
49 4.000e-44UniRef50_A0A2H5ZCS3 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=7 Tax=Bacteria TaxID=2 RepID=A0A2H5ZCS3_9BACT  ali  37  18RVYTRTGDDGSTALGGGQRVPKDSLRIEAYGTVDELNSVLGVAVAM--GLAEPLREPIFTVQQVLFNLGSDLCILESDKERPVPRIEPRHVEQLERWMDAWNAELEPLRSFILPGGDPAAAQLHVARTVCRRAERRVIALSRQEAIGPHVIPYLNRLGDFLFVAARYQAKLSGRGDVLWDSR..... 198
50 5.000e-44UniRef50_A0A1V6CYN8 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=62 Tax=root TaxID=1 RepID=A0A1V6CYN8_9BACT  ali  35  4KIYTKTGDDGTTGLVGGTRVKKSEMRLEAYGTIDELNSWLGLIRSVTD--DTEVKDLLYAVQSNLFICGSKLASDEKGKQISGNLNITEEILRLENAIDAFDMELDPLQSFILPGGSALVGYCHIARTVCRRAERRIVQLAETTEVDDVIIRYVNRLSDFLFVLSRKTGRDTGIAEVPWKP...... 183
51 6.000e-44UniRef50_T0R9B8 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Oligoflexia TaxID=1553900 RepID=T0R9B8_9PROT  ali  38  5KVYTKTGDDGTTSLVGGERVQKSNARIHLYGDIDSLNSHVGLALSFSAKQQHQAFDYLGELQSRLFDIGSNIACLAKERDKFQPTISKSDITELESLIDQLEAQLPALKNFIMPGGCLMASQLHVCRTLARQIERNAVHFDNVDEVPEVVLQFFNRLSDYFFVVARYANFQEGIAETIWQGKKS... 192
52 6.000e-44UniRef50_D7CS17 ATP/cobalamin adenosyltransferase n=57 Tax=cellular organisms TaxID=131567 RepID=D7CS17_TRURR  ali  38  2KIYTRTGDGGTTALYGGERVSKDAARVEAYGTVDEANALLGLARAQLGRSPDDVDALLDALQRTLFEVGTDLATPLSSKYRANLVPSAADAEELERHIDRLEAELPPLKAFILPGGHPAAASLHLARTVVRRAERRVAGLAHEEAVNPHVGVYLNRLSDLLFVLARFVNVRSQTPETPWRARER... 190
53 7.000e-44UniRef50_A0A1W9T5A2 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bacteroidetes bacterium 4572_117 TaxID=1971632 RepID=A0A1W9T5A2_9BACT  ali  36  2KIYTKTGDKGQTSLFGGKRVPKYDLRVETYGTIDELNSFIGLLRS--QNIKDADKHVLLAIQNQLFSIGSVIATEDI-SKLKIPLPSETTIKTLEKEMDNIDSGLAKQMNFVIPGGNQAIGYCHVCRSVCRRAERLIVKLADETKVDGIIIQYINRLSDYFFLFSRKITSDFNIPEAIWKPG..... 180
54 7.000e-44UniRef50_A0A2T2TTD5 ATP:cob(I)alamin adenosyltransferase n=16 Tax=Bacteria TaxID=2 RepID=A0A2T2TTD5_9BACT  ali  39  2KIYTRTGDDGSTGLFGGDRVPKDDPRIAAYGTVDETNSLVGVARAHLSAADSRLDDVLGRLQENLFTVGADLATP-LDSKPVVPRIEAAHVERLEADIDAFQNELPELKQFILPGGAPGGATLHTARTVCRRAERLTVRAEAEGDINPHAAVYLNRLSDLLFVLARWANRRAGAREDRWSPGES... 195
55 7.000e-44UniRef50_A0A0S2I2E0 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=66 Tax=root TaxID=1 RepID=A0A0S2I2E0_9BACT  ali  32  2KVYTKTGDDGTTALIGGKRVPKYHLRIEAYGTIDELIAHIGMIR-DFKKIDKHTQESLIEIQDRLMTCAAIMATDCDNCDVKIPEMYSTDIVFLEKEMDKMDEQLPELTSFVLPGGHPAVSETHVARCVCRRAERLALQVQEEFAGARMVIKYLNRLSDYLFVLSRKLSKDYKAKEIPWSPR..... 182
56 8.000e-44UniRef50_A0A0B7DCT4 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=381 Tax=root TaxID=1 RepID=A0A0B7DCT4_PSEFL  ali  35  7KIYTRTGDKGETGLGDGRRVPKDHPRIEAIGEVDTLNSQVGVLLAGLIAEREELVEVLAPCQHRLFDLGGELAMPQYQA------LNEAEIERLEAAIDVWNEELGPLENFILPGGSMLIAQAHVCRSLARSAERRCQHLNAEEPLAGVGLAYINRLSDLLFVAARVIARRQGIAEILWQPAAK... 190
57 8.000e-44UniRef50_Q96EY8 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=86 Tax=Bilateria TaxID=33213 RepID=MMAB_HUMAN  ali  39  57KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIY........ 238
58 8.000e-44UniRef50_A0A2D4MYG8 Uncharacterized protein (Fragment) n=3 Tax=Euteleostomi TaxID=117571 RepID=A0A2D4MYG8_9SAUR  ali  36  1.......................DQVFDALGTLDELNSAVGLSAEFGSESGHVFVGELHKVQCMLQDVSSNVATPVSSARESHMKRTSFPVLELESWIDKYSDQLPPLTSFILPSGGKSSAALHLSRAVCRRAERRVVPLVKTGEADANVAKYLNRLSDYLFVLARFAAKQEGKKEQIYRR...... 161
59 9.000e-44UniRef50_L7MJS5 Putative cobalamin adenosyltransferase (Fragment) n=4 Tax=Ixodidae TaxID=6939 RepID=L7MJS5_9ACAR  ali  37  45KIYTRTGDKGTSATYTGQRRRKDDAVFEALGATDELNSHIGYVRSVLKH--PEVSEQLKWVQCLLQDLQASIATPLSAAQRVKTEFSPEHIKELEQWIDAHSENLPPLKNFILPSGSPAGAALHIARSVCRRAERRVTTLFLEKEVDEVVMKYINRLSDYLFVAARVCSHHENAEETIYK....... 225
60 9.000e-44UniRef50_A0A250KFL5 Cobalamin adenosyltransferase n=5 Tax=Prevotella TaxID=838 RepID=A0A250KFL5_9BACT  ali  39  2KIYTKAGDNGTTSLCDGSRLSKDDMRVEAYGTLDELNANIGLLISLLEVDSSKGIELLVEIQEELFVIGGELAGAERKAED--LISTQNLIRKLEVNIDELSSQLPVQHHFVLPGGIIPAAQSHVCRTICRRAERRIVALSHVATVSPKILIFVNRLSDYFFILSRYLNKDSGTSEKTWKNTCR... 188
61 1.000e-43UniRef50_A0A1G7R0J6 Cob(I)alamin adenosyltransferase n=1 Tax=Facklamia miroungae TaxID=120956 RepID=A0A1G7R0J6_9LACT  ali  46  2KVYTRTGDKGDTRLIGNRVVAKNDPLVEAYGSIDELNSFIGMIIAS-PNLTEEIRSDLFEIQQLLFDCGTDVANADGKIPY---RTQEKAITWLEERIDNYDKRLKPIESFILPGGTLEASQIQFARSIARRVERRLVGLPTAEKGNPNVLKYLNRLSDYLFVCGRLINHDHNQEEPQYLRSGKVFR 184
62 1.000e-43UniRef50_A0A0G0DWP4 ATP:cob(I)alamin adenosyltransferase n=30 Tax=root TaxID=1 RepID=A0A0G0DWP4_9BACT  ali  35  3KIYTKTGDSGKTSLLGGKRVCKSCIEMDAIGEVDELNAFLGVVIEEVEEDFKQEKNKLINIQRCLFVVGANLAAVQTELKNIPKLKSSEITK-LEKWIDKMEKELPPLKNFILPTGKEGAVYSFYARAICRRAERVMVGLSEKYKIDNNIKKYLNRLSDCLFVLGRWLNMNSGIEEIKWTK...... 182
63 1.000e-43UniRef50_A0A1I6H7B1 Cob(I)alamin adenosyltransferase n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A1I6H7B1_9FLAO  ali  38  2KIYTKTGDAGTTALFGGTRVPKHHIRIQSYGTVDELNSWIGLLYDQIE--SDLLRKELERIQDRLFTLGSQLATEPAKADKPLPEVTPSDILALEEAMDRMDASLEPMTHFILPGGHPIVSQCHVARTVCRRAERMSTLLNEQEPIPEAVLKYLNRLSDYLFILARKLTADLGVVERKWMP...... 187
64 2.000e-43UniRef50_A0A2E9YB38 ATP:cob(I)alamin adenosyltransferase n=9 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E9YB38_9FLAO  ali  32  2RIYTRTGDDGTTSLFGGQRLNKDDMRIEAYGTLDELNAAMGALCSSDGFINDSGVTWLQKLQSDVFTLGSHLATTDEAMVKHLPAIPVGRIQEMEDWMDTVNQSLPDLKNFLLPGGHPAISACHICRVTCRRAERRVITLARDAEVPEGILPYLNRLSDVFFMWSRQLHTALNVDEIPWKS...... 183
65 2.000e-43UniRef50_M4NHD5 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Proteobacteria TaxID=1224 RepID=M4NHD5_9GAMM  ali  35  7RIYTRTGDDGSTGLGDGSRVGKDSPRVNAYGTVDELNSTIGMLLA-ADGVDDEVREALTQVQHDLFDLGGELCIPGMA------LVEDSDIERLERILDSLNEPLPPLKEFILPGGGMAAACGHLARTVCRRAERAVITLSRTEQIRTQPQRYLNRLSDLLFVISRVLARASGHGEVLWQHERR... 183
66 2.000e-43UniRef50_A0A1F8RSX2 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A1F8RSX2_9CHLR  ali  38  9KLYTRTGDRGETGLFGGRRVPKDHPRLVACGTIDEFNAVLGAAASFIRQRS--VVDMLHAIQNELFNIGAELSSDQPVRRGKVFQLNPARARWLETLIDEYDARVPPLRTFVLPSGTTAASFLHLARAVCRRAERTVVTLARTERVNPAILTYLNRLSDLLFVLARYLNKAARRRELLWRK...... 191
67 2.000e-43UniRef50_A0A2E2Y8Z6 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E2Y8Z6_9FLAO  ali  37  2KIYTKTGDKGTTSLLTGKRVSKADMRLEAYGTLDELNSWLGVLAAEAP---DNCFPFLSQIQSELFSMGSYLA-LEGEASFPMPKLDASLVESLERQIDSWNEQLPELKNFILPSGSAASSMAQVARTVCRRAERRVVALSNEVEVKTEIPIFLNRLSDFFFVQARFILNIEGKEEIIWNPK..... 179
68 2.000e-43UniRef50_A0A0F5JDW1 ATP:cob(I)alamin adenosyltransferase n=9 Tax=Bacteroidales TaxID=171549 RepID=A0A0F5JDW1_9BACT  ali  38  6.IYTGGGDKGKTSLVGGQRVSKAHQRIESYGTIDELNSFIGLLITALD--DQADIDFLSFIQHKLFTIGSYLATDQETTEKIESKVTPESIERIEREIDRLDSELPQMKNFILPGGSRSASLAHVCRTVCRRAERQIYRLAETNPVEEPVLIFVNRLSDYLFVLARKECIRNNGKEIIW........ 182
69 2.000e-43UniRef50_A0A1F9GVN4 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_43_9 TaxID=1797867 RepID=A0A1F9GV  ali  39  2KIYTKKGDKGESGLFTGERIPKHSLFFHAYGNVDELAAILGLAVSCTTDK--EIKDIIIEIQRDLFQIGSDLSTPNAEKEKKIDRVSPEQTIKLERIIDKFDSQLPELKNFILPGGTIPASYLHFARTVCRRAERYVSALTNEGKANKEVLIYLNRLSDLLFVLARVLNNRSNIKETIWKRS..... 183
70 3.000e-43UniRef50_T2M7P1 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=5 Tax=Eukaryota TaxID=2759 RepID=T2M7P1_HYDVU  ali  36  31KIYTRTGDKGTSSLFGGERRTKDDQVFEAMGCTDELTSSIGIAKEFCLEFGHEVVQKLEEIQCRLQDINSNIATPAQVSINGDVLSFDANIDQLESWIDEYDKHLPPLKNFILPSGGKSSVSLHLARTICRRAERRLVPLLHKNMIDESVYKYMNRLSDFLFIAARFAAHKDGKNELVYKRRTKII. 218
71 3.000e-43UniRef50_A0A0T5ZPQ4 Cob(I)alamin adenosyltransferase n=6 Tax=Bacteria TaxID=2 RepID=A0A0T5ZPQ4_9BACT  ali  40  8KVYTRTGDKGQTSLVGGKRVSKSSARVEAYGDIDELNSVLGIVR--LEAEDTEIKEIITDIQNDLFIIGADLASPN---EIQVPRISKQKISELEKVIDKFLHELESLKEFILPSGSGGGPYLHLARTVSRRAERRIVRLMEEEQVNENILAYVNRLSDLLFVMARIENKRGNFEET.......... 179
72 3.000e-43UniRef50_R7F0Z2 ATP/cobalamin adenosyltransferase n=1 Tax=Prevotella sp. CAG:485 TaxID=1262927 RepID=R7F0Z2_9BACT  ali  35  6.LYTRTGDAGTTSLVGGQRVAKASPRLDAYGTVDEFSATLALILTHSDC-PPQIRTELQKVQNTLFNIGAYLATDSPEEKPAQLRGSQEQISELEQQIDTLDSQTPEIHCFILPGGTQISAFAHLSRTVCRRAERMILRLDALQKVDPLVLQYFNRLSDYFFILSRYLNHEACTEELVWNP...... 185
73 3.000e-43UniRef50_A0A1F2RYY8 ATP:cob(I)alamin adenosyltransferase n=7 Tax=Bacteria TaxID=2 RepID=A0A1F2RYY8_9BACT  ali  38  2KIYTKTGDGGETSLFDNTRVSKADPRVEAYGDIDELNACLGAVRAA--GVGPDIGAALEGIQKELFALGARLADPRIAGRVKKAAVAEADVEWLEQVIDDLEGELPSLRRFILPGGCAAGALLHLARTVCRRAERRVVGL-GAGAVEPILIAYLNRLSDLLFVMARVVNRRAGAPEIEW........ 179
74 3.000e-43UniRef50_A0A0P7WKV0 Cob(I)alamin adenosyltransferase n=308 Tax=root TaxID=1 RepID=A0A0P7WKV0_9ALTE  ali  36  7KIYTRTGDDGSTGLADGNRIAKNAQRVEAMGTADELNCHIGLLIECLD-SDDELVESLRRIQHHLFDLGGEFAIPGSK------VIGDNHIQWLEQTLDAHNEDLPPLKNFVLPGGSPAAAQCHMARAVCRRAERVVVALSHEDSINTDSRHYLNRLSDLLFVFARGLARRNGGEEILWDQKKS... 183
75 4.000e-43UniRef50_B9NRX4 ATP:cob(I)alamin adenosyltransferase n=22 Tax=Alphaproteobacteria TaxID=28211 RepID=B9NRX4_9RHOB  ali  37  6KIYTRTGDDGKTALGNGERVAKYSGRVTAYGTVDELNAFVGMARTEAEG---ETDAALARIQNDLFDLGADFCRPDMEKDYPPLRIVAAQIDRLEAEIDVMNETLEPLRSFILPGGFRLAAQLHICRTVSRRAERLAVELTNLEPVNEVAVKYLNRLSDWFFVAARCAN-NGGRDDVLWVPGAN... 189
76 4.000e-43UniRef50_A0A1F6IFP7 ATP:cob(I)alamin adenosyltransferase n=12 Tax=Bacteria TaxID=2 RepID=A0A1F6IFP7_9BACT  ali  41  3.IYTKTGDKGQTGLFSGKRVSKASLRIEAIGTVDELNSVIGLVISQIQNSKSQITNELIEIQKDLFEIGAALANPRQA------LNLSKRVKEFEKTIDKMTKELPPLFNFILPGGGVAGSTLHIARTVCRRTERRIVELSKKEKVQSDVIVYINRLSDLFLTVSRFINQKEKQKEVIWTSK..... 177
77 5.000e-43UniRef50_A0A2H9SM28 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Parachlamydia sp. TaxID=2052048 RepID=A0A2H9SM28_9BACT  ali  36  2KIYTKTGDKGETSLFNQERVPKNHAIIEALGAIDETNASMGMASALLPDGDSLQQNHLEKVQCTLFEIGALVANP---ERKINAVELTNEISALESWIDQMQATLPPLHQFILPGGHPGAAALHVARTSCRTTERRLLTL---GPFSKEILIYFNRLSDALFVAARAVNHLTGTKELIWIPKNK... 181
78 5.000e-43UniRef50_A0A1B1PZZ2 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=40 Tax=root TaxID=1 RepID=A0A1B1PZZ2_9CHLB  ali  36  2KIYTRTGDSGTTGLFGGSRVNKDDIRVECYGTLDETNASIGLLRAKLP-LDHTWQEGLFSIQTELMNSMSHLATPPDSSRPNRSPLPLGMATFCEEWIDRLEESSGPAEHFLLPGGTEISALCHIVRTQVRRGERQLVRLMREADVPPSILEFINRLSDLFFALSRAELAQSGVQEERWRS...... 181
79 6.000e-43UniRef50_A0A1Y6B386 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6B386_9PROT  ali  37  5KIYTKTGDKGETRLADGSSIAKTHPRLEAYGTVDELNAAVGWLKDTLTAYPEHIDAQLAQIQNELFDIGGEFASPQMVESRKSALINDRDVERLEQEMDRYNDELEPLANFVLPGGHPGNSAAHICRTICRRAERFAIQLKASEAIRDEPIRYLNRLSDWFFILSRHISHTLGVPELIWNQKK.... 190
80 6.000e-43UniRef50_C3J8C2 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteroidales TaxID=171549 RepID=C3J8C2_POREA  ali  36  6.LYTRTGDRGTTSLVGGQRIKKSDLRLECYGSVDELNSFIGLLRA--EELETSSAEQLAAIQNNLFVIGSNLATDTSSREKAFSQVSEEVIIALEGWVDQLDEATPPMTGFILPAGGRSAALCHVCRTVTRRVERLLYRLEEEVPVDEPLERYINRLSDYFFALARYESHRRGEPEITWQKH..... 185
81 6.000e-43UniRef50_A0A1F3MLK3 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bacteroidetes bacterium GWF2_49_14 TaxID=1797354 RepID=A0A1F3MLK3_9BACT  ali  33  2RVYTRTGDKGDTSLASGTRIRKDHPRLEAYGTIDELNAHLGVIQSGIPDPLEKQR--LTAIQNRVFIVSSTLAVDDPKFLEKLPKILDEDIADLELAMDRMLDLMPPLKNFILPAGHLLVAQCHVARTVCRRAERMMIRLGSEIDVDPLLIRYINRLSDYLFVLARKCSYDLGAGETIWTS...... 180
82 6.000e-43UniRef50_S6GHX7 Cobalamin adenosyltransferase n=2 Tax=Oceanospirillaceae TaxID=135620 RepID=S6GHX7_9GAMM  ali  39  12KIYTRGGDKGKTSLALGGRLSKADDHIKALGEVDELNCQLGVLIATLP-AGQPLQPALLQIQNILFDIGAELAMNNDD----YPPLAQQCIDSLEQQLDQLNSQLPPLHEFILPGGNISAAHCHLARAVCRRVERQLIQLATEKKSFPQASKYLNRLSDYLFVAARYLNLQAGGSEVFWQPSNK... 190
83 7.000e-43UniRef50_A0A2D7MPY8 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2D7MPY8_9FLAO  ali  31  4KVYTRKGDDGSTSLLDGQRVSKDHIRIEILGDLDELNSWLGFINS--EGLASAQREFIIHLQKALFNLGASIACPDSEKADEFLKNWCALPEEMENEMDRLSESLDELQWFILPTGDPIISRIHVSRAICRRTERKIAQFAKEATLNPLIQMIINRLSDYLFVLARHIHHKMGVAETPWNS...... 182
84 7.000e-43UniRef50_A0A1V5N6D2 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Bacteroidetes bacterium ADurb.Bin408 TaxID=1852813 RepID=A0A1V5N6D2_9BA  ali  39  4KIYTKKGDKGETSLIGGKKVTKFDIRVEAYGTVDELKSYLAIIKDT--EDNPALTKIISHIQERLFRVESQLACNEMLISKKLPSLTQRDVQFLEKKIDHMEAMLPPLKNFIIPGGQLASSHCHVARCICRRAERIIVNLNSQEPVKPVILSYLNRLSDFLFMLARYLCLKRNCNDNIWSQPK.... 184
85 8.000e-43UniRef50_I0JJV9 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=378 Tax=cellular organisms TaxID=131567 RepID=I0JJV9_HALH3  ali  39  2RIYTRSGDKGQTSLIYGNRVAKNDIRVEAYGTCDEANSTIGLALSHLTKEDDSFLEAMQRIQTILFHVGAELATPKGKEVKWQVK--KEHIEELEQQIDKWDEDLIPLKNFILPSGHSASAGLHLARTVVRRAERSAVALEDEL-VNPLVVSYLNRLSDLLFVAARYVNQQLGGKETP......... 180
86 8.000e-43UniRef50_F6ADD5 ATP/cobalamin adenosyltransferase n=198 Tax=Bacteria TaxID=2 RepID=F6ADD5_PSEF1  ali  35  7KIYTRTGDAGQTGLADGRRVPKDHPRIEAIGEVDTLNSQLGLLLADLIEQQAELIEVLAPCQHRLFDLGGELAMPEYHA------LQAAEIERLEAAIDRWNEEVGPLTNFILPGGSRLIAQAHLCRSSARTAERRCGQLHAVEPLRGELLAYINRLSDLLFVAARLIARRQGIDEVLWQAAPK... 190
87 1.000e-42UniRef50_UPI00041DD360 cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Lacticigenium naphtae TaxID=515351 RepID=UPI00041DD360  ali  42  2KWYTKRGDNGNTNVIGGRTVKKTDVLIEAIGSLDEVNAFLGDSIARLESDNEEIKVELIEIQHYLFDLGTDIA---DIRKKLDKKITDEEIEWLEKRIDMYSEKTPPIEAFILPGGHPAAASLHIVRTVTRRAERVIVRLHEEVELDSEVLIFINRLSDYLFVLSRYINFKMKVEEPIYERGGKVF. 184
88 1.000e-42UniRef50_A0A2A5FIY4 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A5FIY4_9BACT  ali  33  2RIYTRTGDDGTTGLFGGTRLKKDNVRIEAYGTVDELNAFLGKLIEHDALSPH--LGFFRDIQSQLFLLGSHLATIDPKMKAGLPPFDSKATTEFEKWMDEVDEKVPVLKNFLLPGGHPSVADAHVARAVCRRAERRCVSLAEVESIDSELIVYLNRLSDLLFTTARYLSFVTETEEIAWKTR..... 181
89 1.000e-42UniRef50_A0A2H6AK78 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2H6AK78_9BACT  ali  42  8RVYTRTGDDGQTSLIGGIRVSKASPRVEAYGEVDELNSVLGIVK--LQAKDGYIKEIVSEIQNDLFIMGADLASPPQV---QVPRIDEGRVKRLEEFIDRFLEELEPLKEFILPGGSGGGAYLHLARAVSRRVERRIVKLMEVEELNKNILAYINRLSDLLFVMARIENKRANFEET.......... 179
90 1.000e-42UniRef50_A0A1J5KNI0 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteriovoracales TaxID=2024979 RepID=A0A1J5KNI0_9PROT  ali  37  9KVYTRTGDAGKTALVGGERISKSDDRIDLYGEVDELNSFVGLARSIMSSDEKRAEFLLEELQVLLFDIGSNFACLQEGREKYKPQISAENVDKLEKYIDVIEAKLEPLKYFILPAGSQMSSTLHICRTVSRRVERKAVKFNHQDDLPEEILKYLNRLSDYFFVLARLANKDNSGKEVFWMPRK.... 195
91 1.000e-42UniRef50_A0A1H8ENQ2 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Prevotellaceae TaxID=171552 RepID=A0A1H8ENQ2_9BACT  ali  36  5KVYTRTGDQGQTSIVGGFRVSKASERLEAYGTVDELSSHLGLLAAMLSEG--EYHDMIIRIQNNLFNVCTNLATDQSQTPYDSAKLADGEIELLESEVDRMMKLLPERQGFILPGGTQVAAQAHVCRTVCRRAERRIVALSVVAQISPETLQYVNRLSDYLFVLAKIINFNAGVSEIIWQNVCK... 187
92 1.000e-42UniRef50_A0A2G6MP11 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Desulfobacterales TaxID=213118 RepID=A0A2G6MP11_9DELT  ali  36  2KVYTGTGDKGTTSLFSGERLRKSDPRIEAYGEIDELSSVIGTIKAAWDVEVPELALQIDRIQGQLLDAGAWMATPGASSASFLTPFTQEPAKELESAIDRMSDQLPELRQFILPQGHLSAAMAQTARAVCRRTERRVIAFVTQEDGDTNILVFLNRLSDYLFVLARYLNKLHGIEDTPWVR...... 190
93 1.000e-42UniRef50_A0A0F9ZIQ4 ATP/cobalamin adenosyltransferase n=28 Tax=Bacteria TaxID=2 RepID=A0A0F9ZIQ4_9BACT  ali  43  2KIYTKTGDQGQTSLFGGKRVSKDDLRVECYGTVDELNSFLGLAKSFLD-KNSLIQKKLENLQNDLLRLGSDLATPLEQKNLNIKRIDIEDVENLEKWIDEMDKILKPLNKFILPGGSSAESAIHCARSICRKAERRLVTLMRTEKINDQALKYLNRLSDALFTLARFLGK................. 170
94 2.000e-42UniRef50_A0A2M7YRE5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=bacterium CG_4_9_14_3_um_filter_65_15 TaxID=1975567 RepID=A0A2M7YRE5_9BACT  ali  38  2RIYTRTGDQGQTSLGDGTRLPKSAPRIDLYGDIDELNSVLGCCLSVLPAEQEGTLATLHEIQDQLFALGMVIADPGRCRAGQNQEQASFPVKRLEDLIDGLDRDLPPLKNFILPGGTSASGFLHLARTVCRRCERKAVALAADEPVPASAVIFLNRLSDFLFTAARSANLAARVDDVPWAP...... 186
95 2.000e-42UniRef50_D9RTG4 ATP:cob(I)alamin adenosyltransferase n=17 Tax=Bacteroidales TaxID=171549 RepID=D9RTG4_PREMB  ali  39  2KIYTKTGDKGMTSLCDGSRLSKDDMRIEAYGTLDELNANIGLLISLLQDTFVSLIDFLVEIQEELFVIGGQLACAEIKEDDRFCT--QKLIKEIEINIDKLSSQLPVQHHFVLPGGTLPAAQSHVCRTICRRAERRIVTLSHIAIVSPEIFKFVNRLSDYFFILSRYLNNDSSLSEKTWKNTCR... 190
96 2.000e-42UniRef50_A0A1F3FV71 ATP:cob(I)alamin adenosyltransferase n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3FV71_9BACT  ali  40  3KIYTKTGDKGQTSILGGKRLSKDNLKIEAYGTVDEINSHVGLLRDNSN--NEEIKTWLLEIQNNLFICQTNLALDPEAKLQNIPEIKEEDIKKLEKWIDNMDKDLPPLSSFILPGGHPLSSFCHIARTICRRAERDIIRYINSDRAYPMVIKYINRLSDFLFTLARYFNKINDTKDIPWEKR..... 185
97 2.000e-42UniRef50_A0A1K2I8E0 ATP:Cob(I)alamin adenosyltransferase n=6 Tax=Lactobacillus TaxID=1578 RepID=A0A1K2I8E0_9LACO  ali  45  3.LYTKTGDQGMTKLIGGSQVSKDSDRVQAYGTIDELNTWVGLCVADFDGNFKHLADELQQLQQLLFDLGTDLANPELTMQQM--RLNKQAVDWLEGKIDYYQDIPPAVTHFILPGGSKAAALLQVCRTITRRAEHKMVTLNWTATLPPVLLQFINRLSDYFYALARFTNFKKGVKDVYYEKGRSVFK 186
98 2.000e-42UniRef50_A0A0D0T823 YvqK protein n=229 Tax=Bacteria TaxID=2 RepID=A0A0D0T823_PSEFL  ali  34  7KIYTRTGDKGETGLGDGRRVPKDHPRVEAIGEVDTLNSQLGLLLASLEEQSNDVIEVLTPCQHRLFDLGGELAMPVYKA------LNAAEVDRLEAAIDRWNEEVGPLENFILPGGSALIAQAHVCRSLARSAERRCQHLNALEPLEGVGLAYINRLSDLLFVAARVIAKRQGVAEVLWQAAAK... 190
99 2.000e-42UniRef50_A0A0U4WMY8 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=102 Tax=Bacteria TaxID=2 RepID=A0A0U4WMY8_9BACL  ali  37  2KIYTKSGDKGETSLVYGVRVSKTDVRVEAYGTCDEANSAIGLGLSYISRDTEWFHHVFHVVQTKLFHIGAELATPQ--GKDVGWKIEESDVSFLEKTIDEWDAELPSLTNFVLPSGSPAGAAFHLARTVARRAERQAIAVQADGEVNPIVIRYLNRLSDFLFVAARYVNQKQGTVEPT......... 179
100 2.000e-42UniRef50_H1Q415 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Prevotella micans F0438 TaxID=883158 RepID=H1Q415_9BACT  ali  34  5KIYTRTGDTGETDLRHNLRVRKTDPRIEICGTLDELNAHIGLLVAQLANNNHK--EELNNVQSSLFTIGASIVS------DASVKIEGMSAQTLEQLIDGMQEQLPPQHCFVLPGGCIQAAQAHVCRTVCRRAERLITGLETLKSIHPETLAYMNRLSDYFFVLSRHLNMLSNTPEKRWGP...... 177
101 2.000e-42UniRef50_A0A286RJ80 ATP:Cob(I)alamin adenosyltransferase n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A286RJ80_9PLAN  ali  33  4KIYTRSGDSGETGLYRGPRVGKDCLRIETCGTIDELNSAIGLIRA--ERIPPRADALLATIQNWLFELGAEVATPDPQRQGTQY-ITPEYVRELEEAIDQLDAELPPLDRFILPGGERAGALTHFARAVCRRAERRLVALVRETPLSPVVLAFINRLGDFLFVLARWLNHQAGVVEHPWEPPPR... 189
102 2.000e-42UniRef50_A0A068NYV9 ATP--cobalamin adenosyltransferase n=1 Tax=Fimbriimonas ginsengisoli Gsoil 348 TaxID=661478 RepID=A0A068NYV9_9BACT  ali  37  2KIYTRAGDDGTTGLYGGKRVAKTSARIHAIGDVDELNASLGVARGLADGA---IRDDLAKLQSWLFDLGGELACPPGGKFDVRTIGVG-HSEYLERSMDEQTKLLPPLRAFILPGGTSLSGELHRARTICRRAERSVLELAEVAPVREEARAFLNRLSDWLFTAARTANAEQNVHDIEWHPSEE... 181
103 2.000e-42UniRef50_A0A2J6HCQ3 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2J6HCQ3_9BACT  ali  35  7KIYTKKGDKGQTSLIGGTRVDKNNIRVEAYGTIDELKSFCGLLHDYMQAGDSK--DFLRGILEDLFLIESHVATPEKADQKFFPELSEEMVLKLEREIDRMNEELPELQHFILPAGHPAVSTAHICRTVCRRAERRVLDLVTTAPCNDITIKYLNRFSDFLFVLARFLAKENGAGDVEWR....... 185
104 2.000e-42UniRef50_H2LT81 Methylmalonic aciduria (cobalamin deficiency) cblB type n=34 Tax=Opisthokonta TaxID=33154 RepID=H2LT81_ORYLA  ali  38  51KIYTKTGDKGFSSTFTGERRPKEDHIFEALGNTDELSSAIGLAREFCLEKGHTFIHQLDKIQCILQDVGSNIATPRSSARDSHIKKTKFTSQDLETWIDNFTNELPPLTNFILPSGGKSSAALHLARTVCRRAERSVAPIVRSGEADQDVAKFLNRLSDYLFTVARYAAMKEGNEEKIYKRPE.... 236
105 2.000e-42UniRef50_O34899 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=540 Tax=Bacteria TaxID=2 RepID=PDUO_BACSU  ali  49  2KLYTKTGDKGQTGLVGG-RTDKDSLRVESYGTIDELNSFIGLALAELSGQPEDLTAELLTIQHELFDCGGDLA---IVTERKDYKLTEESVSFLETRIDAYTAEAPELKKFILPGGSKCASLLHIARTITRRAERRVVALMKSEEIHETVLRYLNRLSDYFFAAARVVNARSGIGDVEYERSAIVFR 186
106 3.000e-42UniRef50_A0A0M8KD96 ATP:corrinoid adenosyltransferase n=1 Tax=Candidatus Symbiothrix dinenymphae TaxID=467085 RepID=A0A0M8KD96_9BACT  ali  36  5KIYTGTGDTGFTSLVGGKRIAKTDLRIDAYGTVDELNAFIACLLDEVEEAHD--RQFLLQVQHDLFNLGAYLATEGGLARFEGGLGAA---DALEAEMDKIAALVPPSNKFILPGGCRSNSLAHVCRTVCRRAERCLYTLSERDLVDAAALKYINRLSDYFFLLARKQSFISKQAEIFWENTCK... 183
107 3.000e-42UniRef50_Q6MMM3 Cobalamin adenosyltransferase n=14 Tax=Bacteria TaxID=2 RepID=Q6MMM3_BDEBA  ali  40  18KIYTRTGDKGSTRLVDGSCVEKFNPRVEAYGTVDELNSYLGVVRSTLAPFPEELNHSLEKVQNELFNIGSLLATEKDEVFKLLPPITEEQIRYLELQIDELTTTLPELRNFILPAGHPTSAHLHVARTLCRRSERRSAEIAVKDERYSMTLQYLNRLSDYLFVAARWANMKHGVADVLWKK...... 200
108 3.000e-42UniRef50_R5WCQ0 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Alistipes TaxID=239759 RepID=R5WCQ0_9BACT  ali  32  2KIYTKGGDQGSTSLIGGERVPKYDVRVEAYGSIDELSAQTAMLRDMLNGEDVTQFDDDLIVISRLLMHTESLMALGHGSEDKVKDLNGADIGFLEKRIDEISAVLPPIERFTLPGGHIVVSQAHICRTVCRRAERQACRAAAQYPVSSNALMFLNRLSDYFYVLGRRLAMLLGAEEILWEP...... 182
109 3.000e-42UniRef50_A0A1Q7SNT3 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Ignavibacteria bacterium 13_1_40CM_2_61_4 TaxID=1805219 RepID=A0A1Q7SNT3_9BACT  ali  41  5.VYTRRGDKGETSLFGSRRVSKDSPRIEAYGSIDELNSCIGVAISFS--TSEGVSTLLKKVQKLLFVAGADLATEARGAGEKVPRIRKEDTRWLEKESDELLTKLPPLKNFILPGGGQSAANLQLARSVCRRAERRIVAVGRVEAINPELIPFINRLSTYLFNLARYSNFIEGRQEEAWKK...... 184
110 5.000e-42UniRef50_V6HEJ6 ATP:cob(I)alamin adenosyltransferase n=7 Tax=Leptospira TaxID=171 RepID=V6HEJ6_9LEPT  ali  39  2KIYTKKGDSGTTSLANGLRVSKADDRVELYGTADELNSSLGVASAFLK-SDSKLRASLERIQNLLFELGSELAG--YRKDDGTSCLLEEDTLQLEREIDEWQNSLTPLKHFILPGGSQASALLHVSRTLARRLERELVKAKDRMEIHPETLKFLNRLSDHLFVAARYANFESNIKEPQWQSRAK... 183
111 5.000e-42UniRef50_Q9KCH6 BH1595 protein n=36 Tax=Bacteria TaxID=2 RepID=Q9KCH6_BACHD  ali  47  2RLYTRTGDKGKTSVIGG-RLAKDDTRVVAYGTTDELNSFVGLAITQLENTFADIRGELFKIQHELFDCGGDLAMLKVKEDRPY-KAKQEIVDFLEQRIDAYIKEAPELERFILPGGSEAAASLHVCRTIARRAERYVVRLQQEGEINPIVLKYLNRLSDYFFAVARVVNSRLQVPDVEYERSAIVFR 187
112 6.000e-42UniRef50_A0A1B2F7G9 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=13 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1B2F7G9_PSEPU  ali  35  7KIYTRTGDKGETGLGDGRRVPKDHPRIEAIGEVDSLNSQLGVLLAGLQAEAEELIEVLAPCQHRLFDLGGELAMPSYQA------LDLGEVERLEAAIDRWNEELGPLKNFILPSGSALVAQAHVCRSQARSAERRCQQLNAIEPLEGVGLAYINRLSDLLFVAARIIGRRQGVAEVLWQAAAK... 185
113 7.000e-42UniRef50_A0A150LHB3 ATP:cob(I)alamin adenosyltransferase n=41 Tax=Bacteria TaxID=2 RepID=A0A150LHB3_9BACI  ali  38  2RIYTKSGDKGTTSLVYGQRIPKNDLRVEAYGTCDEANSMIGLAMSHLQTNKDEVNEAFHKIQTILFHVGAELATP--EGKEVKWKLTDEDIKDLEHTIDKWDASLEPLKNFILPGGHPAGATLHCARTVIRRAERCAVAIEH---VNPLVLAYLNRLSDFLFVAARYINNGLGEQEKT......... 178
114 7.000e-42UniRef50_UPI0008DA8517 cob(I)yrinic acid a,c-diamide adenosyltransferase n=3 Tax=Bacteroidales TaxID=171549 RepID=UPI0008DA8517  ali  39  3KIYTKGGDKGRTGIHGGQRVEKDDIRIEANGCIDELNTVIGIVRSLLP-QEHNYQETLHVIQRELMVVMSHVATPAVIRHENPNALQQDISIFCESEIDRLTELLQENEYFVLPGGTPACAQLQFARTVTRRAERRLWTLHREDPLPEEILRFMNRLSDLFFVMARYELQQQGWPEERWQ....... 181
115 7.000e-42UniRef50_UPI000C070B82 cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Butyricimonas sp. Marseille-P3923 TaxID=1987504 RepID=UPI000C070B82  ali  35  2RIYTKGGDKGTTGIHGGSRVDKDDIRIEANGTLDELNASLGVIRALLN-KEDERQEVLAYLQRSLMTVMSQVATPSAIRAQNPNKLPEALDTFCEQQIDRMNNEMHPSTHFVLPGGTMISAQCHVARTIARRAERRLWTLNRTDEVPPLILRFMNRLSDLLFTMARWDMDKEGSEEEKWK....... 181
116 8.000e-42UniRef50_T0SRN3 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Bacteriovoracales TaxID=2024979 RepID=T0SRN3_9PROT  ali  40  5KVYTRSGDKGQTGLVGGSRISKGSDLIDLYGEVDELNSHLGVATTLIN--DKALLEDLHTIQVKLFDLGSNLACEVEKRQFKLPQLSKQDVDWLEQKIDKLDTELEPLKYFVLPGGSQACAVLHVCRTVCRRVERKMVAHLAVEDTPESSREYINRLSDYFFVLSRYINKVEGKAEIYWVPKKD... 187
117 8.000e-42UniRef50_A0A2G1ZXE0 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Coxiella sp. (in: Bacteria) TaxID=59288 RepID=A0A2G1ZXE0_9COXI  ali  36  6KIYTRTGDSGETHLAGGHRVKKTSRRMVAIGDIDELNSWFGMVRARGTAELHEFIQQSLTIQQHLFNLGAELAILPDDRRDNSPRIIQENIDTLEQQIDTMNADLPMLKSFILPGGNDVSATAHIARSMCRRAERSLFSLADDAHIEPLPIQYINRLSDWLFVAARFICQKSQVSETLWV....... 187
118 9.000e-42UniRef50_A0A2D5N973 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Cryomorphaceae bacterium TaxID=1898111 RepID=A0A2D5N973_9FLAO  ali  35  2KIYTKTGDKGQTSLLSGSRVSKAEMRLEAYGSFDELNSHLGVLAATLPSDQFPYAQAI---QSELFAMGSHLA-VEGTPEFPMPQFNEDLVGQLERQMDQWNEILPELKSFILPGAHTQSAHCHVARTVCRRAERRVVALTNEVAVVGEIISFVNRLSDFLFVMARWIDFSNGAPDRIWTPK..... 179
119 9.000e-42UniRef50_A0A2V1IJ17 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Muribaculaceae bacterium DSM 103720 TaxID=2094237 RepID=A0A2V1IJ17_9BAC  ali  39  6.LYTRTGDAGMTSLVGGKRVAKNSPRVNAYGTLDELNAHIGLVQAHCAQLDNFVTATLLSINNTLFNLGAYLATPPAPAPPQSLRVIPDRIAELEQQIDTLDGSVPEQRTFILPGGSIGAAHAHVARTVCRRAEREILNLADTGEVAPIVLTYINRLSDYLFILARYINHFTGTPDIPWQQS..... 193
120 1.000e-41UniRef50_A0A1G2ATE4 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Kerfeldbacteria bacterium RIFCSPHIGHO2_02_FULL_42_14 TaxID=1798540 RepID=  ali  40  14RIYTKTGDRGMTGLFGSKRVSKNTLRIHAYGSVDELNTCIGYLIALLKSARGQLSKELQNIQRTLFVIGAQLATPQ-DATLSIPRITEQVVRDIEQGIDVRDAQLAPLTHFLLPSGTPAASWCHVVRTVCRRVERDLVALHEQEPVSEVLLQYMNRLSDYFFVVARFLNQQAGVSESEWRTHTK... 203
121 1.000e-41UniRef50_A0A136KJJ5 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=candidate division WS6 bacterium OLB21 TaxID=1617427 RepID=A0A136KJJ5_9  ali  34  2KLYTKTGDKGTSGLFGGERLPKSHPLFDLIGTIDELNAHLGEILLLVKDY-QDIKEVLLRVQADLFVLGSMVATPKESKYYDIPQLKKSKVQELEKEIDNWVENTPELKNFILPGGSKVSAKLFIARSVCRRAERLVYADKIDSLSNPEVISYLNRLSDWLFALARYTNKLSDCDEIIWKS...... 183
122 1.000e-41UniRef50_I4Z8S2 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Prevotella bivia TaxID=28125 RepID=I4Z8S2_9BACT  ali  37  2KIYTKTGDAGKTSLIGNTKVDKDDTRVEAYGNIDELNSHIGLLISTAGITD-EIGDFLHHVQGNLFLLSSLMASEKYNEKYEIDATEIE---KVEEEIDRLTAMLPKKFSFVYPGGNLASSESHICRTVCRRAERRVVTMSRTMNAGMNTLPYLNRLSDYFFTLARYINYRDNVDEKKWEISCK... 181
123 1.000e-41UniRef50_UPI000712261A ATP cobalamin adenosyltransferase n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI000712261A  ali  31  35.IYTRTGDKGSSSLYNGERRKKYDDVFHALGNTDELNSFLGFARGFAEKSNNGLAPKLIEIQSRLFDLGAAIATPPHTSESKRTKFPEDNVTVLERWIDELDAKLPPFKTFTIPSSAEGGASLQMCRSICRRAERSVVPLVEREEVDPTVQRYLNRLSDFLYVASRWSVEFDKVEEVPWVPHKK... 220
124 1.000e-41UniRef50_S7V5X4 ATP/cobalamin adenosyltransferase n=5 Tax=Desulfobacterales TaxID=213118 RepID=S7V5X4_DESML  ali  38  2KIYTGGGDRGKTSLFSGERVDKSDDRVEAYGDIDELNAVMGALTASLTGDRTSIREEVHGIQKDLMVIGALLATTPDAPHFGSLRIGPDRIRALESAMDRMDLELPPLKSFILPGGSIPAAWAHVARTVCRRAERRIIRLGERGVVDQDLLTYINRLSDYLFMLARYCNLAAGVTDIQWK....... 188
125 1.000e-41UniRef50_A0A174TT19 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=22 Tax=Bacteria TaxID=2 RepID=A0A174TT19_9FIRM  ali  35  2KVYTKKGDKGTTSLVGGQRVPKNHPRLEAYGTVDELMSFTAYLRDNLNDTPSPYRDDLLAVLDHLMRAASHLATEG-EAPKYLPEFGPEKALFLENRIDAMQSTLPAIAKFTLPGGHPAVSLCHICRTICRRTERIVLTLSEQYTVNEYIRQYINRLSDYFYVLGRRLTEDFNVKEILWV....... 182
126 1.000e-41UniRef50_A0A2E6VP97 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E6VP97_9DELT  ali  40  2KLYTKKGDTGDTSLFGGQRVSKNNERVTAYGDVDEANSFIGFAASSAS-TPEALRGPLQAVMSDLFDLGAELATPPLQKDKLEKKIDQDRIKHLEQWIDEADAQLPPLTHFVLPAGTEAAGALHVARTVVRRAERSVVALDPDHGIRSELYVYLNRLSDLLFIWARLANHEAQVAEIQWIPSKD... 190
127 2.000e-41UniRef50_A0A1V5H3T3 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1V5H3T3_9BACT  ali  37  6.IYTKSGDKGKTSLVGGTRVKKTHVRLEAYGTIDELNSFIGWLNCEVK--DEETNWFLSYLQHKLFTVGSYLATETEQSPKAVSIITDGDIEKIEKEIDRIDNNLPKLKRFILPGGNETASRAHVCRTISRRAERNVYRVADEFPVDASVFKFLNRLSDYFFVLARYESNKTG-KEIYWE....... 182
128 2.000e-41UniRef50_A0A212JHD0 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=9 Tax=Bacteroidales TaxID=171549 RepID=A0A212JHD0_9BACT  ali  36  6.VYTKTGDKGTTSLVGGKRVVKSHVRLEAYGTADELNSFVGFLTEEID--DEHDLETLSYIQHKLFTVGSYLATETEAIPPKAASIITEKDALLETEMDRMDSELPPLRQFVLPGGSESASRAHICRTVCRRTERCIYRVKEEFPVDEHVLMFVNRLSDYFFLLARKESNKKG-KEIFWN....... 182
129 2.000e-41UniRef50_A0A2H0BH92 ATP:cob(I)alamin adenosyltransferase n=3 Tax=candidate division WWE3 TaxID=422282 RepID=A0A2H0BH92_9BACT  ali  37  2KIYTRTGDNGKTSLFTGERTSKDALRIICIGTIDELNAAIGVVVSQLKNTPEDTAIRLRTIQRKLFTTGSSLA-------NSNLSITQEDINNMEASIDYLTDHLPTLNNFILPGGSQAASSCHLARTICRRCERLLVTLNNTESIDPLVLQFFNRLSDYLFTIARAININEGTGEIIWNRH..... 178
130 2.000e-41UniRef50_A0A242DB76 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Enterococcus sp. 3H8_DIV0648 TaxID=1834178 RepID=A0A242DB76_9ENTE  ali  45  3.IYTRYGDRGYTKLVGGGRAKKNAPRVEAYGSIDTLNAQVGLTVASLDAQENSLYTELVQVQQWIFDCGSDFATP---EEKRPYKIEPQMIEWLEEKIDFYWTASPKIDRFIIPGGTVSAANLHLCRCFTREAERNAVSLLEQQEINKEALKFLNRLSDYFFVLARWVNGQAGQSEVFYENSVSVF. 185
131 2.000e-41UniRef50_A0A1D2NA56 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2NA56_ORCCI  ali  37  24.IYTKTGDKGFTSLLTGKRLPKDDRLFEALGTIEELSSHIALACEFAREYGHGYNEKFRRIQCILQDIVSMIATPKSSANESQLKGVGFHVKELEEWIDRYMNNLPPFEKVILPGGGKPNASLHIARTVCRRAERAIIPLVRDNEVDEQALIYLNRLSDYLFTVARYAAKLDRQNETIYIR...... 208
132 2.000e-41UniRef50_A0A2E1C040 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2E1C040_9FLAO  ali  36  2KIYTRKGDSGYTSLIDGEIVNKYNLSVDAYGTIDELNSFIGLLKDYIK--DDKIKGVLNNIQSKLFSIGSILASGKNQNISKKVKIQKKDVEYIELEIDRLDEYLPELKNFIIPGGHRTSSYSHVCRSVCRRAERIISELNNKSSVNPNILAFLNRLSDFFFVLSRFLKHSDNISESHW........ 178
133 2.000e-41UniRef50_A0A1Z1NMB9 ATP/Cobalamin adenosyltransferase n=130 Tax=Aeromonadaceae TaxID=84642 RepID=A0A1Z1NMB9_AERSA  ali  40  2RIYTRQGDKGMTRLADGVQLAKDELRVETYGYIDELNSHIGLLIAEVPAAETGLLADLVLLQQELFDLGGELAFSSDGQHEAIWQVNNEWTLRLEQQIDAYSANLPLLRNFILPSGSRAASQAHVVRTLTRRCERLLLSLSRAEQINPAILPYVNRLSDWFFTIARYLLACTGTPEVLWVKAAE... 185
134 2.000e-41UniRef50_UPI000646AEAA cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Alistipes sp. ZOR0009 TaxID=1339253 RepID=UPI000646AEAA  ali  34  2KLYTKTGDKGNTSLASGTRVSKTHPRIEAYGTVDELTAYVGLIRDTSD--DQYVKEVLLEVLDRLMTIGGILSFEKVDHGYKIPQIISDDFTYIEAKIDEFTAEVPAMRSFVIPGGTILSSHCQIARTICRRAERAVLRLSEESEVPEQCTQYLNRLSDFLFILARKCVKDANINEIPWHPRVD... 183
135 2.000e-41UniRef50_A0A1F4ZDL2 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Patescibacteria group TaxID=1783273 RepID=A0A1F4ZDL2_9BACT  ali  39  2KIYTKTGDRGRTGTFYG-RMGKGDQLAEALGAIDELNSWVGTCRSRFKIQDSVIEKELKRIQTNLLTIGSGLAGSGLKLR-------YQEIKNLENKIDKWTRDLPKLANFVYPVGE-----LQVARSVCRRAERRVVALGIKE---KNTLKYLNRLSDALFVMGRWINHKLKIPEEVWRG...... 168
136 3.000e-41UniRef50_A0A2H5WVX5 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=171 Tax=Bacteria TaxID=2 RepID=A0A2H5WVX5_9BACT  ali  42  2RIYTRTGDTGETGLIGGQRVPKDDVRVEAYGTLDELNAALGLARCYIPH--EDLNALLERIQSQLFDIGAELALPPERAAQFXXXXXXXXXXX-XXXXXXXXXXLEPLRQFILPGGTLAAAALHLARTICRRAERRVVTLSHHSSVSGGIIQYLNRLGDLLFVMARVANHRAGVSDVPWKRTQ.... 181
137 3.000e-41UniRef50_A0A2K9NX21 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteriovoracales TaxID=2024979 RepID=A0A2K9NX21_9PROT  ali  37  6.VYTRTGDKGTTGLVGGTRIKKSDPRIHLYGEVDELNSHIGMAMSLLEKDFD--QTLLRKIQSSLFDLGSNLACEKEKRAQFKLPQIKDTILKLEKEIDEMDAHLEPLKHFILPGGHPAAAAFHVCRTVCRRIERQMVDFAHNGEVPEKALTYINRLSDYFFMLSRFINAKKHIKEPIWI....... 185
138 3.000e-41UniRef50_E8REI1 ATP/cobalamin adenosyltransferase n=17 Tax=Bacteria TaxID=2 RepID=E8REI1_DESPD  ali  37  2KVYTGGGDKGKTSLFSGERVPKHHIRIEAYGDLDELNSMLGAVAAYLPEGEQAIRGDFEQIQSHLFLAGAWLATPDSSATGYLTALPVNVSKDLEKRIDALSDVLPVLKEFILPGGQPVAAWAHVARTVCRRCERRLTELIEVSPDAGNIQVYLNRLSDYLFVVARYLNQLLGTADKTWKK...... 188
139 3.000e-41UniRef50_A0N0H2 Cob(I)alamin adenosyltransferase (Fragment) n=5 Tax=Eukaryota TaxID=2759 RepID=A0N0H2_BLAEM  ali  36  21KIYTKTGDKGTSSLYNGERRSKTDAVFEALGSVDELSSSIGVAAEYCGQAGNGLAEQLQEIQCVLIEMGSNIATPRQSSADAPYKFDEAHVAQLEAWIDALDATLPALTNFILPSGGLAAAHLHQCRSVARRAERSLVPLAAADEVDAGVTQYANRLSDYFFVAARHAAKHEGQVERVFVAKRVVER 212
140 3.000e-41UniRef50_Q2SZ09 ATP:cob(I)alamin adenosyltransferase, putative n=1384 Tax=root TaxID=1 RepID=Q2SZ09_BURTA  ali  36  7KIATRTGDDGTTGLGDGSRVRKDDARIAAIGDVDELNSQIGVLLA--EPLPDDVRAALSAIQHDLFDLGGELCIPGHAA------ITDAHLARLDGWLAHYNGQLPPLEEFILPGGARGAALAHVCRTVCRRAERSIVALGASEPLNAAPRRYVNRLSDLLFVLARVLNRAAGGADVLWDRTR.... 181
141 3.000e-41UniRef50_A0A224WAB3 ATP:Cob(I)alamin adenosyltransferase n=28 Tax=Bacteria TaxID=2 RepID=A0A224WAB3_9NEIS  ali  35  7RIVTRTGDDGTTGLGDGSRVAKDCTRVQALGDVDELNSVLGVLLA--EDLPVEVAQRLLAVQHDLFDLGSELAVPGYAALK------PEHVAMLEEWVSQMNADLPMLKEFILPGGSRPAGLAHQARSVCRRAERALVAASHEGEVSPSARQYLNRLSDALFILARHLNKVLGQPDVLWQPHRR... 182
142 4.000e-41UniRef50_A0A2C9ESM0 Cob(I)yrinic acid a,c-diamide adenosyltransferase YvqK n=88 Tax=Proteobacteria TaxID=1224 RepID=A0A2C9ESM0_PSEPH  ali  35  7KIYTRTGDKGETGLGDGRRVPKDHPRVEAIGEVDTLNSQLGLEQSGACPGLEEVITVLAPCQHRLFDLGGELAMPVYQA------LNEAEVQRLEAAIDLWNEELGPLENFILPGGSALIAQAHVCRSLARSAERRCQHLNAVEPLQGVGLAYINRLSDLLFVAARLIAKRQDIAEILWQAAAK... 190
143 4.000e-41UniRef50_A0A2B4RX01 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=4 Tax=Eukaryota TaxID=2759 RepID=A0A2B4RX01_STYPI  ali  36  50KIYTRTGDTGYTSTYGGERRAKTDQLFEALGENDELNSFIGLASEFCEEAGHKDVKKLEQIQCILQDIGSNIATPRQSSSERKTEFNQENVKTLEEWIDSYHMQLPSLRNFILPSGGKSSAMLHVARSVCRRAERRVVPLVQSGSVDPHVGTFLNRLSDFLFTTARFVAKEEGKTEKIYRRVQR... 237
144 4.000e-41UniRef50_G6CGM5 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=63 Tax=Bacilli TaxID=91061 RepID=G6CGM5_LACCU  ali  54  2KLYTKTGDKGLTRIIGGQKVRKNAIRVEAYGGVDELNSYLGVVISDLPDYPA-LRMELVEIQQILFDCGTDLATPDDSRGY---RTDNAYTKWLEAKIDQYADVPPALKEFILPGGVPSAAKLQYCRTIARRVECQVVALQEVEPINEAVLTFLNRLSDYLYAIARYVNHEEGEPETVYRRNKTIF. 183
145 4.000e-41UniRef50_W9AG67 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=17 Tax=cellular organisms TaxID=131567 RepID=W9AG67_9BACI  ali  39  2RIYTRSGDKGQTSLIYGKRVAKNDLRVEAYGTCDETNSMIGLGVSFLDEEAFEGKDIMQRVQTILFHVGAELATPQ--DKEVTWKLKQEHIEELEKEIDEWDATLEPLKNFILPSGHRAASALHAARTVARRAERTAIGVE---EVNPLVVSYLNRLSDYLFVAARYVNKQLGRTE........... 176
146 5.000e-41UniRef50_A0A2E1MF77 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E1MF77_9BACT  ali  36  13KVYTRNGDHGRTSLIGGIKVDKDDLRIDAYGTIDELNSVLGLCISEINKIEKKNIKIFTRIQNELFNLGSSLSRLDIDKKSNFPSINRDNIIKLENEIDQYNVNLPELTSFVLPGGSSINALLHLARTICRRSERICVSLTKKTKVDENVIPYLNRLSDLFFVLSRWFSHKMDRAENLWDPK..... 199
147 5.000e-41UniRef50_A0A1H9GDV7 Cob(I)alamin adenosyltransferase n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A1H9GDV7_9BACI  ali  41  2RIYTRSGDKGTTSLIYGKRVKKNDIRVEAYGTCDEANSMIGVARSHLINEEWDGKEALHKVQTVLFHVGAELATP--SGKEVMWKLRNEHIDFLEKQIDEWDSSLDELKNFILPSGHPSASALHVARTIVRRAERMAVAIEDVE--NDMVLQYLNRLSDFLFVAARYVNKGLGGEELP......... 179
148 5.000e-41UniRef50_L8GGP9 ATP:cob(I)alamin adenosyltransferase n=11 Tax=Eukaryota TaxID=2759 RepID=L8GGP9_ACACA  ali  35  18.LYTRTGDKGESSLYTGERRAKDDAIFEALGTIDELNSHLGVASEYCKLADNGLHVYIEEIQARLMDVGSAVATPETSATEPQKAKMMEYTEALEEWIDLLDGQLPKLTRFILPSGGMSSAHLHVARSVCRSAERRVVTLVHLRTTDSSVACYLNRLSDFLFAAARCAAMKDGREETTYKKGE.... 202
149 5.000e-41UniRef50_A0A1V6HWA4 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=26 Tax=root TaxID=1 RepID=A0A1V6HWA4_9BACT  ali  37  6KVYTRTGDEGRTGLGSGRRVEKDAARIDAYGEVDELNSVLGLVRAQLAESPA--AAVVARIQNELFHLGSDLCVPEEDKERPVPVVREEHVRALEAWIDEMQAALEPLANFVLPAGAPAAAGLHVARAVCRRAERRVVGLARAERIGPWVIPYLNRLSDALFVAARWENRRQGVPDVLWDSR..... 186
150 5.000e-41UniRef50_A0A1Y0H642 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Armatimonadetes bacterium Uphvl-Ar2 TaxID=2004468 RepID=A0A1Y0H642_9BACT  ali  34  2RIYTRTGDAGETGLIGGERVRKDAHVIHVVGELDELNACLGV--ALAAGLPAPVAQVLNAVQSRLFDIGAEIAAPV-GHRYHQEADLDGTVELFEQQMDALEASLQPLKNFILPGGALSSAHLHHARTVARRAERAMVSLSQDQEVRGIIVRYLNRLSDYLFMAARYANHDQGIDDVPWTRAQ.... 181
151 6.000e-41UniRef50_A0A1F6KFC8 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Microgenomates group TaxID=1794810 RepID=A0A1F6KFC8_9BACT  ali  35  3.IYTRTGDKGKTTLFNGQRVSKGDLRIDTLGTIDELNSAIGVVLAKTQNYNSKLKSELIKIQNDLLSIGSALANPKVSSKRLTVSSLSKRVKEFEDFIDKMMKNLPPLSSFILPGGGKTGATLHLARAICRRAERRIVELNSKEKVDNSIIIYFNRLSDLLFTLARFANFKEKKKEIVWSKR..... 198
152 6.000e-41UniRef50_A0A1G1GX75 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Nitrospirae bacterium RBG_19FT_COMBO_58_9 TaxID=1801711 RepID=A0A1G1GX75_9BACT  ali  38  5KVYTRTGDAGKTRLAGGQQVWKDSLRVEAYGTLDELNAVVGVVRAMNHAQAEQLEQDLRWVQSKLFDLGGILATVPGQEFKNMPQVTAKDVTKLEKTIDRCQKDLAPLKEFILPGGGKVSGFLHQARTVCRRAERVCVHLSREEPVEAVNIKFVNRLSHALFVLARWAAKTQGEPEFLWQR...... 191
153 6.000e-41UniRef50_S9QBB1 Cob(I)alamin adenosyltransferase PduO n=88 Tax=root TaxID=1 RepID=S9QBB1_9RHOB  ali  38  6KIYTKTGDAGETALGNGTRVAKHSSRVNAYGTVDEANATVGLARQHAEGDMD---AQLAMIQNDLFDLGADLCRPDMEKEYPPLRMAAAQVSRLESEIDAMNAALEPLRSFILPGGSALAAQLHLCRTVSRRAERLTVELATMESVNPDAVKYLNRLSDWFFVASRIAN-NDGKDDVLWVPGAN... 189
154 6.000e-41UniRef50_A0A1F7BSC4 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A1F7BSC4_9BACT  ali  38  2KIYTGTGDDGSTGLLGGDRASKSSARLHACGTLDELNAVLGLVLTDGP-LPEIVKGHIEEIQKLLFTVGADIATPH-KIRLKIPKIGSEEISKVEKWIDDFSAKLPELKNFILPGGSMSGAHLHLARTVCRRAERWIVELNAGEPVNENIIPFMNRLGDYLFTAARFANKENGNGETKVIPLR.... 182
155 7.000e-41UniRef50_A0A1Z8R0N2 ATP:cob(I)alamin adenosyltransferase n=9 Tax=Flavobacteriales TaxID=200644 RepID=A0A1Z8R0N2_9FLAO  ali  34  5KIYTKKGDDGTTGLLSGKRVSKHHVRIKAYGTVDELNAWVGMIRNF--KIDEKTENTLIKIQNELMIVASQLADDTSYEVNILEPIDEEAVKNLEDQIDIINDELPELKNFVIPGGHVVVSYSHLARCACRRAERFITELNEIENVPKFIIAYINRLSDYLFILSRKLAKDYQVKEIKWIAQKK... 190
156 7.000e-41UniRef50_A0A1V6H6A8 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Bacteroidetes bacterium ADurb.Bin057 TaxID=1852802 RepID=A0A1V6H6A8_9BA  ali  35  2KIYTKTGDTGTTMLIGGSRVPKSDLRIKAYGTVDELNSFLGLLRSKL---SDDEKDLILEIQNTLFAVGANLATDTAKRKIDDFAQISEKIRFLEENIDKFDAQLPKINNFIVYGNDELSALCHVCRAVARRAEVEILTADKEHVIDKNLLVYINRLSDFLFVFARVLEEKKGNTNFFWQK...... 180
157 7.000e-41UniRef50_D0P057 Cobalamin adenosyltransferase, putative n=27 Tax=Eukaryota TaxID=2759 RepID=D0P057_PHYIT  ali  35  2KVYTKTGDNGTSQLFSGERRPKNDAVFQALGDMDELNAQIGVAVEQARVANAFLPPKLEQIQSRLFDLGACVATPLTSASETKQRRTGAFNDQLEHWIDEMDTKLPLIKCFILPGGGLASTHLHVARAVCRRAERSVVPLVGAGDVDGVVQRYLNRLSDFLFVSARFAAVKEGKEETKWV....... 187
158 8.000e-41UniRef50_A0A1W5ZZ60 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Bacilli TaxID=91061 RepID=A0A1W5ZZ60_9BACI  ali  48  2RLYTKTGDKGQTSVIGG-RVDKDDVRVEAYGTVDEANSFVGKARTELDLSVEKLKQELERIQHELFDCGGDLA---NKKSNRMFKLEEESILWLEERMDAYIEETPELKRFILPGGSDAAATIHIARTVTRRAERLVVSLNKIEEAPEVCLRYLNRLSDYFFAVSRYINYVNSNPDVEYIRSKEVFR 187
159 8.000e-41UniRef50_A0A0H4KL69 ATP:cob(I)alamin adenosyltransferase n=11 Tax=Bacilli TaxID=91061 RepID=A0A0H4KL69_9BACI  ali  50  3.IYTKTGDKGKTSLIGG-RVDKDDMRVEAYGTIDELNSFVGQAASLIEAKEEDMKEELLTIQHELFDCGSDLA---YAKKGHPFKVSDEMSEKLEKSIDRYMEESPAIERFILPGGTQLAATLHVCRTVTRRAERFVVTVSKEHEINKSVLSYLNRLSDYFFAAARAANARAKVSDVEYVRSAKVFK 185
160 8.000e-41UniRef50_A0A242A4M1 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Enterococcus TaxID=1350 RepID=A0A242A4M1_9ENTE  ali  47  2KIYTKSGDKGKTSIIGGQRVLKSDLRVCAYGSIDEVNSWVGKVIAALESRFDTLRVELTALQVLLFDIGTDFATP---SGINTPIVGKQDLARVEALIDHYQGQVPVIEKFILPGGHPIACDLHVARTVIRRGEREVTALLAEEDINLTAYKIINRLSDLFFVLARYINTSYGITEPFYERAGNVF. 185
161 8.000e-41UniRef50_A0A1X6YIK5 Cob(I)alamin adenosyltransferase n=140 Tax=Bacteria TaxID=2 RepID=A0A1X6YIK5_9RHOB  ali  38  6RIYTRTGDKGDTALGDGSRVNKDALRVEAYGTVDETNATIGLARLHAE---DEMDAALGRIQNDLFDLGADLCRPDPDRKYPVLRMTAGQTERLEREIDAMNEALEPLRSFVLPGGSALAAHLHLCRTVSRRAERLAVALGRAEAVNAHAARYLNRLSDWFFVAARIAN-DSGRADVLWQPGAN... 189
162 9.000e-41UniRef50_A0A0A2EEX3 Cob(I)yrinic acid a c-diamide adenosyltransferase n=18 Tax=Bacteroidetes TaxID=976 RepID=A0A0A2EEX3_9PORP  ali  38  7.LYTKTGDKGMTGLVGGKRVPKHHIRLESYGTIDELNSFVGMLMA--QDIEEQDYEFLLRVQHKLFNIGSYLATESDSTEFITEKSHEEDVQKVEREIDRLDGMVPRMKAFVLPGGGKSVSVAHVCRTVCRRAERIMYRLNEEAPLNDLVLKYVNRLSDYFFALARKEVYRTNGEEICW........ 184
163 1.000e-40UniRef50_T1B8G0 ATP/cobalamin adenosyltransferase n=4 Tax=mine drainage metagenome TaxID=410659 RepID=T1B8G0_9ZZZZ  ali  33  5RLYTRTGDRGETGLAGGHRVAKDSPRIQAYGTLDEVGAHLGWVEGQLPEALADVRPVVRRLEHELFVAQAELARSPH-LPPPEHRIEARHVTTLEGEIDRFSDAVGPLKSFVLERGSPPASALHIARTVARRAERELWALHRLEPIRPEILHWVNRLSDLLFALALYANHRLGIPEEP......... 181
164 1.000e-40UniRef50_D3AW80 Uncharacterized protein n=2 Tax=Acytosteliaceae TaxID=2058183 RepID=D3AW80_POLPP  ali  40  54KIYTKTGDKGTSSLFNGERRPKDDQIFNVLGDLDELSAHIGLSIDFIKMNTVEKIKELEEIQCLLLDLGSHVATPRESSPDAHLRRTEDNITRLEAQIDQIDQSLPPLRNFILPGGNVVSSQLHVCRSVCRRCERHLVPLLIGEYIDAAANKYINRLSDYFFTLARYASFVNNSPESIYRTPKE... 251
165 1.000e-40UniRef50_A0A1V5JDW1 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Bacteroidetes bacterium ADurb.BinA012 TaxID=1852815 RepID=A0A1V5JDW1_9B  ali  38  2KIYTKTGDKGETSVIGGVRLPKHHLRIEAYGTLDELIAWIGMLRSCEHSC--IPHEELIEIQSVLMSCCTVIAT--HPSAKVPEGIHIGDTSRLESSIDRMESDLPGLKSFILPGGNNPAATANLARTVCRRAERAILRLNETEKTDPDVIRYLNRLSDYLFVLSRHLMHSIGTEEVKRISDKK... 181
166 1.000e-40UniRef50_A0A2E2A1C5 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E2A1C5_9BACT  ali  37  12KVYTKKGDKGTTSIIGENFVSKSDPRIXCYGEVXELNSSIGFCYACXQFKDEEISKSIKXIQNDLFNLGTMLAISNSIDSKDYPNIDGKNIKFLEXLIDLXNEXLPALKSFVLPSGSTIGAYFHVCXTICRRVERSCVSLSKSDNLNPDIISYLNRLSDLLFVWARWSNKHLGKXENMW........ 194
167 1.000e-40UniRef50_A0A1Y1HTI3 Cob(I)alamin adenosyltransferase n=2 Tax=Viridiplantae TaxID=33090 RepID=A0A1Y1HTI3_KLENI  ali  39  78KIYTRTGDAGQTSLYNGSRKSKTEVEFEALGDVDELNSAIGVAREFLDPTLTSLLQQLEEIQSRLIDVGTSIATPLSTSSKERAKFPEGKVQLLEEQIDAMDEELPPLRNFILPSGGPGASFLHVARGVCRRAERKVVYLVGQNQVEEEVSRYMNRLSDYLFTAARYAALKAGRQETIYKK...... 261
168 1.000e-40UniRef50_A0A2G6GSA0 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Bacteroidia TaxID=200643 RepID=A0A2G6GSA0_9BACT  ali  33  3.VYTKTGDKGKTGIHGGERVDKDDIRIEANGTADELNSIIGIVRAKLD-KEHQWQAFLHRIQKEMMTVMSLIATPSAKIANNPNTFDESLIADCEQMIDTMHEEIGKSRDFLLPGGNEVASYLHLARTVARRCERRLWTLNKQDAVLSSILQFFNRLSDLFFVMARYEVFINDGNEEVF........ 179
169 1.000e-40UniRef50_A0A136LXW9 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=candidate division WS6 bacterium OLB20 TaxID=1617426 RepID=A0A136LXW9_9  ali  39  3KLYTKTGDSGTSGLYGGQRLPKTDPVFAALGTIDELNAYLGVVAAAA---DKQTADLIMSIQHVLFRAGSLVATPAGSPLKNLARMQESDTATLEEQIDTMTAETPELKNFILPGGDMTASQLFYARAICRRAERCVAALSETTPDRMLMLAYINRLSDWMFARARLINHKAGAAEIIWKP...... 181
170 1.000e-40UniRef50_A0A1F8VAP8 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Coxiella sp. RIFCSPHIGHO2_12_FULL_44_14 TaxID=1797697 RepID=A0A1F8VAP8_9COXI  ali  35  6KVYTRQGDGGYTALSDQKKVSKADDRVDALGEVDELNSSLGIICALLKHHHDSLIARLSRIQHELFNLGAYLSYTRIDNQKKSPSVGLPQITQLEQEMDMMNHTLPSLCSFVLPGGSEVAAQCYLARAVCRRAERALVRLAVHESSLNLAIAYLNRLSDWLFVSARYLNQQLSIPESLWNPS..... 188
171 1.000e-40UniRef50_A8JFX7 Flagellar associated protein, cobalamin adenosyltransferase-like protein n=5 Tax=Eukaryota TaxID=2759 RepID=A8JFX7_CHLRE  ali  38  2KIYTRSGDAGQASLFNGERLYKDDDVFQALGDVDELNSALGVADYAAQFCAASWRSSLETIQSRLIDVGSAVATPLPTSDEDKLQRTKEHTEQLEAWIDAMDEDLPKLTKFILPSGGQAAACLHHARSVCRRAERSVVVLSRRQAVSSEVNMYVNRLSDYLFTAARHAAMTQGAVEKVYQKARS... 189
172 1.000e-40UniRef50_A0A1D1VZ46 Uncharacterized protein n=11 Tax=Opisthokonta TaxID=33154 RepID=A0A1D1VZ46_RAMVA  ali  36  42RIYTKTGDAGTSSTFTGERRRKDDDVFESLGTTDELSCLLGIVREFAADAGHNFDSHLEQIQCLLQDVGSALATPLPYARKSHTRFDPHHVKMLEDQIDRMEDQLPALQNFILPSGGKTAVFIHYARAVCRRAERAVTSLVLNGQVDGEPLKFLNRLSDYLFVLARYAAMKEQKVEKIYIRPQ.... 227
173 1.000e-40UniRef50_A0A1W9L759 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Beggiatoa sp. IS2 TaxID=1934247 RepID=A0A1W9L759_9GAMM  ali  38  7KIYTGMGDQGLTDLGNGQRVDKDHLRIEVYGTLDELNSFIGLLLTY--PLTPIISQSLATIQHDLFSLGSELSGAAQS------VIMARHVIDLENTIDELSEQLSPLQAFILPGGTQTVALCHVARTVCRRAERQWVTLNRLETVNPNSLVYLNRLSDLLFIMARYLLKIAGKTEIVWKKTCTV.. 183
174 2.000e-40UniRef50_A0A2M7KUB1 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 TaxID=1973912 RepID=A0A2M7KUB1  ali  33  2KIYTRKGDDGTTQLLSGDRVAKDDLRLEVEGTLDELNSCLGAALSHLE--DEKLAETVRTLQGKLFVLGALVAGAQADDSS--SLLSDAEVLALEQTIDDRTASLPPLRAFVLPGGAPAGAHLHVARTVCRRLERRLTSLAGREPVTPAAQRFVNRLADLLFVLARSANHRAGVGELTWGP...... 178
175 2.000e-40UniRef50_F8WWR4 ATP:cob(I)alamin adenosyltransferase n=42 Tax=Bacteroidia TaxID=200643 RepID=F8WWR4_9BACT  ali  36  6.IYTKTGDKGTTSLVGGKRVIKAHVRLDAYGTTDELNSFVGFLTEKIE--DEHDLKILSFIQHKLFTVGSYLATETEAMPKAASIITDKDIATLENEMDRMDSELPQLRQFVLPGGSESAARAHICRTVCRRAERCVYKVKEEYPVDDLVLMFINRLSDYFFLLARKESNKKGN-EIFWN....... 182
176 2.000e-40UniRef50_A0A174BYL4 ATP:cob(I)alamin adenosyltransferase n=20 Tax=Clostridia TaxID=186801 RepID=A0A174BYL4_CLOPF  ali  36  3.IYTKTGDKGTTSLFGGSRVDKCDLRVDAYGTIDELISFIG--LAYAELTDEEEKEILNKIQKELFMLGAELASDEKGLELLKDKIQLEHIEYLEKLIDKYMGIAGPLTAFVIPGKNKPSATLHVARTVARRGERIMTALNEVQPLREEIKKYINRLSDTLFALARYYEEK................ 170
177 2.000e-40UniRef50_A0A1H3ZIZ6 Cob(I)alamin adenosyltransferase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1H3ZIZ6_9BACT  ali  35  3KIYTRTGDKGTTGLIGGTRISKGDLQVDCYGTLDEVNAHLGLLISQLKEIIDQPFTTLTTTQKHLFDIGAVLADPEKADKFKLPMISSTEITNLELEIDEMNFHLPKMTHFILPGGHQVVAQAHILRAVTRKAERLTVAFSFAADAYPLILKYLNRLSDYFFVLSRYIGYLLNIPENKWIPEK.... 195
178 2.000e-40UniRef50_A0A1G3A212 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A1G3A212_9BACT  ali  35  2KISTKKGDRGETSLLGGKRVGKDDPRVAVNGDIDELNASVGAAAAFIK--SEELKELLAAVQRDLFTIGANLSASGNGKDKPPELEKGS-LQRLEKFIDDAERRLPPLKEFILPGGSTGGAMLHQTCAVARRAERNVVALSRTIAVDPTILVYLNRLSDMLFMAARVENDRAGAAREPWHRNKK... 182
179 2.000e-40UniRef50_A0A1F3N5J4 ATP:cob(I)alamin adenosyltransferase n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3N5J4_9BACT  ali  33  2KTYTRTGDDGTTSLSGGKRVPKCHIRVEAYGTIDELISWIGLLRDH--PDNVKRVRMLAYIQDQLMRCAASLASEKVKTERGICLPEPESIQILEKEIDNMEAALKPLKSLILPGGNLIISYCHITRCICRRAERAAVKLNETEKISEIIIIFLNRLSDFLFVLSRKICLELDIEEVKW........ 178
180 2.000e-40UniRef50_A0A2G6P9J2 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Delongbacteria bacterium TaxID=2044594 RepID=A0A2G6P9J2_9BACT  ali  40  2KIYTKTGDEGKTSLVGGKRVSKGDLKVNCYGDVDELNSFIGFSRSLLKSSNIESKEDLYWVQNRLFDLGGYLATSLDIR--VSTPYDDRAVSYLEEKIDFMDKELEPLKHFIIPGGSTLASSIHICRSVSRRVERLMVNLREEETLDPVMLKFINRLSDYFFNLSKYINLKLNIKEDKWEK...... 184
181 2.000e-40UniRef50_A0A2K9J0G6 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=41 Tax=Bacteria TaxID=2 RepID=A0A2K9J0G6_VIRPA  ali  42  2RIYTRSGDKGKTSLIYGERVNKNDLRVEAYGTCDEANSMIGLAISYLQQEKEFVIEELSRVQTLLFHVGSELATPL--DKEVPWKLTEKHIETLEKQIDDWDKQLEPLKNFILPSGVPASSALHVARTVSRRAERLA---VGIENVNPLSLTFLNRLSDYLFVAARYINQLLEGEE........... 177
182 3.000e-40UniRef50_UPI00077A93F0 LOW QUALITY PROTEIN: cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial-like n=2 Tax=Eumetazoa TaxID=6072 RepID=  ali  36  43KIYTRTGDQGYTSTYGGERLPKTDAIFEALGTTDELSSVIGYLKKRYIYNLH-----IFKIQCVLQDVGSNIATPRQTSPQRNTKFNVDATKELEQWIDAYHNQLPPLRNFILPSGGKSAAMLHVARSICRRAERRVMPLVHSGNVEPEVGSFLNRLSDFLFTAGRFVSNMEGKTEKIYRRIQRXQK 227
183 3.000e-40UniRef50_A0A2D5PY97 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D5PY97_9BACT  ali  39  5KIITKTGDKGGTGLGDGSRIAKDDPRIECIGTLDELNSFVGFAKVVI--TDAGIISFLEKIQNNLFNMGGSLAMPGVDTKS----VDDACITDLEKQVDAWNNELPPLKEFVLPGGSEASARFHLARTSTRNAERRLVSLHKIEPLPDELLQYINRLSDVFFVLARKFQRDEGVDEKHW........ 177
184 3.000e-40UniRef50_A0A2T9ZBB2 Uncharacterized protein n=1 Tax=Smittium megazygosporum TaxID=133381 RepID=A0A2T9ZBB2_9FUNG  ali  38  51KVYTKTGDKGRSALYTGERRSKSDPIFEALGTTDELSSTIGFSQSCLKDPKIFALDQLVKIQCLLQDVGSNIATPVNSKSKTKIANTRFFVKELEEWIDEMSKELVLHKYFVLPSGGMAASSLHVARTICRRAERCVIPL--MDEIDPNVLKYLNRLSDFLFTAARYVAKIEGQKESVYLR...... 235
185 3.000e-40UniRef50_F3UCA3 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=86 Tax=Firmicutes TaxID=1239 RepID=F3UCA3_STRSA  ali  50  3.LYTKTGDKGLTKLVGGQSVAKDAERVNAYGTIDELNSWIGYTITKLD-KDDKLRDELLQLQHYLFDCGSDLSTPKGVYPY---KVDQQLIDWIEERIDTYAEIPPALERFILPGGDEIASMIHVARTIARRAERHIVGAMWTTEINNNVLIFVNRLSDYFFALARVINFTKNQEDIAYERGTKVF. 183
186 3.000e-40UniRef50_A0A1A7T428 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Enterococcus TaxID=1350 RepID=A0A1A7T428_ENTFC  ali  45  3.IYTRYGDQGFTRLVGGGRAKKNAPRVQTYGAIDTLNAQVGLTIAGLE-KEDLLYAELVQVQQWIFDCGSDFATP---EEKRPYKVEGKLIKWLEEKIDLYWSKLPKINQFILPGGTVAAANLHLCRCFTREAERNAVDLFEHQEVNMEALKFLNRLSDYFFVLARWVNNQAGQSEIFYENSVSVF. 184
187 4.000e-40UniRef50_A0A1Q3MKI4 ATP:cob(I)alamin adenosyltransferase n=7 Tax=Bacteria TaxID=2 RepID=A0A1Q3MKI4_9BACT  ali  39  2KIYTKTGDSGETGLIGGERVGKDSLRISAIGEVDELNALIGVVRAIDASFPLDG--LLEKIQGWLFEAGAEFASPN---ESRFATVGQSAIDALEASIDEQERDLPELKNFILPGGNLLAAHLHLARSVCRRVERTSLCLHREEPVRYELRVFFNRLADWLFIGARTANHLSNVEEVNWKRG..... 178
188 4.000e-40UniRef50_A0A0K8RLE7 Putative cobalamin adenosyltransferase n=22 Tax=Eukaryota TaxID=2759 RepID=A0A0K8RLE7_IXORI  ali  35  30KIYTRTGDKGTSVTFSGQRRRKDDAVFEALGTTDELNSHIGYVRAVLQH--EELSDQLKTVQCLLQDLQASIATPKSSSSEGQTAFPPEHVEELERWIDGHTSNLKPLKNFILPSGSPSSSSIHIARSVCRRAERRVSTLVHDNEVDDVVMRYLNRLSDFLFVAARVAAQHDGAEEVIYK....... 210
189 4.000e-40UniRef50_A0A2N2WH40 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-6 TaxID=2013696 RepID=A0A2N2WH40_9BACT  ali  38  6KIYTRKGDSGTTALIGGKIVSKSYIRVESYGLVDELNSFVGHLYDQVE--DSENKVFLFGILNKLFLIESHLADPEAADKKFFPDIIASDTRTVELEIDRLNVNLPELTHFILPAGNKLASLAHICRTVCRRAERNILRLHETEPVDVEILKYINRLSDYFFVLARKLSHIYGAEDVPWIASPDRE. 190
190 4.000e-40UniRef50_I4B8Z0 ATP/cobalamin adenosyltransferase n=4 Tax=Bacteria TaxID=2 RepID=I4B8Z0_TURPD  ali  39  2KIYTKTGDSGETSLFGGGRVQKNDKRVTAYGEIDELNSFVGALLANLGDKMVEIRHLLEALQNRLFDLGAELAGDQKFLAKLARRIAEPDIAALEAAIDRMQAHLKPLTNFILPGGSPAAAHAHICRSVSRRAERAMIAAAVQE---PLLLSFINRLSDYFFVLARYLNHLNGVAEPEWEK...... 188
191 4.000e-40UniRef50_A0A1P8WS78 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Fuerstia marisgermanicae TaxID=1891926 RepID=A0A1P8WS78_9PLAN  ali  38  6KIYTRTGDSGQTGIGDGTRVSKLDARIVAGGSVDETNCCIGV--AAAQCTDASLKSLLLTLQQRLFDLGADLTSPWRDADDRCPRMTLQHIEWLEQQIDRFNERLSALKSFVLPGGQPCAASLHLARSVCRRAELDTLRLQNGTSLNPQIVVFLNRLSDLLFVLARDAN-DHGAMDVLWEPSRR... 188
192 4.000e-40UniRef50_T1EEX2 Uncharacterized protein n=11 Tax=Metazoa TaxID=33208 RepID=T1EEX2_HELRO  ali  39  23KIYTKTGDKGTSATYTGERRPKDDQIFNALGATDELSSHIGLAREHCSSRCADLTERLKIIQCILQDVGSSIATPKSSAKDRHLKKTEEPVENLEKWIDEYMETVPPLKSFILPSGGLASCHLHIARSVCRRAEREIVPLVANGEMETEPAVFVNRLSDFLFAAARYCSYKDGVPEAIYKR...... 206
193 4.000e-40UniRef50_A0A1Y5S364 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=50 Tax=Bacteria TaxID=2 RepID=A0A1Y5S364_9RHOB  ali  37  6KIYTKTGDAGETALGNGSRVAKHSLRVTAYGTVDEANATVGMARLHATGDMD---AQLAAIQNDLFDLGADLCRPDMEKEYAPLRMTDGQVARLESEIDAMNADLEPLRSFILPGGSALAAHLHLCRTVARRAERLSVELGGMESVNPAGVKYLNRLSDWFFVASRIAN-NSGKDDVLWVPGAN... 189
194 5.000e-40UniRef50_A0A1F7TK70 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Uhrbacteria bacterium RIFCSPHIGHO2_01_FULL_63_20 TaxID=1802385 RepID=A0A1  ali  36  2RIYTRTGDTGTTSLFGGQRVPKTEPRVAAYGDVDEANSVIGWV-VVCETLPADVKEKLLEVMSDLLDVGSELATPPDEKSHLTSRVSEERVAEIERWIDAADAELTPLTQFILPTGCEAAARLHVARTVMRRAERSVTNVE---GVRTALSGYVNRLSDLLFTLARLCNKRANQADTPWKGRKS... 187
195 5.000e-40UniRef50_A0A1Z9E059 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Gammaproteobacteria bacterium TMED119 TaxID=1986671 RepID=A0A1Z9E059_9GAMM  ali  33  7KIYTRTGDDGSTGTASGERVGKDCLLIHAQGDLDELNSHLGSLRAH--NTNAQIESLLIVIQHHLFNIGGELSAPECD------LTHAAEIIWLETWIDHFNAGLPALEDFIISGGDICVAQCHIARTVCRRTERHLVHWSRDHDVREELLKYINRLSDLLFVLARVLESERGHQPTLWNKH..... 180
196 5.000e-40UniRef50_A0A1G2SLW6 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2SLW6_9BACT  ali  33  2.LYTRKGDKGDTGMFGDQRMSKSSVVAEALGTLDEVNSFLGVCKKMMHVEGRSYETILGAVQQNLFTVQAEVAG-------APKQITEEKVKEIEALIAEIEALLPPIKTFFVSGGTELAASLDFARTLARRAERRVVAVAEEGEVGAHTLAFLNRLSSLLYAMARFANHVSGVKE........... 177
197 6.000e-40UniRef50_A9V6S9 Predicted protein n=3 Tax=Opisthokonta TaxID=33154 RepID=A9V6S9_MONBE  ali  39  38KIYTRTGDAGTSALLTGERRPKYDPCFEAVGTVDELSSALGVTMASIRSEQQDINEQLQRIQCILQDVSSCLVTPDDDATPEHLRKDEAFVTELEALIDAHEEELAPLKNFILPGGGPASASFHVARTVCRRAERRAVELQQVQAVQPAALKFLNRLSDYLFTLARVACHRQGEEELVY........ 222
198 6.000e-40UniRef50_A0A2E3BWI4 ATP:cob(I)alamin adenosyltransferase n=5 Tax=FCB group TaxID=1783270 RepID=A0A2E3BWI4_9FLAO  ali  37  2KIYSRKGDKGDTSLFNGKIVKKHNLRVDAYGTIDELNSFIGLLKDYIE--DEKIKDLLNRIQIKLFSIGSFSAINKEGELSNKVKIENIDIENIESEIDNFNKDLPKLKNFIIPGGHKPSSYSHVCRSICRRAERKISEINDESKINPLILPYVNRLSDLFFVLSRYLSFNDNANESYW........ 179
199 7.000e-40UniRef50_E7SAQ0 ATP:cob(I)alamin adenosyltransferase n=30 Tax=Bacilli TaxID=91061 RepID=E7SAQ0_9STRE  ali  51  3.LYTKTGDKGLTKLVGGQSVAKDSDRVNAYGTVDELNTWVGYTISKMDPAD-ELRDELYQLQNYLFDCGSDLSTPHGVYPY---KVDESLVKWIEERIDTYADIPPALERFILPGGDEIASMIHVARTIARRAERLVVATMWTNEINNQVLIFINRLSDYFFALARVINYRKHCQDIPYERGAKVF. 183
200 7.000e-40UniRef50_A0A0G1Y5W7 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Candidatus Peregrinibacteria TaxID=1619053 RepID=A0A0G1Y5W7_9BACT  ali  37  14...TRAGDSGSTGLFGGKRVSKASDRLHAYGTVDELNAILGMLLA-LRALPDLVADDLSSIQNILFCIGSDLATPFQSAA-HVDRLRPEAVQHLEERGVALESQLPPLSKFILPGGSEAGALFHHARTVCRRAERWAVALSEREQVNGHVIVFLNRLSDYLFLAARIANKQAGVREQEWSGK..... 190
201 7.000e-40UniRef50_A0A2G4JEF5 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Thaumarchaeota TaxID=651137 RepID=A0A2G4JEF5_9ARCH  ali  38  2KIYTKTGDDGTTGLQGNNRVSKDNPRIIAYGTIDEANATLGIALSY--ELDKDVAILCNLIQNELFIVGADLSNIDLHDEKN--RVSDEMILNLEKNIDNYEKELSPLTNFILPGGNIIAAQIHHVRTIIRRAETCIVILSQQEKINQNCIKYVNRLSDLFFVLGRVLNKRSGQKDIIWK....... 177
202 8.000e-40UniRef50_A0A1F7AZI1 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A1F7AZI1_9BACT  ali  42  3KIYTKQGDFGQTMIYGGDKKSKDDLRIEAYGTVDELNSFIGLAISHLDEESNTTKS-LKKMQFDLLRLGADLATPLEREDLEVNRINAEDIEKLEKWIDKMDEKLEPLKTFILPGGTKAQSALHTARSVCRRAERRVFTLIKKEKVNPNALKYLNRLSDALFTLARFLEK................. 171
203 8.000e-40UniRef50_A0A2E2V1H3 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E2V1H3_9FLAO  ali  42  2KIYTKKGDSGKTSIIGASGLNKHNIKIEAYGTVDELNSLVGLLRSFDNPDFSVHQKELVFIQDTLFKIGSILASA--SDVEDPFSITSNNIKELEIFIDNIENQLEKLTSFILPGGNIWNGYTHLARSVCRRAERRITALNMEEKIDNNILIFINRLSDYFFVLARKINVINNVDEIKWNS...... 180
204 8.000e-40UniRef50_A0A1F3XXK6 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bdellovibrionales bacterium RIFOXYD1_FULL_55_31 TaxID=1797404 RepID=A0A1F3XXK6_9PROT  ali  37  2KIYTRKGDQGETGLIGGFRVAKDSPRVRAYGDFDELNAVLGLALAEEGYLATERRERLIRIQGELLVLGAELATSNGGREQLLERIERKFILRLESEIDRMEQWLSTISDFIIPGGTRIAALFHLARTVARRAERELVALHHEPPLRPEVLEYANRLSDYLFVCARLANHELKVQDLLWLKRRDL.. 193
205 8.000e-40UniRef50_A0A0E9M2T4 Cob(I)alamin adenosyltransferase PduO n=1 Tax=Geofilum rubicundum JCM 15548 TaxID=1236989 RepID=A0A0E9M2T4_9BACT  ali  38  6.VYTKTGDKGTTGLIGGTRVAKDHFRLEAYGTVDELNTNIGMIRSY--PIDQPSIETIIRIQNQLFTIGSYLATDASVSDQSKXXXXXXXXXXXXXXXXXXXXXLPPLKNFVLPGGHPAVSQCHITRTICRRAERRVISMSGEVKVDEWVIRYLNRLSDYFFVLSRHLSNYFNIDEIPWIS...... 184
206 9.000e-40UniRef50_A0A0P1I119 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=50 Tax=root TaxID=1 RepID=A0A0P1I119_9RHOB  ali  42  6KIYTRTGDKGTTALGNGDRVAKFDARVNAYGTSDELNATVGMARLYAA---DEMDAQLSAIQNDLFDLGADLCRPEMDKEYPPXXXXXXXXXXXXXXXXXXXXXLEPLRSFILPGGSSLSAHLHLCRTVARRAERLSVELSRSEDVNPQVIMYLNRLSDWFFVAARIAN-DAGKADVLWVPGAN... 189
207 9.000e-40UniRef50_A0A2K8KWL2 ATP--cobalamin adenosyltransferase n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2K8KWL2_9GAMM  ali  34  7KIYTKTGDNGTTGLGINERIAKDSLRIQAIGDIDELNSTLGFFIESVAPT-STHRDELRQIQHDLFDLGGELAMPDYS------LLDGAIIDQLEALIDRDNAELPPLTNFILPGGNEAAARCHMARALCRRVERTVVTFNRAEDKHTLAQTYLNRLSDYLFVLARLLVQEQGDAEVLWQSRHR... 184
208 1.000e-39UniRef50_A0A2E0XVV8 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2E0XVV8_9BACT  ali  37  3.LYTGRGDDGCTDLFGGGRVPKHHGRVAAYGAADEMNAFLGLARCACEDVDERLSEIINLLQDKVFVLGADLATPPGGPHEDIPRIQASDVEVLEDLIDEIDDQNTPLKTFVLPGGCELAARLHVARGASRRCERAVSMLNHEDDCGRDIMVWINRASDLLFAMARAANRLRGIEDIPW........ 181
209 1.000e-39UniRef50_A0A2S6RF90 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6RF90_9PROT  ali  36  6KVYTKGGDKGITSLGDGTRVSKTDKIIIALANLEELNANLGLVVCKI---SSPYKSIIQKIQNDLFDLGADIVTP--SNKKNVLRIGKEYTINLEKEIDAILSNLPTLKSFILPGGTEISSRIHLARTVCRRCEISILELNKKKYVNTEILKYINRLSDLLFVIARKLNILNN-KEILWKPGKN... 183
210 1.000e-39UniRef50_F5SLW7 ATP:cob(I)alamin adenosyltransferase n=17 Tax=Psychrobacter TaxID=497 RepID=F5SLW7_9GAMM  ali  39  7KIYTRTGDDGTTGLADGSRVNKSDLIFVVMGDVDELNAHIGMILAQIEGLTAEKLEALSTVQHLLFNVGGELAMP------EYIGISEAHISWLESEIDAFNEELPALKDFILPAGSTLVSQIHIARTVCRRAERQAVQLNNKEAISANVLKLLNRLSDWLFVLSRYCAKVEGSKEVLWDK...... 190
211 1.000e-39UniRef50_A0A0G0JFG6 ATP:cob(I)alamin adenosyltransferase n=1 Tax=candidate division WS6 bacterium GW2011_GWA2_37_6 TaxID=1619087 RepID=A0A0G0JFG6_9BA  ali  36  3.IYTKKGDKGSTSLYGGRRVSKSIVRLEVIGCIDELNSLLGLINSKLKDEQKTWTDRIERIQGELLQVGADIATPYSASQKNIDRLAPENIKNLENEIDEMDTQLPKLRYFIIPGGSETASIAQLARAMTRRAERNAVRLTKGAKLNPNVLKYLNRLSDWLFITARYINKNSGEKDKIWN....... 191
212 1.000e-39UniRef50_A0A2R6JIQ5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Halobacteriales archaeon QS_8_69_26 TaxID=1919187 RepID=A0A2R6JIQ5_9EURY  ali  36  3.IYTGRGDEGMTDLWNMDRVPKTSPRVEAYGTVDELNSLLG---TAVPTGYEDVDEQLRAVQNHLFVVQADLANPDSSPGEDTACVRPEHVDRIEEWIDAHQEDLEPTTAFILPGGSEHGSRLHHARSVCRRAERRTVELAESEDVNDHVLEYLNRLSDGLFVFARVVNAREGVEEE.......... 180
213 1.000e-39UniRef50_A0A2H5VRQ7 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5VRQ7_9BACT  ali  37  2..YTRTGDGGYTALGSGERVPKWEPRVSAYGDLDEVNSWVGMLRA--EGVPSEADAHLERAQRALFSLGSVLAG----SPRGFLSPDAADVTWLENWIDRMSAELPPLKNFVLPGGSRSAAVAHLCRTVTRRAERAVAALGIEDEVVGTAVRFLNRFSDALFVLARWLNHLQGGREILW........ 172
214 1.000e-39UniRef50_A0A196SBM8 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Blastocystis TaxID=12967 RepID=A0A196SBM8_BLAHN  ali  35  21.VTTRTGDKGTSSLYNGKRLPKSDIHFEALGSLDELNSQIGVAREFLCSDCAELDDYLEKIQCLLFSVCSAVATPLTTSSQYVLKFDEAHVKNLEKWSALIYSQLPPQDSFYLPSGGKAACFLHMARTICRRAERVMCVLLQDEDITECVYQFVNRLSDFLYNAARYASLKENIEPKKWVP...... 203
215 1.000e-39UniRef50_A0A1M4Y544 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A1M4Y544_9CLOT  ali  39  2KIYTKTGDKGTTALFGGSRVEKDSLKVEAYGTVDELISFMGV--AFAEANDKDEKEAIESIQKKLFVLGAELASDEKGLTYLKEVITDEDIEKLESLIDKYMEKAGPFKGFVTPGKDKVSAALHVARTVARRAERRIATLSKEEPIREELRMYINRLSDCLYAMARYEEEK................ 170
216 1.000e-39UniRef50_A0A2G6HU08 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2G6HU08_9BACT  ali  37  17KVVTRGGDKGMTSLATGQRVSKTHPRIEAYGTVDELNAFLGKAIETSKTADEDFIQMLIRIQHDLFNLGAELASMPKDPSSRKPSIDTQHVAFLEESVDKYNAELPELTSFILPGGSPLAAELHICRTICRRAERLAQSIRPTEQVPEKALIYLNRLSDAFFVFSRWVLVKASLKEHLWHP...... 207
217 1.000e-39UniRef50_A0A1Y1R5N1 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Oceanospirillales TaxID=135619 RepID=A0A1Y1R5N1_9GAMM  ali  38  11KIYTRTGDKGTTSLGGGTRVAKTHTRIEAIGSVDELNAWMGMLICELKDCQHKLQKPLEFIQHRLFDVGGELAMPAYQ------LIRQEFVTYLEEVLDEFNEGLPPLKNFILPGGSRLACHCHMVRTVSRRAERRVIAAKKAEEINAPLLQFLNRLSDLMFVLGRVTARQSG-GEVLWQQSEK... 191
218 1.000e-39UniRef50_A0A0D2X5K9 Cobalamin adenosyltransferase n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2X5K9_CAPO3  ali  36  10.IYTKTGDQGTSSLYTGERRTKAHAIFNALGDVDELNSALGLARAYCESRKGQLVPLIEDIQCALLEIGSSIGTPEDPEEAAKRARMLASTAFLEHAIDLYDSLLPRLTNFILPSGGLASSHLHLARSICRRAERAVVPLLQSGAGEKSVGKYLNRLSDFLFVAARFAAQQDGQTEVV......... 248
219 1.000e-39UniRef50_A0A2M8S6X9 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Anaerolineae TaxID=292625 RepID=A0A2M8S6X9_9CHLR  ali  31  4.LFTRTGDDGTTGLLGEGRLPKSHPRLEALGTLDEASAALGLARSLCQAEQT--GPLLVGVQRDLYALMAEVAATPENAAQ-FRSLDSGRVQWLESQAEAISALVPLPDEFILPGDSPGAAAMSLARTIVRRAERRLAGLLETGEINQILLQYLNRLSSLCFALELLENQQAGKKTSLAK....... 180
220 2.000e-39UniRef50_F4KN19 ATP/cobalamin adenosyltransferase n=27 Tax=Porphyromonadaceae TaxID=171551 RepID=F4KN19_PORAD  ali  35  6.IYTRRGDDGTTGLVGGTRISKGHIRLECYGTIDELNSHIGVLLA--EDLTDETHDFLLRLQHILFNVAGSLATPPDQEEYAAMRIDPTDIEKLEHKIDELDATLPRLKEFVLPSGGRTAALCHVCRTVCRRAERNIYRLREESRVDDLIVRFVNRLSDYFFVLARTEAVRTHGSEVTWNRG..... 185
221 2.000e-39UniRef50_A0A1Z8T9U7 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A1Z8T9U7_9BACT  ali  38  24KVTTKTGDMGQTGLANGERVSKNSPRIHAMGSVDTLNSFIGWTRVNAKENIDKS---LQEIQQDLFNIGAELAIPDVE----MNLLNXSRXXWLDEQIDMHNKQLPPLDEFILPGGTELASRLHISRAECRETERNIIYLSEQEXVPDLHKKYLNRLSDLLFNLSRXVAXDKGVSEISWEYNK.... 199
222 2.000e-39UniRef50_A0A250XEJ9 Uncharacterized protein n=1 Tax=Chlamydomonas eustigma TaxID=1157962 RepID=A0A250XEJ9_9CHLO  ali  40  14KIYTKTGDTGTSSLYNGQRLPKDADYFCALGDVDELNSVVGAAREFCGPECASTCSQLEVIQSRLLDVGSAVATPNNSSKLNRTRFDASSTTQLEAWIDEMDTSLPALKNFILPSGGKASVFLHMARSICRRAERSVIPLTREGHIDEQVAVYLNRLSDYLFTAARFTASLQECPEVIYRK...... 196
223 2.000e-39UniRef50_A0A2M6X1N3 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bdellovibrionales bacterium CG10_big_fil_rev_8_21_14_0_10_45_34 TaxID=1973927 RepID=  ali  36  10.IYTRSGDQGMSSLIGGQKVSKNHYRLRAYGSLDELNSFLG--LAHVKCEFSEIGEQVLAIQSDLFVIGSHLACEDAALSAKLPQLSEDRISVIERDIDKFDATLSPLKNFILPGGSEGSALLHVCRTICRRAEREIVAMHESEKTDVRYVEYLNRLSDYLFVAARAENQHRNVKDTVWNP...... 187
224 2.000e-39UniRef50_A0A2E9PQW4 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Bacteria TaxID=2 RepID=A0A2E9PQW4_9BACT  ali  34  5KVYTKTGDDGTTELSKGERMPKDSPRIVILGALDEVNAAIGVVLA--ENLNKIIAKVLEGVQHDLFNIGGELA----VLEEDLGLVKSDDVQKLEEAIDSLNESLPSLEEFVLPGGSRRSALLYQAKVICRRTERDLVTLSHKEKINPLHLKYLNRLSDYLFVAARYENMKGGGEEQLWKRKQ.... 181
225 2.000e-39UniRef50_A0A2D9XIH3 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D9XIH3_9FLAO  ali  41  2KIYTKKGDAGKTSIIGASGLNKHNIKIEAYGTVDELNSLVGLLRSFNHSDFSPHKKELVFIQDTLFKIGSILASSSDVDDPFCITLN--HIKEIEKFIDSIDGQLEKLTSFILPGGNIWNGYTHLARAVCRRAERRITALNMEEKIDNNILIFINRLSDYFFVLARKINVINNVDEIKWN....... 179
226 2.000e-39UniRef50_A0A2E3RP91 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E3RP91_9BACT  ali  38  2KLYTRTGDDGTTGLIGGDRVDKDNERIEAYGTVDELNACLGLACCCLGTFSDHAGRILSSIQSRLFDMGAELATVKGSDDQSVQRIDGDMVRQLEKDIDLMSSMAPPIRNFVIPGGCELAARLHLARTVCRRGERLLIGLVRQEQASLEVLKFLNRLSDLLFAMARAANADAGIEDVPWI....... 183
227 2.000e-39UniRef50_R5B7R8 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:927 TaxID=1262753 RepID=R5B7R8_9BACE  ali  38  8.LYTGGGDRGTTSLVSGHRIAKHHMRIEAYGTVDELNSHLGLAGAY-PGLPAEQKKMLVWIQNKLFDMGAYLA---NDNPDAAPGISDGDIIKLESMIDTVDNMLPALNRFVLPGGCIESGQLHVARTVCRRAERRITALAEATPVNARVVVFMNRLSDFLFALARYANICTNCDEIFWEK...... 183
228 2.000e-39UniRef50_C0BGS3 ATP/cobalamin adenosyltransferase n=4 Tax=Flavobacteriia TaxID=117743 RepID=C0BGS3_FLABM  ali  32  5KVYTKTGDGGFTSLISGKRVPKHDLRIKTYGTIDELIAWLGLIRDTTKL--EEVQTTLLEIQKQLMTVAAQLSIDSDKKPKNLTPIQPSAVKFLEYEIDSLTTKLEPLRNFVIPGGHVLISYSHLARCVCRRAERYVTELDEEASISSTLIAYMNRLSDYFFTLSRTFAAELNVEEVKW........ 182
229 2.000e-39UniRef50_A0A158IB78 ATP:cob(I)alamin adenosyltransferase n=7 Tax=Burkholderiales TaxID=80840 RepID=A0A158IB78_9BURK  ali  38  7KIATRTGDDGTTGLGDGSRVQKDDARIAAIGDVDELNSQIGVLL--CEKLPGDVRAALVDIQHDLFDLGGELCIPGHSMIE------EAHLARIDTWIGEYNANLPALKEFILPGGSRAAALAHVGRTICRRAERSIVALGRVDRINAEPRKYVNRLSDLLFVLARVLNRADGGSDVLWNHERKL.. 183
230 2.000e-39UniRef50_A0A1Z8ZY40 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Gammaproteobacteria bacterium TMED92 TaxID=1986770 RepID=A0A1Z8ZY40_9GAMM  ali  30  12RVTTETGDQGTTSLATGRRVSKTAPIITALGSVDELSSLLGVLR---NQGSQALATELEAVQQVLFDLGAILAMEGQYQPQGL----AERIDALKAATEASNAELPPLKEFVIPGTNQANAQCHLCRTVCRRAESNVWAVLEDEATNSLQLRYLNRLSDYLFVQARKLS--DNPDEPQWQGPR.... 193
231 3.000e-39UniRef50_UPI000711C279 hypothetical protein n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI000711C279  ali  36  19.VTTKTGDKGSSSLYNGKRLPKSDLHFEALGTLDECNSYIGLAREFLTDESQEVDEYLENIQCILFNVCSAVATPLKTSSKMKTAFSEAYVNDLEKWSYILNQQLPQQESFFLPSGGKAASHLHVARTICRRAERCMVPLLEDEDIHPEVYRYVNRLSDFLYIAARFVSMKEKKPLKPWR....... 200
232 3.000e-39UniRef50_A0A1R3TC18 Cobalamin adenosyltransferase n=10 Tax=Bacteroidia TaxID=200643 RepID=A0A1R3TC18_9BACT  ali  36  6.VYTKTGDKGTTSLVRGMRVSKTHIRLDAYGTVDELNSYVGWLNCAVK--EEEHRDFLRYIQHKLFTVGSYLATETESKDPKPASIISERDVRIEEQIDIIDENLPRLDRFVLPGGNEAAARAHICRTVTRRAERNVYRVAEKFPVAEEVLIFLNRLSDYFFVFARYESNKT-SEEIFWEQG..... 184
233 3.000e-39UniRef50_A0A0P1JDH8 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=52 Tax=Bacteria TaxID=2 RepID=A0A0P1JDH8_9RHOB  ali  42  6KIYTRTGDKGTTALGNGNRVAKHDARVNAYGTSDELNSFVGVARLAAK---DEMDQRLSLIQNDLFDLGADLCRPEMEAEYPPXXXXXXXXXXXXXXXXXXXXXLAPLRSFILPGGSALSAHLHVCRTVARRAERLATELADHEDVNQHVVTYLNRLSDWFFVAARIAN-DDGKSDVLWVPGAN... 189
234 3.000e-39UniRef50_A0A0G4J4M3 Uncharacterized protein n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4J4M3_PLABS  ali  32  12RIYTRSGDQGTSSLYNGKRRPKSDPVFHVLGDIDELNAHIGLAREYCTTQDHAINKQMSMIQSRLLDIGTHVATPRSSSNEKRAAFPGGQTEILESWIDELDKSLPPLRNFILPSGGLPSAAIHVARTVSRRVERDLEPVIQDGDCDRSVGMFVNRLSDYLFVAARTAAHALGVPETTYKK...... 199
235 3.000e-39UniRef50_UPI00037A7331 cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Fangia hongkongensis TaxID=270495 RepID=UPI00037A7331  ali  37  7KVYTKTGDQGQTALSDNKRIFKHHPMVEMIGQIDSLNASIGVVVAFSD--NKSINETLQHIQHQLFNIGGHLSYP------ESPSISDADIKHLEDMIDRYNDQLPPLKEFILPGGSKAASLCHQARTTARAVERYYVELMQKEIINKMILQYLNRLSDLLFVLARYFNYDQNHIETLWASHR.... 182
236 3.000e-39UniRef50_A0A1Z9LZR8 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A1Z9LZR8_9BACT  ali  35  16RVYTKSGDSGTTSLVGGQKVPKNHPRIYAYGDLDELNVVIGGCREWIKEYTQDNQDFLERVQNELFNLGTMLATPTKDMGPQIPVIADEDVVQLENDIDRVNKDLSTLASFVLPGGSQANIWFHLGRTVCRRVERQCISLSADGEISLIVVKYLNRLSDALFVWSRWVNLQFNCNEHIWQP...... 202
237 3.000e-39UniRef50_A0A2E4X038 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E4X038_9DELT  ali  33  16...TRGGDQGETSLVGGLRVPKDDLRIETYGTVDELNSILGLCVQCPDAPDGAWKDQLAQIQHRLFDLGAELADARDGASG---SLCQDDVDQLEGWIEEALGPLEPLTSFLLPGGSYVSAHLHQARTVCRRAERLSVGLSRQAKVRSILLVYLNRLSDLLFALSRWVLHAGGHEAALWAPRR.... 192
238 3.000e-39UniRef50_A0A1U9YYF5 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=16 Tax=Bacteria TaxID=2 RepID=A0A1U9YYF5_9RHIZ  ali  40  6KIYTRTGDDGTTGLAAGPRRKKADIRMAAIGDVDETNAAIGLARLQEAG---DYDAALARIQNDLFDLGADLATPETGEAYEPLRIVDAQVAWLEAEIDRLNDALSPLNSFILPGGSALAAHLHMARTVCRRAERAMTRLAETEAVSKPALQYINRLSDLLFVAARHANGQ-GERDVLWVPGKN... 187
239 3.000e-39UniRef50_U9UQD1 Cob(I)alamin adenosyltransferase n=5 Tax=Rhizophagus irregularis TaxID=588596 RepID=U9UQD1_RHIID  ali  38  14.VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYYEQRRD... 199
240 3.000e-39UniRef50_A0A239SMW9 ATP:cobalamin adenosyl transferase n=22 Tax=Bacteria TaxID=2 RepID=A0A239SMW9_9STRE  ali  43  2RIYTKYGDTGFTRLYGGDRVSKTHVRVEAYGTMDEVCSLLGQIVAEMGNYDADLRNECEEIQQHLFDCGSDLATPRELRPY---KQKEADVQWLEERLDRYMHIPPKLEHFIIPGGHKIASSFHMARTMTRRLERRMVAVIEADEVNPVGLTYINRLSDYFFVIARLVNHRLDVSDTVYKRSAKIFR 188
241 3.000e-39UniRef50_A0A2D7NAS0 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D7NAS0_9BACT  ali  34  13KVYTKTGDRGITKLVGGQERSKSDLRIICYGEIDELNSFIGGCIEQIKILKKKMINILFRIQNELFNLGTLFATLSENHTSKLPKIEKSHIKNLEDDIDNFNSKLKPLKSFVLPGGSMCNTWFHLARTVCRRVERNAVSLNKIEKLDTASLVYLNRLSDALFVFGRWIINYQEQEESLWNPNHK... 202
242 4.000e-39UniRef50_A0A1G0HU29 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_41_15 TaxID=1798282 RepID=A0A1G0H  ali  35  6KIYTKRGDQGETDLAGGHRIAKHSLRIEVIGVVDEVNAAVGFAIEALKQHLPKNIDQCRRIQNELFNLGSQIAVLQQDRRENTPVIQLKNIEQLEIEIDEMNANLAPLKSFVLPGGSETAARLHLARTECRKAERAAVALARTEKSFEEILAYLNRLSDWLFVASRSVNATLQVEEILWQS...... 189
243 4.000e-39UniRef50_F5YQS1 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Treponema primitia TaxID=88058 RepID=F5YQS1_TREPZ  ali  31  3.ISTGLGDDGSTELLAGTWVPKDHPRVEFIGTLDELNSFLGDAKAAALLERT--KTIIDSVQRDLFVLATALDVPAGKEASILPGGGAVEPERLTAWLHEIEEK-HPMRGFIIPGANPVSAKLDIARTVCRRAERRLVTVARQETVSPKVLRYMNRLSDLLFILAR..................... 170
244 5.000e-39UniRef50_UPI0009465C03 cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Planctomycetaceae TaxID=126 RepID=UPI0009465C03  ali  34  2KIYTRNGDKGETGLLGGVRVPKSNLVIEVCGTIDECNCLIGCSITAWKHSDTDLESVLAKIQSELFDLGSRVAAALSLNPQTQPVLADEQSSQLEKWIDQFDGQLPALQTFILPGGSPVGSQLHLARTVCRRAERRLVSLIESQTDRDLSLVYLNRLGDLLFVMARYANQIGGSVETPW........ 193
245 5.000e-39UniRef50_A0A2K2RGM7 ATP:cob(I)alamin adenosyltransferase n=19 Tax=Actinobacteria TaxID=201174 RepID=A0A2K2RGM7_9ACTN  ali  34  6RIYTRTGDKGTTHLGDMSRVAKTDLRISAYADANEANAVIGTALA-LGGLPDEVAAVLTRVQNDLFDVGADLSTPVAENPQHPPLRVEQFYDRLEEDCDRFNGQLDKLRSFILPGGTPGAALLHQACTVVRRAERSTWAAAHGETMNPLTATYLNRLSDLLFILARVANKETG--DILWVPGGE... 189
246 5.000e-39UniRef50_A0A2D8UAL7 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D8UAL7_9BACT  ali  38  6KIYTKIGDGGMTHIGDSSLVRKDDLRIESIGDVDELNSMIGLVRHSV-VDESDLEGGLSMVQNDLFDLGADLCRPENEQQKKYLRIRKXNIEKLEKLIDSHNSHLKPLNSFVLPGGTIQASYLHVARSVCRRAERRVWALARREKINDNIAVYLNRLADLFFVLARYMNKK-GEIDVLWQPG..... 187
247 5.000e-39UniRef50_A0A0G1HEV9 ATP/cobalamin adenosyltransferase n=11 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1HEV9_9BACT  ali  34  3.IYTRTGDFGETSLFGGKRVPKYDDVVGLYGLIDELNSFIGLIVSVITVM--EVQEFLQKIQKDLFVLSSFFAGATVD-----FYHIEKRVKEMEARIDQMDEKLTPLHQFILPGGTMLASFIHITRSMARRVERKAVYVLKHVPDCPIILKYLNRLSDFFFILARFVNKQENAIETVWD-GKKVTR 188
248 5.000e-39UniRef50_UPI0009BACD16 cob(I)yrinic acid a,c-diamide adenosyltransferase n=3 Tax=Proteobacteria TaxID=1224 RepID=UPI0009BACD16  ali  36  2.................SRTGKDGLRIAAIGEVDELNSHIGVLLT--ETLPGDVRAALTAIQHDLFDLGGELCIPG------HTMVTPAHVLRLDQWLADYNADLPRLAEFILPGGSRAAAQAHVCRTVCRRAERAIVALGRAETLGEAPRQYVNRLSDLLFVLARVLNRAGGGQDVLWEHER.... 159
249 6.000e-39UniRef50_A0A0A8TUT5 ATP:Cob(I)alamin adenosyltransferase n=63 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0A8TUT5_ACIBZ  ali  36  7KIYTRTGDSGTTGLGDGSRVPKDDLRITALGDVDELNSIVGVLRSQISISDAHWDKSLSLVQHWLFDLGGEVCIPNYN------LLQPVCVEFLENEIDKMNEDLPMLKEFILPSGTLACSYAHQARAVCRRAERSLMTVHRDQNIQATALQLLNRLSDWLFVASRTLQRAEGGSEVLWQK...... 186
250 6.000e-39UniRef50_A0A2D6MLC7 ATP:cob(I)alamin adenosyltransferase n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2D6MLC7_9BACT  ali  35  3.IVTKTGDQGETARFGGGRVSKNDASVIANGDVDELNSAIGLLSARSDISGD-ILDDLKAIQSACFTIGAELATPPNASEEYIPRIKEQDLSYIEARINHMEPKLAPQKHFLLPGGTPAAAMAYWIRTIARRAERSVVIVHQEQGANPMLVQYLNRLSDYFYVLARYLNQETGVSEKIWQGGE.... 186
251 6.000e-39UniRef50_A0A2N2NKB6 ATP:cob(I)alamin adenosyltransferase n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A2N2NKB6_9CHLR  ali  32  4..YTKTGDDGTTGLLGKDRVKKYDLRMETIGSLDETSAALGLCRSFVCS--IEIQEIVLKVQKQLYLVMGEVAS-EKDVAEKFRVINQESVTWIENTIENISQKTTIPSEFIVPGDTKGGAFLALSRTIVRRAERRLAELLDLGIINQELLRFLNRLSSLLFILELYENIIVGKGD........... 175
252 6.000e-39UniRef50_A0A226PYV2 Uncharacterized protein n=1 Tax=Colinus virginianus TaxID=9014 RepID=A0A226PYV2_COLVI  ali  30  91........SGFSSTFTGERRPKGDRVFEALGTTDELSCAIGLARELSSDKGHAFVGQLHKVQLALGRLSQHVAVRAAQGLPTPHTLCEEPVLELEKWIDRYSEQLPPLRAFILPSGGKSSAALHLSRAVCRRAERCVVPLVQAGEADPNVAKYLNRLSDYLFVLARYAAMKEGKEEKIYTKPE.... 319
253 7.000e-39UniRef50_UPI00098515DB cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Marinicella TaxID=863253 RepID=UPI00098515DB  ali  34  3RIYTRSGDQGESGLVNGQRLTKADLLFDVLGDVDELNAQLGMIRALS--ADSKVDQQLSRIQHQLFDLGAQVA------QYKENNMKAADIKQLEDWIDDWQDQLTPLKQFILPAGNQAGSSAHLSRSICRRAERKAWQAAAGHDIEAEVMQYLNRLSDYLFVLARVLN---GGQEVFWQS...... 172
254 8.000e-39UniRef50_A0A2E8I0T2 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2E8I0T2_9PROT  ali  39  5KIYTRVGDKGTTSLAXGTRVLKNSARINAYGNIXELNSSLGMXRDQXELSADXIVQKVMXVQNELFXLGGELSLPPEIVNKKXXXIGSRQIQRLEAXIDEWNEVLPPLKNFVLPGGHPLNSMTHLARTXCRRAEREXVAATEIEEIREDVLSYXNRXSDWLFVXARXXSHLVNAEEVLWNQS..... 188
255 8.000e-39UniRef50_Q1LJ80 Cobalamin adenosyltransferase n=522 Tax=root TaxID=1 RepID=ATR_CUPMC  ali  34  7KIATRTGDAGTTGLGDGSRVGKNSLRIVAIGDVDELNSHIGLLLTE-PDLPEDVRAALLHIQHDLFDLGGELSIPGY------TLLKAPQVAQLDDWLAHYNAALPRLAEFILPGGSRPAAQAHICRTVCRRAERALVELGAAEALNEAPRQYLNRLSDLLFVLARVLNRAGGGSDVLWQRERE... 183
256 8.000e-39UniRef50_A3ZZL8 Uncharacterized protein n=1 Tax=Blastopirellula marina DSM 3645 TaxID=314230 RepID=A3ZZL8_9PLAN  ali  33  2KIYTKTGDDGETGLYRGGRVRKDDRRIVAIGDIDELNALLGIVLSLA--ASPEIAEPIGLIQSDLFALGAQIASPDPAAA-GTTLLNDDSITQLEQTIDLAESRLTPLTAFILPGGSTLGAHLHQARAVCRRAERHLVTLYDYDASASLALRYLNRLADLLFVLARWSNQLSGHHETEWHP...... 181
257 8.000e-39UniRef50_F2I7E1 ATP:cob(I)alamin adenosyltransferase n=8 Tax=Aerococcus TaxID=1375 RepID=F2I7E1_AERUA  ali  43  3.IYTRTGDQGMTRLYGGHSVSKASERVGTYGAIDQLNASVGYLAALVDPKYDQVQRQLLAIQQDLFDCGSDYATLDQERPY---KVKTGLADKLEAWIDDYTEATPSIKKFVLPRGTQAASFCHMLRTQTRTLERQLVQFSQSQDYNPQVLPYINRLSDYFFSLARALNHYDHYSEVPYKNSRDIF. 185
258 8.000e-39UniRef50_R5I4V5 ATP:cob(I)alamin adenosyltransferase n=10 Tax=root TaxID=1 RepID=R5I4V5_9BACT  ali  34  2KIYTKTGDSGETSLVGGKRVSKASLRVCAYGDMDELISYIGLLRCEIPDSDA----FLRKVQAVLMTGSAHIASEVENPRLTPFPY--EEIRTLEDEIDRLSAQMPPMKSFVLPAGPAAASHCHIARCVCRRSERSCVALGDHRPDVQDVIRYLNRLSDLLFTLGRYQCLAHNIPEDFW........ 174
259 9.000e-39UniRef50_A0A1F9VE92 ATP:cob(I)alamin adenosyltransferase n=2 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9VE92_9BACT  ali  37  2KSYTRGGDRGETGLFGGTRVPKDHPLVSACGTLDELNSALGAARAALAADASLKDEALARVQAECFALGAVLAAPGDKPAE----LPADATKRLESEIDAWDAGLPALKTFILPGGSQAGSALHLARAVSRRAEREAVGLAARQAVPEGVVAYLNRLSSWLFAAARWVNLKQGRPEPPWKGP..... 181
260 9.000e-39UniRef50_A0A2E1TDP2 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E1TDP2_9FLAO  ali  36  2KIXTKKGDKGYTQLLGGTRVTKNNKKLECYGTLDELNAFIGNL--YDEDINKXQKNILLIXQNLIFNIGSCIAFDKKKNKIDLPEISNDDIHILESQIDNMEKKLSPLTNFILPSGHPNASKCHIARTVCRRAERTLVSLSEHEEINFLHLKFLNRLSDYLFVLARYILLEENKNATEWKKK..... 181
261 9.000e-39UniRef50_A0A152A6Y2 Uncharacterized protein n=1 Tax=Tieghemostelium lacteum TaxID=361077 RepID=A0A152A6Y2_9MYCE  ali  41  35KIYTKTGDKGTSSLFNGERRNKDDMIFHVLGSVDELSSSIGVAKETLKSTDQDIIDKLESIQCLLLDIGSHIATPEYSEEKKRAQFPEEHVETLEKDIDFMDQHLQPLKNFILPGGGLVAAHFHTCRSLCRRAERDLVTLSHRDQIQPQVLKFLNRLSDYFFALSRYSSYLSNSTESLYKR...... 232
262 1.000e-38UniRef50_A0A174PKY2 ATP:cob(I)alamin adenosyltransferase n=70 Tax=Bacteria TaxID=2 RepID=A0A174PKY2_9CLOT  ali  38  3KIYTKTGDKGTTSLFGGSRVNKDSLKVEAYGTIDEVISYIGVAYSKIDV--KELKEELNHIQKRLFTLGAELASDEKGMTYLKDLISKEDIESLEKLTDKYMDIAGPMTEFVIPGKNEASAHLHVARTIVRRAERRMVTLNAEQGLREEIRKYTNRLSDTLFAMARYLE.................. 169
263 1.000e-38UniRef50_A0A2E5VIT9 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E5VIT9_9PLAN  ali  37  3.LYTRTGDEGQTGLASSRRVAKYDPRIATYGTVDELNAFVGLLRA--EDLDEDLDQKLGEIQNMLFEIGANLASEGEEASLNRIRPG---IAKLEDWIDACEEQLEPLRNFVLPGGHRTAALLHVLRTVCRRAEREVWSLGSHEKVPVEIGIWLNRLSDLFFAWARDANRRHKITDTPWERTPE... 180
264 1.000e-38UniRef50_A0A2E8R5M6 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E8R5M6_9FLAO  ali  33  2RIYTRTGDNGKTSLLSGKRVNKHNKRIIAYGSIDELNSFMGVVR---DYSPEDYKDEIFLIQNKLMIIASQLSNDKNY--DNIPNISKEDTEFLENAIDRMTDKLNPLENFIIPGGNKLISFTHVARCVCRRAETNISILKEKEDLNKEILLYINRLSDYLFTLARFFSKTLKINELKWN....... 176
265 1.000e-38UniRef50_A0A1G0RHJ3 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Ignavibacteria bacterium GWF2_33_9 TaxID=1798430 RepID=A0A1G0RHJ3_9BACT  ali  42  2KIYTKSGDDGTTGLFNGKRVKKFDLRVECYGTVDELASVVGLAVSF--GTDEVMKDDLQEISHKLFRFASDLATPNPPAKFKIARIEQSDIDYLENKIDTYDLELEPLRNFIISGGTNSAAFLHLARTVSRRAERRIIELNEKEDLGEFAVKFINRLSDYLFTAARIANSRAGKSDIL......... 178
266 1.000e-38UniRef50_UPI0009FBEBEF cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Bacteria TaxID=2 RepID=UPI0009FBEBEF  ali  35  10KVYTKTGDSGTTALLGGERVSKYHPHIVVYGELDELNSLVGMLHASLTTGTE--REFLLGVQADLFQMGAWLALPGSPLIERLAPLREEQVRQLEEQIDIWQGELPELKSFVLPGGDSSAALAHLARTVCRRTERGVCQLLDALPEGAYVAVYLNRLSDALFMLARVINVMRGVSENVWHP...... 195
267 1.000e-38UniRef50_A0A1J1AAP1 ATP:cob(I)alamin adenosyltransferase n=65 Tax=Archaea TaxID=2157 RepID=A0A1J1AAP1_9EURY  ali  37  3.VYTGRGDEGQTDLFDGSRVAKTNLRVQAYGTVDELNALVGMVR---PTGYADIDERLERVQNQLHILQAVLANPETGGE---PAIDDSHVQTLESWIDDIEAELEPQQEFILPGGGAAGSRLHHARTVCRRAERQVMALTEAEDVEQAPLVYLNRLSDLLFVTARLANKRDGVDEV.......... 172
268 1.000e-38UniRef50_A0A1S6IQV4 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=13 Tax=Firmicutes TaxID=1239 RepID=A0A1S6IQV4_9LACT  ali  45  5.IYTRTGDKGRTRIGGGQAVEKNDARIDAFGEVDHINSWCGLVEASLIKDGHDIRKDLRTIQQFLFDCTSDLSIPNGHRDY---KITGEHVTWLEGRIDHYDPELPEIMYFIIPGGSESASWLHVLRTETRNVERKIVTFMQAEPVNPSVLKFINRLSDYFFVVARLMNTRQGIEDVPYERSERVF. 190
269 1.000e-38UniRef50_A0A0G0YN64 ATP:cob(I)alamin adenosyltransferase n=13 Tax=root TaxID=1 RepID=A0A0G0YN64_9BACT  ali  46  2KIYTKTGDGGTTSLFGARRVDKNSARIAAYGEVDELNSLIGVILAELTPYPDCHIKKLLRIQSELFVLGADLATPA-DVKTKVPRITKRYITRLEEEIDSWSDKLPKLRNFILPGGNKVGSKLHLARSVVRRAERAIVDLNRQEKINQNVLIYTNRLSDWFFVAARYINKLENIRENIWKGR..... 221
270 1.000e-38UniRef50_A0A2H0MR72 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H0MR72_9BACT  ali  39  6KVYTKTGDGGDTALAGNVRVPKDSLRVETYGTVDELNCCVGIARTFNLRQPDKLEIILRSIQQRLFDIGSALATVPQSGR-PPLKLTESNVEWLENVIDAMNEELGPLKSFTLPGGGPVPAFLHQARTVCRRAERLVVKLKREEEISVMILPYINRLSDALYVFSRWTTLVFKETEFLWEP...... 190
271 1.000e-38UniRef50_A0A1F4VCN5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=candidate division WWE3 bacterium RIFCSPLOWO2_01_FULL_41_18 TaxID=1802625 RepID=A0A1  ali  33  2KIYTKTGDEGKTSLFRGKRVSKDAKIIESLGCLDELNSALGVSISYIKL--DEINLILTGVQRDLFTIG--FVLPSLEEQVRTSSRLKRRTSFVEKCIDKYSAKVSKLSNFILPGGSVPSSSLHLTRSVCRRCERNIVSFSKEEKVSGSIIMYLNRLSDLLFTLARYVNKMENTKEFIWSKRDE... 181
272 1.000e-38UniRef50_A0A090B603 ATP:Cob(I)alamin adenosyltransferase n=337 Tax=cellular organisms TaxID=131567 RepID=A0A090B603_ACIBA  ali  33  7KIYTRTGDSGTTGLGDGSRVAKDDLRIAALGDIDELNAIIGVLRAQITTDKAGWDKSLSLIQHWLFDLGGEVCIPNYH------LLQPVCIEFLEQEIDRMNEDLPMLKEFILPSGSLSCSYAHQARAVCRRAERSLMSVQRDQNIQATALQLLNRLSDWLFVASRALQRAEGGQEVLWQKNINEM. 191
273 1.000e-38UniRef50_A0A2W4N7F7 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4N7F7_9FIRM  ali  36  47KIYTRTGDRGETSLRWGQRVPKDALRVEAYGAVDEANCLIGLALAHLQAPGDRIREILLRVQRELFDVGADLAVPPERNKGEAPRITAAHVAGLEAAIDELDGGLPPLRHFILPGGSLAAAALQTARAVTRRAERRLVTLARQEPVDPELLRYLNRLSDLLFVCARAVNHALGIQEPPWNR...... 237
274 1.000e-38UniRef50_A0A2N9M6D3 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=49 Tax=cellular organisms TaxID=131567 RepID=A0A2N9M6D3_9BACT  ali  35  15RVYTRQGDQGETALAGGQRVPKDSLRIEAYGTVDELNSFVGVAQASAEPRAARLASILLRVQHELFNLGSILATLPDDVHPKQXXXXXXXXXXXXXXXXXXXXXLAPLRSFVLPGGSRLNAELHICRAVCRRAERDCVALARVESIPPETVRYLNRLSDALFVFSRWASHVSGAAETLWDPNQS... 204
275 1.000e-38UniRef50_A0A1V6I6Z6 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Bacteroidetes bacterium ADurb.Bin028 TaxID=1852798 RepID=A0A1V6I6Z6_9BA  ali  36  2KIYTKVGDKGNTSLLGGQIVRKDSLRIEAYGTIDELNSFIGMLLNF--KIDNSDKEIINFVQNRLFDIGSILAADEKNAKYKLPQLRHEDISTLEQAIDKNSENLPKLKSFVLPAGSEFISWCNISRTVCRRAERLIVSAKDEIFIPDEIFIFINRLSDYLFVLGRKYAIVYNIDEILWK....... 182
276 1.000e-38UniRef50_T0GN59 ATP:cob(I)alamin adenosyltransferase n=103 Tax=Spirochaetia TaxID=203692 RepID=T0GN59_9LEPT  ali  43  2KIYTKKGDFGQTSLATGVKVPKSDRRVELYGTADELNSTIGVVKSFLR-KESVLHSTLEMIQNLLFELGAELAGFQPKQESCIL---EEDIAFLENQIDQMQEKLEPLKKFILPGGTKAAAFLHISRTVSRRLEREMVKFKEEGEILSSPMVFMNRLSDYFFVAARFANLEENIQEPLWTSRTK... 182
277 1.000e-38UniRef50_A0A2G9IJA7 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Lactobacillus reuteri TaxID=1598 RepID=A0A2G9IJA7_LACRE  ali  41  2KLYTGIGDKGMTKLIGGDYVSKDSDRVKTYGTIDELNTYIGLVVSKLSSKDKDITNELLHIQSCLFDLGTDIANPNTNSSN--LRFNKENIKWLEHLIDKYQTEAPEIKRFILPGGSEVSSLLQICRTVTRRAERNLVTLSWCADVPNQIEVFINRLSDYFYAIARVTNYRLGVKEYFYENGNEVF. 187
278 2.000e-38UniRef50_UPI00084B7F2F cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial-like isoform X1 n=2 Tax=Hyalella azteca TaxID=294128 RepID=UP  ali  31  82KIYTRTGDRGTSATFTGTRHPKDHEIFEALGNIDELSAHIGLAREVGCARKHQYCEQLERIQCLLQDAASAIASSDQSSPWPSSGVNASHIQELEAWIDEYSETLPPLRNFILPGGGEAGAGLHVTRAVCRRAERSLVALKPAYALDPNINKYINRLSDFLFTIARYASIADNCKEVIYINPAK... 280
279 2.000e-38UniRef50_A0A0G1ZGE1 Cob(I)alamin adenosyltransferase PduO n=4 Tax=Bacteria TaxID=2 RepID=A0A0G1ZGE1_9BACT  ali  33  5KIYTRKGDDGTTGLFGGPRVSKTSLRVQTYGTIDELNAAIGVAKVFSNVSD--IKKLLERLQHKLMNTASILASPNNTDPARLPVMTEADVTGLEKCIDYFAQDLPPISTFIVPGQNKAGAFLSVARTTCRRTERMIVALSEIEDVDPAIRKFFNRLSDLLFTLERHEYFAGHIEEKYWEK...... 184
280 2.000e-38UniRef50_A0A222SFP4 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=A0A222SFP4_9CHLB  ali  34  2KIYTRTGDGGKTGLFGGARVDKDNIRVECYGTFDEVNAFVGLLRTKLP-SDHAWQGRLHDIQIELMNTMSLLATPPEAARSNTLPLPAEAAESCERWIDELEAAAGPSEFFLLPGGTEIAALCHVIRTLVRRGERLLVRLGRETEIDASVFSFINRLSDLFFALSRAELSSAGIEEEAWKKR..... 187
281 2.000e-38UniRef50_A0A0G0PVM6 Uncharacterized protein n=2 Tax=unclassified Microgenomates group TaxID=1794839 RepID=A0A0G0PVM6_9BACT  ali  36  3.IYTKTGDDGTTAIFGGTRISKGDPQVEAYGSIDELTSTVGLLVSHLSKKDP-LINFFHTVQEDLMVIGSVLAGWGGNVD-----VLEKRVRQMEMYMDVFSNKLSPLTHFILPGGSLTASYMHIARSVCRRAERTIVRLTRNHMHYAIIVKYLNRLSDLFFVYARVINKKAHMKELPWKGTK.... 178
282 2.000e-38UniRef50_A0A135L1C9 Cob(I)yrinic acid a c-diamide adenosyltransferase n=22 Tax=Bacteria TaxID=2 RepID=A0A135L1C9_9BACI  ali  36  3KIYTKTGDQGYTSLTGGKRVKKNESMVEAYGTVDEANSMIGLALAKIDQNNELEKNMLLNVQHDLFHVGAELSTPV--GEKVYWPLNTKQIERLEQYIDKLDQELPQLQQFILPGGSEAGATLHLARTMIRRAERNAI---SIPQIKKEALAYLNRCSDFLFVAARWINMKSGKKENHFTPVQ.... 182
283 2.000e-38UniRef50_A0A1G6MMF2 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Williamwhitmania taraxaci TaxID=1640674 RepID=A0A1G6MMF2_9BACT  ali  35  5KIYTKGGDKGTTSICGGIRVEKDDIRIEANGTLDEACSTIGIARAMLK-DDKELHDMLLAIQESMMTIMGVVATPSIMLYEHPPRLPELTTEWMEKHIDDIHAEMGDDEFFLLPGGNILSAQIHVARTQLRRAERHLVALNRVDELHEVVIPWVNRLSDLFFALARVTLHRSGDGEDKWHK...... 185
284 2.000e-38UniRef50_A0A2V5UZ56 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=18 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5UZ56_9BACT  ali  33  3.IVTKTGDKGETSLMYGRRLPKGDSRVDAYGCIDELTAALGLARSISTDK--FLSDEIFAAQKDLIVVMGELATAPSDRKDGFELTTQAMVDRVTAVIFDLEKDKSLPKDWVIPGETPVSAALDFARATCRRAERRIAAFSAEKDFNLEILRYLNRLSDFCWVLARYAEKQAQTS............ 180
285 2.000e-38UniRef50_A0A058Z703 Uncharacterized protein n=1 Tax=Fonticula alba TaxID=691883 RepID=A0A058Z703_9EUKA  ali  34  40......GRRGTSSLYNGTRVSKSDPVFLTMGHVDTLNSSIGVAIQFLTSHKDMIADHLVLVQNWLFDLGAHIATPRTSSNPTKINATQFDDTQLEEWIDDISARLPPLKNFILPSGGYASSHLHMARSYCRMVEPHLVTLVVDRQCHPSSLAFINRLSDYLFVAARLASQADAVPTATYQK...... 222
286 2.000e-38UniRef50_A0A2M8F5Z5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_9_14_0_2_um_filter_53_11 TaxID=1974780 R  ali  36  3KIYTKTGDDGTTGLLGGGRVGKDDPRMEVIGTLDELNASLGIAHRSVTES--LSRHHLENLQRELFDLGAILAMPAENAVEGRPRPTLPSSSWIEDVIDELSGDLPPLAQFILPGGRPGAANLHLSRTICRRLERQLTTFHKATPQPADLLAYINRLSDLLFVMARWENFQRNEPERYW........ 189
287 2.000e-38UniRef50_A0A1Z9TK51 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Proteobacteria bacterium TMED261 TaxID=1986846 RepID=A0A1Z9TK51_9PROT  ali  30  9.VTTRTGDSGYSSLATGKSVKKSSESIRALGGLDEINSSIGLAICYISDEP--VLEFLTEIQQTLFDVGALIALEGEFDSPN--------IEIVENQIKLENRKLPPLEEFVIPGGAPGCAHLHHSRTICRRVETELWDLIAKNEKLEGAGVFLNRLSDYLFVAARKVSTNNGQ----WRGPE.... 176
288 2.000e-38UniRef50_A0A2G9T3J6 ATP:cob(I)alamin adenosyltransferase (Fragment) n=1 Tax=Teladorsagia circumcincta TaxID=45464 RepID=A0A2G9T3J6_TELCI  ali  29  2....GTGDSGKSSLFNNERRWKDDDAFQALGNTDELSSLLGVCREAVLDDIPELVEVLTRLQCCLQDIGAHLATPSSERKKEMTHIDTHMVDWIHAEIDRFGDQLPPIKQFILSGGGPTSAHLQFARAVCRRAERSVVPLVRDEEADPQAMKC----SDLLFVLGRYACMKTKHDELTY........ 177
289 2.000e-38UniRef50_A0A1G3WI67 ATP:cob(I)alamin adenosyltransferase n=8 Tax=unclassified Tenericutes TaxID=713063 RepID=A0A1G3WI67_9BACT  ali  32  2KIYTKRGDQGQTDLMT-KRVSKADLHISVNGVIDEAMAFILMSKHYIMNPD--ILSDLDQIHDHLFSICHEIAL----NDQTKHISNFPQVTWLESRIDYFDSLLAPLTKFIKLDQTKAASMINIARVTVRRAEREMVLLNDQQELNIFTLSYLNRLSDYLFTLGRFLD.................. 163
290 3.000e-38UniRef50_UPI0009BB6515 cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Varibaculum timonense TaxID=1964383 RepID=UPI0009BB6515  ali  37  2RIYTKTGDKGMTSLFDNKRVSKDDIRVESYGTIDELGSWLGLVKNYVE--DKEMYSIVENIQNKLFTVATNLATE--DKSKVKFHIHEEDIEELEKIVDYYMGKIGNPTGFIVPGSGKKSAYLHVARTVCRRAERRITSLSGVAEVDALVIKYVNRLSDALYAMARSSEEEE............... 169
291 3.000e-38UniRef50_A0A2G2IIW5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2G2IIW5_9PLAN  ali  31  2KIYTKTGDSGQTGLYRGQRVSKDSLRISAIGDADETCAFLGLVLT--EELPEQIATILTRIQGELFCLGAELASEDPSAAGTNFLTLAHIGQ-MESEIDSLEERLPQMTAFILPGGSKAGGLLHVARAVCRRLERTIVGLKQSDTSMEIAIQYVNRLSDLLFVMSRSVNQHLGRQEITWNAPK.... 183
292 3.000e-38UniRef50_L1J018 Uncharacterized protein n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1J018_GUITH  ali  37  28.VYTRTGDKGKSSLYNGERRRKDDKIFHALGDIDELNSAVGIGKEMIKVEDDILLARLEDIQCRLLDLGAHIATPTSEKKVKRMKVEDVWVDDLELWIDEMDKELPPLKNFILPSGGLASATLHNARTVCRRAERNVVALQQDEQIDASAVRYLNRLSDFLFVSARRCAKLAGKPEALYQSG..... 216
293 3.000e-38UniRef50_A0A075B5C4 Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase-like protein n=10 Tax=Eukaryota TaxID=2759 RepID=A0A075B5C4_  ali  40  12KIYTKTGDKGVSSLYSGERRAKTDDIFNALGTSDELSSHIGVALEYCASPDQELSNRLQKIQCILQEANSVIATPRRHEEDKKMEFSPNYTVNLENWIDEMENELPKLTSFILPSGGLASSHLHVCRTVCRRAERMIVHLSSKKECNSDVSIFFNRLSDFLFTAARFACFKSGKKEFIYKK...... 195
294 3.000e-38UniRef50_A0A256W610 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bacteroidetes bacterium 4572_112 TaxID=1971630 RepID=A0A256W610_9BACT  ali  34  3.IYTKGGDKGQTSLIGGKRVPKYSLQVEAYGTIDELKSYTGLIYDLFE--DKQTKESLLKVINQLFVAESLMSIDKIERGEKMQQIKISDIEFLEKEIDRMTEQLAPLTAFILPGGHPTISHCHIARTICRRGERAYLRFLATDGENENILKYLNRLSDYFFTLARFAAKENDVEELLWQ....... 182
295 3.000e-38UniRef50_A0A2D8S5A3 ATP:cob(I)alamin adenosyltransferase n=16 Tax=root TaxID=1 RepID=A0A2D8S5A3_9CHLR  ali  38  5KVTTKTGDNGETGLVNNVRLSKDHPRIVAIGEIDHLNSFLGWSIS--ECSDSDLRSDLKDIQQDLFNLGGELAMPDT----QHLLLKEQRLMFLEQKIETFTEKLPPLEEFVLPGGIEFSSRLHIARSGCRSAERAIVALYKKEVGIALHIKYLNRLSDYLFSLARWVNLSGGGKDEEWIHEK.... 181
296 3.000e-38UniRef50_A0A222P9T5 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A222P9T5_9FUSO  ali  41  2KIYTKYGDKGFTKLYGGKKVSKNSSRVDAYGTVDEVCSMLGVLVAKMRNVTEEILKECEKIQQQLFDCGSDLATP---DKLREYKQESGDVKWLESLIDKYIPQMPKLESFIIPGGSEISSLFHLIRANIRKLERKIVKLFEENEVNEYGMQYINRLSDYFFVVACISNVKMGVKEVVYKKSSKVFK 188
297 3.000e-38UniRef50_A0A2E6M2M5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E6M2M5_9GAMM  ali  36  7KIYTRTGDAGTTAVSDGKRISKSSPRIKALGALDCLNAHIG--IMLCEALPPLVQTQLERLQHILFDIGGELSMPELVS------VTGESIKELENQIDLMNESLEPLKEFILPGGSKASAQCHLLRTETRSIEIQLIELHETETLRQDITAYVNRLSDWFFVAARYILLQEGKPEVLWKNP..... 180
298 3.000e-38UniRef50_A0A2E8S1I5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E8S1I5_9DELT  ali  34  6KIYTRKGDDGSTGLVDGSRVRKDDPRVVAYGSVDELSANLGVVHVLLIQNANSIAGFLVDVQQDLFDLGSQLATPE-DSDIELPSITDDHVAALETELDRCNENLEPLASFILPGGNLVGAQLHVSRTVCRRAERCCVSLPGVDEPGRRIVRYLNRLSDLLFVWSRWVHACSGTEDLLWKPGQ.... 196
299 3.000e-38UniRef50_A0A2D6E7T1 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D6E7T1_9BACT  ali  35  2RIYTRTGDTGETSLIGGRRVGKHDPRISVCGDLDELSASMGAALAELP-EGHDLRDEVDRVQEDLFGIGAEVAAPGAEAGRM---LRDERVAALEASIDAMESGLEKLTGFLLPGGGKAGAALHVSRTVCRRAERSLVGLSSGDDVRPAILGYMNRLSDWLFVAARRVNREEGSPE........... 175
300 3.000e-38UniRef50_A0A2N9NZM6 ATP/cobalamin adenosyltransferase n=42 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2N9NZM6_9BACT  ali  29  7.IVTKTGDQGTSALMYNRRVSKCHPRLEACGTVDELNAALGLARATAPDRFG--QEQLLAAQKEIVGLMGELATAQEDMREGYALVNLGMVTRLEKAVSDLEAQEAHGRGWATPGATLHTAALDMARAVCRRAERRVCALQEAKEIRAEPLIYLNRLSDLLWLMARRAENAGATPE........... 184
301 3.000e-38UniRef50_A0A2E9X4Y3 ATP:cob(I)alamin adenosyltransferase n=9 Tax=unclassified Gammaproteobacteria (miscellaneous) TaxID=33811 RepID=A0A2E9X4Y3_9GAMM  ali  37  24KVTTRNGDKGQTRIANNRKVSKSDALVRALGSTDELNSAIGLLRCHINAA--LFDTQLAEQQQLLFDIGAVLATGGDYETPAIAAGLDAVTANSE----ALNNALPALREFVIPGGNLAAAHTHMCRTICRRAETDLWAAMQAWQTDEIAGACLNRLSDYFFVLARTL--VVGQQEDQWRGP..... 206
302 4.000e-38UniRef50_A0A1M7MBZ2 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Thermoanaerobacterales TaxID=68295 RepID=A0A1M7MBZ2_9FIRM  ali  37  2KIYTKKGDKGETSLLGGKRVKKSDIRVEAYGTVDEVVALIAFARANVNTQKSK--DLLLKVEKELFKLGAELACAE-PEKVLKDRITEDDIMWLEDKIDDLMEEIEFKKDFVLPGPYPSSSSLHIARTVVRRAERLVVRLSEEENVRPEVLRYLNRLSDFLFTLSLYEEKEEVVKRSLEEIKKKI.. 183
303 4.000e-38UniRef50_A0A1Z9CKE3 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A1Z9CKE3_9PROT  ali  36  29KVTTRNGDSGKTNLAKGEKVLKSDDIIHALGEVDELSSVIGVCVTL--SKDSDISNFLMKIQNDLFDIGGHISMNLNEDS----VVNIEMISELENQIKLLNENLDPLTEFILPSGNNFSANLHVARAVARRAERSTVQLYIDSLSNNPVIMYLNRLSDYFFVLSRYYNRQNSIPETTWKR...... 203
304 4.000e-38UniRef50_A0A2D6V936 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2D6V936_9GAMM  ali  29  16RVTTQTGDNGTTALGTGRRVSKTDPMITALGSVDELSSLLGVLRNLQIN--PELSTQITDVQQVLFDIGAILAMEGQYQVE----QMDARIDALKSITETCNSTLPPLREFVIPGSNQTNAQCHLCRTVCRRAEANVWAVLETTDLNKQAGRYLNRLSDFLFVQAR---XLANXPEAQWRGP..... 196
305 5.000e-38UniRef50_A0A2E4DJA8 ATP:cob(I)alamin adenosyltransferase n=10 Tax=Bacteria TaxID=2 RepID=A0A2E4DJA8_9BACT  ali  34  6KVTTKTGDKGETGLGDGSRVSKSHPLIRLLGEIDELNSY--XGRAIASCNKDTIIXELQSIQQDLFNMGGEVSMP----KTEINLLTKDRISFLEDRIAKLNEQLPPLEEFILPGGDEFCSRIHVLRAVCRRVERYCVEVMEEGLKIRYWLLYLNRLSDYFFVLSRYYSLEDGEDEILWNRNK.... 182
306 5.000e-38UniRef50_A0A0G1IIL5 ATP/cobalamin adenosyltransferase n=13 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1IIL5_9BACT  ali  33  3KFYTGQGDTGETSLFGCQKVSKTNPKIEALGAVDELNSYLGVCKSLAADEN--VKKALLGAQENLFIIQAELAGAEKRLDEAKLKS-------LEKTIDELGEFVGPITKFTIAGGEPLSAHLDYARAVCRKAERFTAELQEEAKPPWLALAYLNRLSSLLFVLARYTNKKAGVSE........... 177
307 6.000e-38UniRef50_A0A1X7QM74 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Lactobacillus TaxID=1578 RepID=A0A1X7QM74_LACCU  ali  34  3.IYTKTGDKGTTALFDGRRVKKFDDRVEAYGTIDECNSQLSVAQKFCKI--PRNIELLETIQNNMFIVAGELATDNTDKFYKSHQVTEDDVHLLETTIDYYTDKLPVIHEFILPGKSIAGAHLHLCRSVCRRAERLIVRLNEDKPVRPGLLKYVNRLSDLLYILARAEDKEKLVDEVVRRYQEKV.. 189
308 6.000e-38UniRef50_A0A1G4U819 Cob(I)alamin adenosyltransferase n=26 Tax=cellular organisms TaxID=131567 RepID=A0A1G4U819_9RHIZ  ali  36  6RIYTRTGDDGTTALGTGERRPKYDLRIAAYGTVDETNALIGVARLHTSAAPADMEAMLARIQNDLFDLGADLATPETGEDYTPLRIVATQVDKLERDIDTLNASLKPLRSFVLPAGTPAAAHLHVARTVCRRAERMAVELSATLGVTPEAVKYLNRLSDLLFVMSRIANARAAGEDVLWVP...... 196
309 6.000e-38UniRef50_UPI000686239B cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Clostridiisalibacter paucivorans TaxID=408753 RepID=UPI000686239B :_  ali  37  2..YTKTGDRGDTGLFGGSRVNKDNLKVECYGTVDEANSMIGVAYSLVKNR--EIKDELREIQKRLFIVGAEIASDANGVEKLTDKISQRDVELLEETIDIHTAEVEPQDGFVIPGGAVSASTLHMARTVVRRAERLVVSLDNQVEINSNIKKYLNRLSDVLFIMARVEEKYNFIQEV.......... 174
310 6.000e-38UniRef50_A0A2U3L985 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Syntrophobacter sp. SbD1 TaxID=2043167 RepID=A0A2U3L985_9DELT  ali  40  18KSYTGRGDLGRTDLYSGERVPKNHPRVEAYGDVDELNSVLGVLLSALPESKGDLRAQILHIQSLLFTAGGWLATTADSPKFETVVNIAESETRLERFIDGMDRELPRLKEFLIPGGHISAAFAHVARTVCRRAERHVVLLSRAHIELMALITFLNRLSAYLFTLARYLNRLHGIGDAAWKNSDS... 208
311 6.000e-38UniRef50_A0A2E1RF47 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Halobacteriovoraceae bacterium TaxID=2026745 RepID=A0A2E1RF47_9PROT  ali  34  6KLYTKLGDDGTTSLVSGNRVHKSDLRIDLYGDLDELNSLIGFCISSLGGKFEEQEDFLKSIQKDLFVMGSNMACEEEERSKYKLPILEEVITRVEKNIDRLDSELPKLTSFILPGGNETAARLHLCRTYTRKLERKLANFDKTEPAPKYYIKFLNRLSDYFFVASRYVNFLDNINETKW........ 186
312 7.000e-38UniRef50_A0A0C2SFJ6 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Jeotgalibacillus campisalis TaxID=220754 RepID=A0A0C2SFJ6_9BACL  ali  42  151RIYTRTGDKGQTSLIGG-RVDKDDIRVEAYGTIDEVNSFVGKAVADLKTKFKDIVEDLEAIQHELFDAGGDLA---NVSSKREWKLDVKAIDQLELRIDQLMDEAPDLERFVLPGGTAASASLHVARTITRRAERLVVSLSKADAELPAAQQYLNRLSDYFFACARAVNARDGVADVEYIRSAKVFR 335
313 7.000e-38UniRef50_A0A0G0FLU7 Cob(I)alamin adenosyltransferase n=39 Tax=root TaxID=1 RepID=A0A0G0FLU7_9BACT  ali  40  20.IYTKFGDKGKTSLYAGKTISKGSLRVNAYGTVDELNSFLGVVLSLVK--DKKLKTKIIVVQKDLFETGASLASPTGNKNKNLSKYLNKRVLEFEAEIDSLTKKLPKLENFILPGGGKTGSNLHFARTLVRRAERRVVELSEKEKINTDIIIFLNRLSDLLFMYARDINLKAKQKELLWKSRE.... 199
314 8.000e-38UniRef50_A0A2E5E0T2 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Planctomycetes TaxID=203682 RepID=A0A2E5E0T2_9BACT  ali  37  2RLYTGRGDDGNTDLFGGDRVPKHHLRVDAYGAADEMNASLGLAVTACGPTDERLHEILLRLQDRTFVLGADLATPGGPHEDKVARIQMSDVKELEGFIDEIDGDNEALKTFILPGGCELASRLHLARAISRRCERQVTRMLESEGGDMAKLLWMNRISDLLFAMARAANRLQGLPDVPWTPS..... 184
315 8.000e-38UniRef50_A0A1Z8V1C7 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z8V1C7_9PROT  ali  43  6KIYTRGGDKGSTSLGDGSRVDKSSARIKAYGEVDEANSSIGIAVA---FSSSKIKNILLAVQNDLFDVGADLCFPTQQKKKXXXXXXXXXXXX--XXXXXXXXXLSKLESFILPGGTRSSSFLHLSRSLVRRAERSIVELDKGEEVNPNVIKYINRLSDFLFVAARFENKKEG--DILWVPNK.... 181
316 8.000e-38UniRef50_A0A1Y0GY38 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Armatimonadetes bacterium Uphvl-Ar1 TaxID=2004467 RepID=A0A1Y0GY38_9BACT  ali  37  2KIYTKTGDDGSTGLLGGDRVSKDDLVIHTLGDLDELNATIGLAIAHRAVLSER----LLEIQSRLFDLGAEVASLS-EDKRFIXXXXXXXXXXXXXXXXXXXXXLPVLMNFVLPGGTPPASTLHIARAVCRRAERSMVAVAEDSSLRPEGVQFLNRLADWLFTMARLENARTGTPETIWRKS..... 178
317 8.000e-38UniRef50_A0A2S9YCR1 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=39 Tax=Bacteria TaxID=2 RepID=A0A2S9YCR1_9DELT  ali  38  6KVYTRFGDEGQTMLASGDTVSKSSARVHAYGEVDELNAVIGLVRANHEPFRAALDAELARIQQELFNLGSELATPAAADGGARLKVEAHHIEALEQSIDRYNELLEPLRSFILPGGGPTGTAAHLARTVCRRAERMLVGLAHDEPIRGEARRYLNRLSDWLFVIARATAARFGYDEVLW........ 193
318 9.000e-38UniRef50_A0A0S8HHT0 Cob(I)yrinic acid a c-diamide adenosyltransferase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A0S8HHT0_9BACE  ali  31  2KIYTKTGDEGSTSLLGGTLVPKNDSRIEAYGAIDELNSWIGLL--SAQNLNQHDKDILLHIQDRLMLLSSHVSDEKNTLQNLSMLEEKD-VTMLEQEMDHFNSFLTTLKSFIVPRGDQAVASCHLARSVCRRAERRLVPIIKERKELVIAMKFLNRLSDYLFMLSRKIGQEHDIKEITWKPK..... 180
319 9.000e-38UniRef50_A0A2I7N7Q9 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Neisseriaceae bacterium DSM 100970 TaxID=2052837 RepID=A0A2I7N7Q9_9NEIS  ali  31  2KIYTKTGDTGETSLYNGTRVSKADILIDVLGDSDELSSYLGLVHDLVEDKNSK--NQISEIINTLFRLNASIA----KAKGYETLNLTENINQLESFIDKMDLELPPLSSFIYLFGHPIISQIHIARSICRRLERKLVTAFQFESIEPSQQIYLNRLSDYLFVLARFTAKNLNVEETPY........ 174
320 1.000e-37UniRef50_A0A1G0HA25 ATP:cob(I)alamin adenosyltransferase n=2 Tax=unclassified Gammaproteobacteria (miscellaneous) TaxID=33811 RepID=A0A1G0HA25_9GAMM  ali  36  7KIVTRTGDDGHTNL-GKQRVPKDNILIEVLGTLDELNSTLGLCLSLGTPNNQLIVTALTQIQQDLFNIGGELYAPEH------PVITTEKISRLEELINNWNTTLPPLKEFLLPGGNPASAACHLARTVCRRLERRLVTLHQQHPLNREILRYTNRLSDLLFVLARILAKDTHEQEVVWERS..... 182
321 1.000e-37UniRef50_R6EX05 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Prevotella sp. CAG:520 TaxID=1262929 RepID=R6EX05_9BACT  ali  36  4KLYTRHGDTGQTSLVGGKRVSKDDIRIAVCGDLDELNAHIGLLLSF--GVPERESAVLIRVQQLLFHIGGELSNPDYTMSSH---LTAADIAQLESSIDTLQQQTPEPTTFVLPGGCAAAAESHICRTVTRRAERSMVAMSHQYRVDPLAMQYVNRLSDYFFVLALNLNFISSIDEK.......... 175
322 1.000e-37UniRef50_A0A1H7PZ57 Cob(I)alamin adenosyltransferase n=4 Tax=Alkalibacterium TaxID=99906 RepID=A0A1H7PZ57_9LACT  ali  41  9KIYTGRGDHGNTNLIGGQTVRKTDVRVDAYGSIDELNAQVGLLASLVDEEKNIIKESLSRIQHNLFDIGSILA---DKGNKLGMQFDLSEIQTIEQEIDELTEKVSEINYFILPGGAKQASQAHIARTVTRRVERTVLKLNEKEPVAEPPLIYLNRLSDYFFVLARYLNKLAEKEEVYYTKTGKVF. 195
323 1.000e-37UniRef50_A0A2N5YWI7 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YWI7_9BACT  ali  36  2KVYTKTGDKGQTSLLGGQIVDKDNARLEAYGTIDELNSFVGMIRNFIK--DEYDINLIAFIQNRLLDIGSELSAVDEGAEFPLPKIKKSDIDYLEQSIDRYCVNLPKLKNFVIPAGSELISLCNISRTVCRRAERRIISIEDAKNKYSDIIIFINRLSDLLFVMGRKFDKEQNVDEILWN....... 182
324 1.000e-37UniRef50_H0AFC4 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Haloredivivus sp. (strain G17) TaxID=1072681 RepID=H0AFC4_HALSG  ali  40  2.VYTRTGDEGRTDLSSGERVSKSSNRIEAYGTVDELNSQTG----LCAHYSDEKSDELEKVQNHLHILQAELA-----NRDPDVMVSQDEIDWLEGLCDDYQNECPPLRDFILAGGCESASHLHMARSVARRTERRIVELDQDEELRPQVLAYINRLSDLFFLMARHENFLEDVEEK.......... 168
325 1.000e-37UniRef50_A0A202E7I6 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Natronolimnobius baerhuensis TaxID=253108 RepID=A0A202E7I6_9EURY  ali  35  3.IYTGRGDDGETDLRDMTRVSKASPRIEAYGTVDELNALIGTIR---PSGYDDIDDCLQMVQNHLHIIQAEFATP--EPDEDDPEIRPDHIDTIETWIDDFDEELEPLTSFILPTGSDAGARLHHARAVCRRAERRSVALAETEQINNDAVQYLNRLSDGLFTFARVVNARDGEPE........... 172
326 1.000e-37UniRef50_A0A2E2UDA3 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Halobacteriovoraceae bacterium TaxID=2026745 RepID=A0A2E2UDA3_9PROT  ali  37  6.VYTRTGDKGETSLVSGTRISKANMRISLYGEVDELNSHIGFMRSLYPKEESKHNELFDSIQSSLFDLGSKLACESNWEKYKLPDIKAEMILSMESVIDELDGLLPKLKNFILPGGTQAASYTHVVRTACRKVERKLIDFDNTQSIPENSIIFLNRLSDFLFVYARYCNYVANQEERIWKP...... 189
327 1.000e-37UniRef50_A0A0D6EXJ7 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=60 Tax=root TaxID=1 RepID=A0A0D6EXJ7_9PROT  ali  37  7KIFTRGGDKGSTGLGDGSRTNKFSDRIVALGAIDELNSMIGLMLT--ESLPPKIIKMLTVIQHHLFNLGGEISMPGYKI------IQKNDVLELEEIITSYNKDLPPLKEFILPGGSKAAAFCHMARTICRRTEQAIFKLNSKDAINAYSLQYINRLSDLLFVLARVINKHKKVKDVFWKK...... 179
328 1.000e-37UniRef50_A0A1G2PNW8 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Terrybacteria sp. (strain RIFCSPHIGHO2_01_FULL_58_15) TaxID=1802363 RepID=A0A1G2PNW8  ali  37  3KSYTRTGDDGTTGRFGGARLKKSSPLIAVLGALDEANAAIGLARALSQHEPDELDERLEKLQHLLFRIGADLSTSLDHTDPRAPRLIAADTREIEKAIDTLDVKLGELRKFILPGGTPAASALHLSRAIVRRAERAAIHAREAGEFNPEILPYLNRLSSYLFALARWANKQKGAEEK.......... 181
329 1.000e-37UniRef50_F8JH50 Cobalamin adenosyltransferase, methylmalonyl-CoA mutase cofactor biosynthesis protein n=1351 Tax=root TaxID=1 RepID=F8JH50_HYPSM  ali  40  6RIYTKTGDAGTTALGTGERVPKTSPRIAAYGTVDETNAAVGVARTHLAGSEPDVDAMLLRIQNDLFDLGADLCVPDKGEKYEPXXXXXXXXXXXXXXXXXXXXXLTPLRSFILPGGTPAGAALHVARTVSRRAERMMVELAAVPDVSAPALKYINRLSDFLFVASRYVNDR-GKGDILWVPGKN... 192
330 2.000e-37UniRef50_A0A1F8RF53 ATP:cob(I)alamin adenosyltransferase n=9 Tax=Bacteria TaxID=2 RepID=A0A1F8RF53_9CHLR  ali  39  9KLYTRTGDLGETALFGGGRVPKDHPRVEAYGSVDELNSTLGVAVSFIRQRRAAAALQAIQ--NELFNVGSELASEPRAEKGRMXXXXXXXXXXXXXXXXXXXXXVPRLRTFILPSGSRAGALLHLARGACRRAERAVVRLSRQEEVNPQIVVYLNRLSDLLFVLARYVNKAARKPETPWRKG..... 190
331 2.000e-37UniRef50_R5PI39 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Prevotella TaxID=838 RepID=R5PI39_9BACT  ali  35  2KIYTRTGDDGTTSLPDGKRTYKTDWRIELYGTMDELNSYLGLLTSVMEDGRDK--DFISEIQCLLFRIGNEFAGFSQST------VSASDVAGLENEIDRLQSSLPPLHSFVIPGGTPAAATCHVCRALCRRAERRMLSMTERNANDNTSLAFMNRLSDYLFVLARNLNFISNTAEKT......... 171
332 2.000e-37UniRef50_A0A2E4Y3J1 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Halobacteriovoraceae TaxID=1652132 RepID=A0A2E4Y3J1_9PROT  ali  36  7.IYTKSGDKGKTSLVGGKRVSKSDISLALYGEIDELNSWIGVILSEIEGKDYINNQLLKKVQVSLFNLGSNFACEPEKRKSFKPQLVEEDVLNIENEINEMDSDLKELKNFILPGGSKLSSFLHILRTVCRRVERILIAYSEKNGLPSFSGEFINRLSDYFFVFSRWVNFKEGREEELWKPS..... 192
333 2.000e-37UniRef50_A0A2T0B1C8 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Clostridiales TaxID=186802 RepID=A0A2T0B1C8_9CLOT  ali  38  4.IYTRTGDKGTTALFGGSRVEKDSLKVEAYGTIDELISNIGAASSFIK--DEELKAELADIQKKLFVLGAELASDEKGIKHLKEQIEQKDIDDLEKIIDKYMGKAGAFKGFVTPGKNTQSAMLHIARTVARRAERVIITLSKEGNVREDIRKYVNRLSDALYAMARFEEEK................ 171
334 2.000e-37UniRef50_A0A0G1FS62 ATP/cobalamin adenosyltransferase n=11 Tax=Candidatus Gottesmanbacteria TaxID=1752720 RepID=A0A0G1FS62_9BACT  ali  37  21KVYTRTGDSGKTSLYGGKRVAKDNFRVEVYGTIDELNSVIGILLSDMG-SEENLFNFFKAVQADLFSAGAYLAG-----DKTDLDFLRERTGEMEKLIDILDEELPELKNFILPGGTVTASFAHLARSVCRRAERKAVSL---PKTDSRLVAYLNRLSDLLFITARYLNWKNGLKDTVWFKKK.... 194
335 2.000e-37UniRef50_A0A210UUV2 ATP:cob(I)alamin adenosyltransferase (Fragment) n=1 Tax=Klebsiella pneumoniae TaxID=573 RepID=A0A210UUV2_KLEPN  ali  37  3.IYTRTGDAGSTSLFTGQRVSKTHPRVEAYGTLDELNAMLS--LCVCAVAEEEQRTLLEALQQHIFWFSAELASDSEQPSPGKRYISSEEIALLEQTIDREMARVPALHQFVLPGRCEAASRLHLARTVARRAERRLVELGAEVTIRQMLLRYLNRLSDCLYALARSEDHAA............... 171
336 2.000e-37UniRef50_A0A1U2Y4I6 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Corynebacteriales TaxID=85007 RepID=A0A1U2Y4I6_9MYCO  ali  34  156RIYTRTGDDGTTGLSDFSRVAKTDARVVAYADCDEANTFIGTALALGGEIPEAITTVLTTVQNDLFDAGADLSTPVVDDPKYPPRIEQSYIDALESWCDAFGADLPALNSFVLPGGTPFAALLHQARAVTRRAERSAWAAVDADPDHTSVLPYLNRLSDLLFILSRVANRGPGGDDVTWVPGGDRHR 346
337 3.000e-37UniRef50_G6B0U9 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Prevotella TaxID=838 RepID=G6B0U9_9BACT  ali  37  2KLYTRHGDTGQTTLVGGKRVMKDDIRIAVCGDLDELNAHIGMLLSF--GVPERELNVLIRVQQQLFHIGGELSNPDFAMPSH---LTAADIAQLEQCVDTLQKETPEPETFVLPGGCTAAAESHVCRTVARRAERSIVAMSHEYRVEPLILQFINRLSDYFFVLALNLNFITSIDEK.......... 173
338 3.000e-37UniRef50_A0A1Y3AU02 Uncharacterized protein (Fragment) n=1 Tax=Euroglyphus maynei TaxID=6958 RepID=A0A1Y3AU02_EURMA  ali  34  29.IYTRTGDSGTSGLFSGERRPKDDAIFEALGTTDELTSCIGFAREFIK--DSVILDELEQIQCILQDLQATVATPKSSSNEFQIRKTKWNVNHLEKWLEIHTAKLPPLRNFILPSGGKAASSLHLARAICRRAERRLIPLLDEGLELP-VVQYLNRLSSYLFIVARVCCQQEGHTEVVWERPK.... 211
339 3.000e-37UniRef50_A0A2H0RB40 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H0RB40_9BACT  ali  45  2KIYTKTGDKGTTSLLGGKRVKKSNIRVKAYGNIDELNSFVGLLDSRL-HTNDKIRIYLRDTQVNLLLVGSHLADEKGKIKLKDXXXXXXXXXXXXXXXXXXXXXLPKLKNFILPGGCEQASLAHICRTITRRCERL---LVSIEEINPHVLKYINRLSDYFFVLARWFNYKEGVTDKIWK....... 178
340 3.000e-37UniRef50_A0A2D7PKL7 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2D7PKL7_9DELT  ali  38  45KIYTRRGDGGDTDLAGGTRISKDALRVEAYGAVDELNAFIGVAIVDC---DPKWFSILEAVQRTLFEVGAGLATPPSATQAALSSETEADVQSIEAAIDQADQDLPALRAFVLPGGCRAAAAFHAARTVCRRAERRVVALDRVEHLSDATLHYLNRLSDFLFVLARSENVRVGQGDVEWTRR..... 225
341 3.000e-37UniRef50_A0A2S6UCY5 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=63 Tax=cellular organisms TaxID=131567 RepID=A0A2S6UCY5_9PROT  ali  42  6KIYTRGGDKGQTSLGGGQRVGKNDVRVQAYGTADEANAIIGLARLNA---DDKVDAMLSRIQNDLFDLGADLCRPQDEGNDTSXXXXXXXXXXXXXXXXXXXXXLEPLTSFILPGGNEIAAWLHMARTVVRRGERLICALAETEAVNPMAIQYANRLSDHLFVLARHVN-DGGQNDVLWVPG..... 184
342 3.000e-37UniRef50_A0A1Y1W8U1 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial-like protein n=2 Tax=Kickxellaceae TaxID=4862 RepID=A0A1Y1W8U1_9  ali  36  54KVYTRTGDKGTSSLFTGERRGKNDAVFEALGTTDELSSMLGLAIAHLEGSSAQSVPRLETIQCLLQDVGSNVATPVNSKKRTRFDPDGFHCTNLEAWIDEMSVGLPVHRSFILPSGGLAASTLHVARTICRRAERTLVPLK--NDIDKESMMFVNRLSDFLFVAARWTAMQQNITEKIYVHQK.... 240
343 3.000e-37UniRef50_B5YN54 Predicted protein (Fragment) n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B5YN54_THAPS  ali  37  1..YTRKGDAGTSQLFTGERRDKHDDVFEAMGTVDELCSVVGVVYSQLMTSNEALPEQLLDVMSRLFDVGSHIARPAPKQAQQKRPFHPHNTDLLEEWIDTMTDQLPELTSFVLPTGSPASAQLHVARTVCRRAERRMVPLVQRDECDPAALSYVNRLSDYLFTAARYVNYCDGRDEMQYRR...... 188
344 3.000e-37UniRef50_B0ABV5 Cob(I)alamin adenosyltransferase n=6 Tax=root TaxID=1 RepID=B0ABV5_9FIRM  ali  41  2KVYTKNGDKGMTSLIGGKKIEKDDIRVEAYGTVDELNSYIGLCYHYLKEDSDK--EALRKIQVKLFDIGAELSSPNYKRIKNITK--EDDVEELERLVDYYTDKIEKINEFIVPGTSIASANLHIARTICRRCERRILSLSKQDEINLVILKYINRLSDFLYILARYSEDE................ 168
345 3.000e-37UniRef50_UPI000D6C2655 cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Gammaproteobacteria bacterium ESL0073 TaxID=2070539 RepID=UPI000D6C2  ali  31  7KIITKTGDQGSTRLGDGSRVSKSSPRIMAIGGIDELNTSIGLLRAYVDNR--EIIDQLIIIQHQLLVTGSQLA------NSNRCALQARHVEFLENWATTLMQQLDPVQDFVLPGGSKASAHCHMARVTCRRTERYLIAADLKEDYIPTIMQYLNRLSDVLFVLARVLNKEQGVSEIV......... 176
346 3.000e-37UniRef50_A0A2D9VE11 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A2D9VE11_9BACT  ali  34  13KVYTKSGDKGLTHLIGGEKVFKNDIRVIAYGDVDELNVSIGVCSNYLKNSPNSKISRLTSIQNELFNLGTVLAATGSXIEXDLPRVTAXDVENLENDIDNMNEKLEPLSSFTLPGGDSIILSFHQARVICRRSERNVVEVNKFKDLDELVIIYLNRLSDYLFVLGRLVAQILNIDEELWSP...... 199
347 3.000e-37UniRef50_C4FNS2 ATP:cob(I)alamin adenosyltransferase n=20 Tax=root TaxID=1 RepID=C4FNS2_9FIRM  ali  38  3.IYTKTGDTGTTALFDGTRVPKNSLRVDTYGTFDELNAQVSVCEKLVVSPDNKH--VLHTLQHQLFRLCAEVATPHVENSESSNLISQQDISELEHMIDDYTKRLPQQHSFILSGNYLSAAELHVARTICRRGERLLISLGSVEPIRDEVRKFINRLSDALYIMARMEDYVQFVETIVERVSERV.. 185
348 3.000e-37UniRef50_A0A0S1B2L9 Cobalamin adenosyltransferase n=4 Tax=Stenotrophomonas TaxID=40323 RepID=A0A0S1B2L9_9GAMM  ali  35  205RIYTRTGDDGSTGLGDGSRTGKDSLRVNAYGTVDEANSAIGVLLAVA--LPDDVRALLTTIQHQLFDLGGELCIPGHAAIQAADIDA------LERHLDRYNDDLPPLKDFILPAGGEAAARCHLARTIVRRAEREAVALSRVEAVRGEAVRYLNRLSDLLFVLARVLARADGHGEVLWNHERR... 380
349 3.000e-37UniRef50_A0A0G3S871 ATP:cob(I)alamin adenosyltransferase n=320 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0G3S871_KLEOX  ali  35  3.IYTRTGDAGTTSLFTGQRVSKTHPRVEAYGTLDELNAALS--LCACSAADEHHRALLEAIQQQIFWFSAELASDSERPSPKQRYISSEEISALEAAIDRAMARVEPLHSFILPGRCEAASRLHFARTLARRAERRLVELAAEVTVRQVLMRYINRLSDCLYALARAEDSDAHQNNIIREVSRR... 183
350 4.000e-37UniRef50_B4WXB7 ATP:cob(I)alamin adenosyltransferase n=27 Tax=Gammaproteobacteria TaxID=1236 RepID=B4WXB7_9GAMM  ali  33  17RVITRTGDAGETGLADGSRVSKCHPRIVVLGELDELNSALGVLRA--RPLDSDLDAVLGLVQQMLFDIGGELAIP------GHRVIDDHDLVEVESQADTINAELPPLKEFVLPGGHPDAAWCHHCRTVARRLERHVIALHETDEVNPVSQALINRLSDLLFVMARLINLRHEAPETLWMPKAD... 194
351 4.000e-37UniRef50_S7MPJ2 Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=1 Tax=Myotis brandtii TaxID=109478 RepID=S7MPJ2_MYOBR  ali  39  51KIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELIAEKGHPFAEELEKIQCSLQDVGSALATPRSSAREAHLRRTTFESGRLEQWIDKYSGQLPPLTAFILPSGGKSSAALHFCRAVCRRAERRVAPLVQMGETDADVAKFLNRLSDYLFTLAR..................... 219
352 4.000e-37UniRef50_Q18HW0 ATP:cob(I)alamin adenosyltransferase n=8 Tax=Archaea TaxID=2157 RepID=Q18HW0_HALWD  ali  35  2KIYTKRGDSGQTDLRDMSRISKQHPRIEAYGNADELNSLLGTVR---PTGYDDIDTILHSIQNHLHIVQADFANP--DPDEDDPTVDMSHVEELEEWIDTIDEELEPLEDFILPGGAEAGAKLHHARAVCRRAERRAVSFSEVEDMNNVAVTYLNRLSDLLFTLARVTNQRDDVAEE.......... 174
353 4.000e-37UniRef50_A0A257TIY3 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A257TIY3_9BACT  ali  40  460.......DTGETGLFGGPRVRKDHPRVETYGDVDELNAVIGLAR--CEPLDAGIDSLLATIQNDLFDLGAQLASPQPD-RVGTQRITADHVAALESAIDRHESGLPPLTAFILPGGTRGAALLHLARTVCRRAERRLVALMESEPIASECLIYLNRLSDLLFVLARAANHAGGCEDVLWQSK..... 631
354 4.000e-37UniRef50_A0A1Y1XRV9 Cob(I)alamin adenosyltransferase (Fragment) n=1 Tax=Basidiobolus meristosporus CBS 931.73 TaxID=1314790 RepID=A0A1Y1XRV9_9FUNG :_  ali  32  7RVYTRTGDNGTSSLYNGDRAPKTSEYFHALGTVDELCCFIGVAYFYANKSGNTVTEQLTEIQCRLFEIGSNIATPRNSSSQTQIERTNFYVDDLELWIDSLDELLPPLRQFILPSGSETAVHLHQCRAVARRAERTVIPLVESGSADPVVSKYLNRLSDYFYVAARFATKIDQGTEVLYNFRK.... 193
355 4.000e-37UniRef50_A0A1F9GPZ0 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_01_FULL_45_74 TaxID=1797872 RepID=A0A1F9GP  ali  34  3.VVTKTGDKGETGLLSGERVSKTHPRVETYGTLDELVSHIGWVRSLNPH--DDLVHPLKLIQVSLFRLGAELASSRLDPKWHLTPMSQKDVDQLESWVKHFEPKLNLPRSFVLPGGTPVSASLDMARTVARRLERLIMALKEKIYENPEALKYINRLSDLLFVFARYEQKMAGKD............ 175
356 4.000e-37UniRef50_O30452 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=4 Tax=Clostridium TaxID=1485 RepID=O30452_CLOPA  ali  37  3.IYTRSGDKGETGLFGGSRINKDDLRVECYGCLDEANSFIGLAYSLIKSKDIKI--ILRNIQNKIFIAGAELASDEKGKAYLKDTISQGDIEELEKIIDRYTEIVGPQKSFVIPGDTISSASLHVSRTVVRRSERLMVALKSKLKVRKELYKYINRLSDVLFILARVEA.................. 168
357 5.000e-37UniRef50_A0A1F3K5F2 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bacteroidetes bacterium GWF2_33_38 TaxID=1797342 RepID=A0A1F3K5F2_9BACT  ali  30  2KVYTKTGDDGTTSLIGGKRVKKNNPRLETYGTIDELNSYLGLIASY--HISTAIDEFILDIQKKLMLVSSHIA--NEDKKIVLPDIEINDITIIENKIDELSESLPTLNSFVIPGGSQTAAFCNITRTVCRRAERNLISLNEIANVSALHIQYFNRLSDFLFVLGRYSFVSSNLKEIYWNGK..... 179
358 5.000e-37UniRef50_B0R5U9 ATP:cob(I)alamin adenosyltransferase n=26 Tax=cellular organisms TaxID=131567 RepID=B0R5U9_HALS3  ali  36  2KIYTKRGDDGDTDLRTMDRVSKASPRIEAYGTVDELNAAVGAIR---PTDIADLDAWLREAQNHLHVVQADFANP--EPEPDDPQITAEHVTHVEKWIDHCEARLDPLESFILPGGSEAGAALHQARAVCRRAERRAVALQDHEPVNDTAVAYLNRLSDALFVFARLANDVAGVHEE.......... 176
359 5.000e-37UniRef50_A0A1I2XHL8 ATP:cob(I)alamin adenosyltransferase n=36 Tax=Proteobacteria TaxID=1224 RepID=A0A1I2XHL8_9PROT  ali  40  7RIYTRTGDDGTTGLGNGLRSGKESLRIEAIGAVDELNSHIGVLLSQVLQEG--MRNRLENIQHDLFDLGGDLSIPGRXXXXXXXXXXXXXXXX------XXXXXLPPLKEFILPGGTPIAAICHVARAVCRRAERCVVRLYRTDAVIPCHIHYLNRLSDLLFVLCRDLNREHGVADIMWQPGKN... 182
360 5.000e-37UniRef50_A0A2H5XDZ3 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=43 Tax=cellular organisms TaxID=131567 RepID=A0A2H5XDZ3_9BACT  ali  35  4RLYTRRGDTGMTDLIGG-RVPKSHQRVDAYGTLDELNATLGLLRAHL--TDAQLARLVAQIQRDVFTLGAELATAPSHRPS--VRLSATRLRALERQIDQFQQEAPIPPQFVLPGGTVAAALAQVARAVCRRAERRVVALAAEEPVRPTVLGYLNRLSDWLFALALVINHRNGVRETTWRGRRR... 182
361 5.000e-37UniRef50_A0A0G1BMW5 ATP-cobalamin adenosyltransferase n=1 Tax=Parcubacteria group bacterium GW2011_GWA2_42_80 TaxID=1618824 RepID=A0A0G1BMW5_9BACT :_  ali  40  41KIYTKTGDGGESSLYGGTRLPKSDLRFEAYGTID---------------------------------VGAELALAPGQESKAALVGIQE-TAKLEQRLDEMQAELPELKNFILPGGSALGASLHHARTVARRAERAVVRLSGSLAVRPELLAYLNRLSDYLFVLARYVNFKAGVEEKIWRS...... 187
362 5.000e-37UniRef50_A0A0C7K7Q6 ATP:cob(I)alamin adenosyltransferase n=662 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0C7K7Q6_KLEPN  ali  37  3.IYTRTGDAGSTSLFTGQRVSKTHPRVEAYGTLDELNAMLS--LCVCAVAEEEQRTLLEALQQHIFWFSAELASDSEQPSPGKRYISSEEIALLEQTIDREMARVPALHQFVLPGRCEAASRLHLARTVARRAERRLVELAAEVTIRQILLRYLNRLSDCLYALARSEDHAA............... 171
363 5.000e-37UniRef50_A0A0C7QVA1 ATP:cob(I)alamin adenosyltransferase n=13 Tax=Bacteria TaxID=2 RepID=A0A0C7QVA1_PAESO  ali  41  2KIYTKTGDAGKTSLYDGSRVNKDDIRVEAYGTIDELNSFIGDACNYINENDKK---ILRGIQRKLFDVGGELAT--MDIKKFKNNINEEDVKNLENIIDEYMNKTGEMEMFILPGTTKASSKLHIARTVCRRAERRIISLNKIETLNPMTIKYINRLSDVLYSISRAYEKQ................ 167
364 6.000e-37UniRef50_A0A1Z8WX03 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Methylococcaceae bacterium TMED69 TaxID=1986766 RepID=A0A1Z8WX03_9GAMM  ali  33  7KIYTKTGDDGTTGLGDGSRVKKDSIRVETMGDIDELNCDIGLLRA--EELPEAIDVVLKQIQNALFDIGGELSIPESNIFTPVIIEEIE------IEIDRYNEILPPLKEFLIPAGSRGVALSHLCRSVCRRAERKLVRLSESEHVRAESQMFINRLSDYFFVLARIIGSHDKVIESLWER...... 179
365 7.000e-37UniRef50_A0A0G1TIU3 ATP-cobalamin adenosyltransferase n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G1TIU3_9BACT  ali  36  5.IYTRKGDQGTTALFGGQRTDKNDARVEALGAVDELNASIGIVVSMSTQQ--ATNELLQTIQHQLFTFQAMLANPPKNPTKPPHVIKQSHIDFLEKQCDAFDTCNKKLSSFILPGGHPIAAHLQYCRVLTRKAERRIISLHRQSPLVPESIAYINRLSDLFFVLARYMNRLHGVSE........... 179
366 7.000e-37UniRef50_UPI0009FF8C5A cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Candidatus Azobacteroides pseudotrichonymphae TaxID=511435 RepID=UPI  ali  37  6.IYAYTGDNGYTSLIGGKRVIKTHPRIEAYGVIDELNSFIGYLLNEIDEKND--RSFLLQIQHILFALGSYLATENTKKEY---LFLSENLINLEKEIFKINELLPPLKCFILPGNCSSNALAHICRTICRRAERCIVCIGEQESIHPLFLKYTNRLSDYFFSLARKQSFINSTSEIIWNK...... 180
367 7.000e-37UniRef50_P53523 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=958 Tax=root TaxID=1 RepID=PDUO_MYCLE  ali  35  7RIYTRTGDNGTTGLSDFSRVAKTDLRLVAYADCDETNSAIGVALA-LGNPDQKITDVLQQIQNDLFDAGADLSTPMQDSEYPQLRITQTHIDRLEEWCDTYNTPLPTLNSFVLPGGSPLSALLHVARTVARRAERSAWAAVEAHPVSMLPAKYLNRLSDLLFILSRVANTGN---DVLWRPG..... 190
368 8.000e-37UniRef50_A0A2E8XXJ3 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E8XXJ3_9BACT  ali  34  15KVYTRTGDKGTTSLIGGKRVPKSHNKVSAFGQVDELNSSLVFLNNLNNKDFSILSKILVKIQNELFNLGNMLAVDKNVSLENMPQITNESINQLEDNINYFNDSLEELNSFILPGGNELSIRLHKVRVKCRKVERYIVSIMDKEKFDDVIVKYLNRMSDLFFVLARYAIFKLKDDELKWNP...... 199
369 8.000e-37UniRef50_A0A2M6W2L2 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Magasanikbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_40_10 TaxID=197  ali  32  36.IYTKTGDKGATSLLTGERVSKDCINLQVVGALDELNAVLGMIVCELAVKADDFGRLLARIQKDLFKAGSEIASSQLASELTDLKLIDKNIESLEKEIDDMWADLPALKNFILPGGSAVSARLQLARAVCRRAERDLVGLSKQTKVREELFMYLNRLSDYLFTAGRWVNYKSGREEII......... 216
370 9.000e-37UniRef50_A0A132HVG8 ATP/cobalamin adenosyltransferase n=1 Tax=bacterium F083 TaxID=1768114 RepID=A0A132HVG8_9BACT  ali  34  2.IYTKTGDNGTTSLVGGARVDKDDARVEAYGTVDELNAQMA-LMAELMGHDADDYAIVKTVQRHLFIIQTLLATEDRELAQKLPQLEEEQVQWMERQIDRIDGGLPRLRSFVLPGGTTAGAQCHVARCVCRRAERRVVTMQHEAPSAATILAYLNRLSDWLFVLGRKWTLKGGGED........... 177
371 9.000e-37UniRef50_A0A2S6TT28 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6TT28_9PROT  ali  42  6KIYTRSGDEGITSLANGERVTKHSLRVECYGSVDESNSYIGLARVNIKKGH--IFQDLGIVQNDLFDLGADLASPFRKDKKKSXXXXXXXXXXXXXXXXXXXXXLRPLTSFVLPGGRISAANLHVARTIVRRAERSTVLLSKEEKINPLVIKYLNRLSDLLFVCARYQNDK-GKLDLLWDPG..... 184
372 1.000e-36UniRef50_D9UUY4 ATP:cob(I)alamin adenosyltransferase n=15 Tax=Actinobacteria TaxID=201174 RepID=D9UUY4_STRS3  ali  35  6RIYTRTGDKGTTALGDMSRTAKTDPRIAAYADANEANAALGTALA-LGRLDADVAAVLTRVQNDLFDVGADLCTPVVENPAHPPLRVEQYVDRLEADCDRFLAPLPKLDSFILPGGTPGAALLHQACTVVRRAERSTWAAAYGETMNPLTATYLNRLSDLLFILARAANTEHG--DVLWVPGGE... 189
373 1.000e-36UniRef50_A0A2D6R668 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Archaea TaxID=2157 RepID=A0A2D6R668_9ARCH  ali  37  12KIYTKIGDRGKTTFFGCGLVSKDDPRIETFGALDELQSVLGVTISFLE--DEKLKEILTRIQNDLFQVGADIVGSKLAEKSM-PRIQTSHIDELEKDIDILQDKLGMPTAFILPGGTKASAFLHLCRAITRRAERSLVKTQSVIDLNPELLRYVNRLSDFMYVLARDANKEVKEQQPIYK....... 188
374 1.000e-36UniRef50_A0A2R6AG28 ATP:cob(I)alamin adenosyltransferase n=12 Tax=Candidatus Marsarchaeota TaxID=1978152 RepID=A0A2R6AG28_9ARCH  ali  36  4KMYTRSGDKGETSLFGGIRVKKTDQRVIAYGCVDELNSLLGVVRSVV--TEERIKQLIFKEQRRLFKVGADLATPLSAKPKPIERISDEDIRELEEEIDALN--VKPINAFVVPGSSQPSAYLHYARAVTRRAEREVWKLLESADANPKVAVYLNRLSSLLFVAALYVNESAGVSEDKW........ 180
375 1.000e-36UniRef50_A0A2E4AHZ3 ATP:cob(I)alamin adenosyltransferase n=7 Tax=Bacteria TaxID=2 RepID=A0A2E4AHZ3_9BACT  ali  36  5KVTTKSGDKGKTSLGNGDRVSKSNAFINLLGDIDELNSHIGSAVSACKST--QVSDDLQLIQQDLFNLGGEVSMPNSGT----ILINESRIAFLEEKIDELNQSLKPLKEFILPGGDEFCSRIHISRSVCRRAERSCVKIIDKIKEKNIWLPYLNRLSDYLFVLARYISSERGSEEILWDR...... 179
376 1.000e-36UniRef50_J1K0Q2 ATP:cob(I)alamin adenosyltransferase n=64 Tax=Alphaproteobacteria TaxID=28211 RepID=J1K0Q2_9RHIZ  ali  39  6KIYTKTGDDGTTGLVNGPRRSKADLRIDAFGHVDETNAAIGLARLETNYINTNKYQMLFRIQNDLFDLGADLATPLXXXXXXXXXXXXXXXXXXXXXIDYLNKTLSPLTSFVLPGGTKLAAHLHLARTIARRSERAMVALHLKETLQEDTLHYINRLSDFLFVAARHANNK-GHDDVLWVPGKN... 211
377 1.000e-36UniRef50_A0A2J8GML6 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Vibrio diazotrophicus TaxID=685 RepID=A0A2J8GML6_VIBDI  ali  32  3.IYTKTGDKGTTSLVGGVRIAKTDIQVEAYGTVDELNANISVAQKMATV--ESTKQLLDSIQYQLFYIGAELASPDLNVKSDNQQQVEEEIKALEDAIDAAMAQVPALHSFVLPGSSVSGSQMHLARAVSRRAERRVLAVNEIKPVRPELMKYLNRLSDALYALARLEDHENQIKCVISKVAQR... 184
378 1.000e-36UniRef50_A0A2D7T7U5 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Euryarchaeota TaxID=28890 RepID=A0A2D7T7U5_9EURY  ali  32  6RVHTGTGDEGNTSLVDGSRVPKFHPRLEVVGTLDELNSILGSVLMESNRIPERHSDGIKRIQQELFDLGAELACPADNIPEGIVLLEQEVSDLLLSEMDSMQKELKPLESFILPGGVAPIANLHIARTVVRRTERQLIKLIHEEGEDSVVKEYINRLSDWLFVLIRWVSNRLGEEEFLWVPKEK... 208
379 1.000e-36UniRef50_A0A0R0LHX0 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=278 Tax=Proteobacteria TaxID=1224 RepID=A0A0R0LHX0_9PROT  ali  45  7RLYTKTGDAGTTGLGDGSRVDKDHFRVEVMGDIDELNSILGILLSY--PIDQNIQNELTQIQHDLFDLGAEMCIPGHXXXXXXXXXXXXXXXXXXXXXXXXXX------XXILPGGNQAAAICHHARTVCRRAERRIVSLSHHEMISAYAMQYINRLSDYLFVIAREINRLSNTPDVLWRSLK.... 181
380 1.000e-36UniRef50_A0A1P8UV62 Cob(I)alamin adenosyltransferase n=22 Tax=cellular organisms TaxID=131567 RepID=A0A1P8UV62_9RHOB  ali  40  6KIYTRTGDKGETALVNGTRVPKFAPRVEAYGTVDELNSVLGVTRLHAEG---DLDAALARIQNDLFDLGADLGRPEMEKDYPVXXXXXXXXXXXXXXXXXXXXXLEPLRSFVLPGGSAAAAHLHQCRTVARRAERRAVELASVEETNEHAVKYLNRLSDWFFVASRICN-DDGKADVLWVPGAN... 189
381 1.000e-36UniRef50_A0A2E1DI78 ATP:cob(I)alamin adenosyltransferase n=3 Tax=unclassified Flavobacteriaceae TaxID=61432 RepID=A0A2E1DI78_9FLAO  ali  33  2KIYTRKGDSGHTSLIDGDIVNKHNLSVDAYGTIDELXSFLGLL--KDYXKDDKIKDILNXIQIKLFSIGSILASGENQNISEKVKIEKNDVEYIELEIDRLNKDLPELKNFIIPGGHKSSSYSHVCRSICRRAERKISELNNKNSVDSNILAYVNRLSDFFFVLSRFLKHSDNVSESHW........ 178
382 2.000e-36UniRef50_P45515 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=100 Tax=Bacteria TaxID=2 RepID=PDUO_CITFR  ali  34  3RIYTRTGDNGTTALFGGSRIDKDDIRVEAYGTVDELISQLGVCYASTRQ--AELRQELHAMQKMLFVLGAELASDQKGLTRLKQRIGEEDIQALEQLIDRNMAQSGPLKEFVIPGKNLASAQLHVARTLTRRLERILIAMGRTLTLRDEARRYINRLSDALFSMARIEETTPDV............. 174
383 2.000e-36UniRef50_A0A1A7T0G6 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=80 Tax=Bacilli TaxID=91061 RepID=A0A1A7T0G6_ENTFC  ali  35  3.IYTKTGDKGTTSLFDGTRVKKSDLRVDTYGTFDECCAQVSVAQKLAR--DSETIQHLEWVQQKLFQLNAEIATDFTKLEEKSTLIGSKDIHQMEEWIDQYTKRLPELHQFILPGQTHSGAQLHVARAVCRRGERLLTDLSEATDIREDLRKFVNRLSDCLYIFARMEDQKE............... 173
384 2.000e-36UniRef50_A0A2G9M3N3 ATP:cob(I)alamin adenosyltransferase n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2G9M3N3_9ARCH  ali  39  2KIYTKIGDAGKTTFFGCGLVSKDDPRIEAFGALDELNSVLGLTISFTD--DKVLISILTKIQNDLFQLGADLVGSKLSAHSM-PRITKEHVEELERKIDELEEKLGMPDSFILPGGTKESAFLHLSRVITRRAERTLVKVQNILELNPEMLKYINRLSDFMYVLARQSNKELDVKE........... 174
385 2.000e-36UniRef50_I2WI94 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Escherichia TaxID=561 RepID=I2WI94_ECOLX  ali  36  3.IYTRTGDSGSTSLFTGQRVSKTHLRVETYGTLDELNATLSLCYCATAIESHRI--LLEAIQQQIFWFSAELASESEQPSAQQRYIGTEEIAALENAIDSAMNAVPPVHSFILPGRCEAASRMHFARTVARRAERRLVELTTETTVRNVLLHYINRLSDCLYALARVED.................. 168
386 2.000e-36UniRef50_A0A2E2BSF6 ATP:cob(I)alamin adenosyltransferase n=63 Tax=root TaxID=1 RepID=A0A2E2BSF6_9EURY  ali  31  21KVHTGGGDRGETSLASGERVSKANLRVAFYGTIDELNSVIGMVLAEFNRLEDHHKDKLGLIQQELFDIGGECSFMPGQVPEMMTVISQEQADRLCDEMXVWTEQLEPLXSFIXPAGSPLVSTIHLARTIARRAERNAVQIRDQDAIRDVVIAYLXRLSDWFFVLARWVGMILGESETLWVPLGKRMQ 226
387 2.000e-36UniRef50_A0A1I0MDF9 Cob(I)alamin adenosyltransferase n=4 Tax=Natrialbaceae TaxID=1644061 RepID=A0A1I0MDF9_9EURY  ali  36  3.IYTGRGDEGQTDLRDMTRVSKASARIEAYGTVDELNALIGTIR---PTDHDDINERLAAIQNHLHVVQADFANP--DPDEDDPAIRADHVETVEDWIDEYDEELEPLTSFILPTGGDDGAALHHARTVCRRAERRAVALAESEAINEDAVQYLNRLSDGLFTFARVVNARDGERE........... 172
388 2.000e-36UniRef50_A0A2N1PID8 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1PID8_  ali  40  2KIYTGTGDRGMTSLVGGDRISKNDVKVRAYGELDELNSTLGYLVSLINNAPWSQRKILMTAQGLLMDASAWVASPCLEEHSSLPVFQPESVKWMEKCIDEICSNLAPLHSFVIPGGTPEASWAQVARTVCRRTERTIVELVHYADNIMCILTFLNRLSDYLFALGRWLNLAAGKPESLWIREKELE. 219
389 2.000e-36UniRef50_A0A2A4REW4 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A4REW4_9GAMM  ali  34  7KIYTRTGDDGSTGMADGSRVAKDALSLQALGDIDELNCQLAVLASHAP---ESFIVSIRAIQDELFNVGAQLSLGQVMIKH-------SSVTALEKSLDALNQSLTPLKEFILPGGGLAASHCHVARAVCRRAERSLVSLNREQVMGKGLMAYINRLSDYLFVLARAISQHEGEDEIYWQSKR.... 179
390 2.000e-36UniRef50_A0A160VIH6 ATP:Cob(I)alamin adenosyltransferase n=7 Tax=root TaxID=1 RepID=A0A160VIH6_9ZZZZ  ali  33  5KVTTKTGDQGNTTLGDGSHVSKDNVRVHCLGSIDELNASIGFARVTL---SENHATDLESIQNDLFNIGGEISIPALEKP----LLHKDRVDFLEKRIKSINKQLLPLEEFIIPGGSETGARLHVARSICRRAELDLVSLNNTEKLSTDILKYVNRLSDYLFVLARLVIDKSGGKETQWDRS..... 179
391 2.000e-36UniRef50_R2RK29 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Enterococcus TaxID=1350 RepID=R2RK29_9ENTE  ali  36  3.IYTKTGDKGTTSLFDGTRVKKSDPRVETYGTFDECCAQVSVAQKLAK--DSETIQHLEWVQQKLFLLNAEIATEKDFSKAKSTLIAASDIQQMEDWIDQYTKRLPEVHSFILPGQTLSAAQLHVARAVCRHGERLLTELSESAEVREDVRKFVNRLSDCLYIFARMEDHSE............... 173
392 2.000e-36UniRef50_A0A0B5HGE1 ATP/cobalamin adenosyltransferase n=1 Tax=Archaeon GW2011_AR15 TaxID=1579373 RepID=A0A0B5HGE1_ARCG3  ali  39  7KIYTKRGDTGETSLCDGSRTLKDTTRVEAYGVLDETNAFLG--LAIVKLEEEDLKSHLMDIQKDLHAISSNLAYPSNPMANKIPRVTEDMVKKLERLIDMYEEELPVLKNFILAGGTEESALLHMARVVCRRAERQIIRLMREEEIEKNILKYMNRLSDYLFTAARLASHRQGKEDTKWMP...... 194
393 2.000e-36UniRef50_A0A2N3F5F8 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-7 TaxID=2013652 RepID=A0A2N3F5F8_9ACTN :  ali  39  3.IYTRRGDHGQTSLADGTRVSKTAARVEAYGAVDEANSAIGFARAALD--DPYLDEILHFVQQRLFNCSSSLAFP--GASEPAPTIDPEDVAFLERAIDACQARTGELTQFLLEAGAESACRLHVARAIMRRAERRIYSLDAEEPVAKQVLAFINRSSDLLFAAARYCNATEDVPEETWDR...... 178
394 3.000e-36UniRef50_A0A2E3TKL5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Kiritimatiellaceae bacterium TaxID=2026752 RepID=A0A2E3TKL5_9BACT  ali  34  3KIYTKTGDNGETSRFDGQRVRKDDSIIQLNGIVDECNCIIGLAISTSS--DSKINNILTDIQNKLFIAGTEISSC---GKKIDLKIKSSDTKKIEEIIDIYEKELPPLTNFILPGGSITSSYLHLSRAKSREVERCLASISEEWIKDSNLNAFMNRLSDLFFVLARXVNKRXXIXDVPWN....... 177
395 3.000e-36UniRef50_UPI000316A31F cob(I)yrinic acid a,c-diamide adenosyltransferase n=2 Tax=Bacillus TaxID=55087 RepID=UPI000316A31F  ali  34  3.IYTKKGDKGETGLLGGSRISKDSLKVSCYGTLDEANAALGVAVSQIDHI--EIKSILKDIQKQLFVVGAELASDEKGKDLLKNKVSEQEIARFEEIIDKFEQIMGPIHEFIIPGETSASANLHLSRAIIRRAERQIVELTKTAPIRSELIQYVNRLSDVLFMLARAEVHYHQLEEIKSKVIGKLE. 185
396 3.000e-36UniRef50_A0A2X1UZY2 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=10 Tax=Alcaligenaceae TaxID=506 RepID=A0A2X1UZY2_9BURK  ali  38  8.IVTKSGDQGSTSLADGQRLCKSHPRIGAIGDIDELNSHIGLLITALQGMNQRHLRLLSSIQHALFDLGSELAVPGFNA------LSPTIVTTLESSIDTMLQQLPPLREFILPGGCHQAAQAHICRSVSRRAERSLVLLNREEPVSDLSLQLLNRLSDYFFVLARELNRLNEYQDIFWQKNER... 188
397 3.000e-36UniRef50_S8FBC5 ATP:cob(I)alamin adenosyltransferase n=224 Tax=Bacteria TaxID=2 RepID=S8FBC5_9BACT  ali  36  3KIYTKTGDAGMTSLRNGVRVPKDDIRIETNGMLDELNALLGVCRSSLPVEDERWR-MLYAIQTELMSVMSHVATSS-GKVNPKELHVAELTRRMEEAMDRMHEEVGDAGHFILPGGTLLSARLHFARAVARTAERRLWTLNRQDDVNDEILCFMNRLSDYLFLSA...................... 165
398 3.000e-36UniRef50_A0A1V6JB41 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A1V6JB41_9BACT  ali  38  6KIYTHTGDQGETSLIGGQRVPKSHEKIEAYGTLDELNAFTGLVIDLCN--DMPTKEFLMLIQQKLFAVESLFAAASSEFQKDLXXXXXXXXXXXXXXXXXXXXXLPQLNSFILPAGHPSISSAHVARTVCRRAERCMVRAFSGSEQELAALKFINRLSDFFFVLARKFAFDLNIPEIPW........ 182
399 3.000e-36UniRef50_A0A1F8C062 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Candidatus Woesebacteria TaxID=1752722 RepID=A0A1F8C062_9BACT  ali  36  3.VYTKKGDKGTTGLFASTKIPKNSPRIRAIGGIDEINSFLGLCAAFIE--NQSVLEIVFEIQRDLFTIGSILAGAP-------LTFSASKVKKLEGKIDSMESVLPKLSNFILPGGSRAGALLHTARVVTRRAERELSHLAGREKVNAQIVKYVNRLSDFLFTLARKVNFDLGTPEKIWKSR..... 178
400 3.000e-36UniRef50_A0A1W0X4B7 Putative Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0X4  ali  34  55RIYTRTGDKGKTSTYTGERRRKDDELFEALGTTDELSSILGIVREFAADYGHNFDAQLESIQCILQDVGSALATPLSSARP---------------------AHLQKTAFSSNYSGGKTSAFLHHARGVCRRAERAVIPLVLSGQVDGEPLKYLNRLSDYLFVLARYACHKEGKVEKIYVRPK.... 216
401 3.000e-36UniRef50_A0A062UV11 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Methanoperedens nitroreducens TaxID=1392998 RepID=A0A062UV11_9EURY  ali  32  2KLYTGRGDKGETDLLEGGRIKKSALRVEAYGTVDELNSLVGLSRLYVE--DKEINNLLFQIQEKLFILGSDLA---VAKGENTPRLTEKDKKWIERIIDEISHELKPIDRLVFPGASLASAYLQLCRAVSRRMERRIQALSMSEPINEYAYVFTNRLSSLLYGLALMVNQRLGVEEVEWV....... 176
402 4.000e-36UniRef50_A0A2D6WSX5 ATP:cob(I)alamin adenosyltransferase n=44 Tax=cellular organisms TaxID=131567 RepID=A0A2D6WSX5_9BACT  ali  30  6RVYTGGGDKGESSLVDGSRRKKSDPRFSVVGTCDEANSWLGMVLAEINRLPRHENEAIVRVQNELFDLGAELACPPETLPEYMVLLSQGQTDVLMAEMDAWLEALPELTSFILPAGSPPVACMQVARTVVRRLERDIVQLQDHDSVRPLVKVYVNRLSDWLFVMGRWVSTMLNEEEALWVPLGK... 207
403 4.000e-36UniRef50_UPI000995DB20 cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Bacillus patagoniensis TaxID=228576 RepID=UPI000995DB20  ali  42  2KIYTKGGDKGRTSLI-GTRVDKTDARIEAIGAIDELNSSVGMAIAYVKKEGIDLQKELLIISNQLFDVGADLANTTVEMK---AKINVEHTKMLEKRIDHYTETIDPLRQFILPGGSESACALHRCRTDARRAERKMSMLDVF---SSPLGPYINRLSDYFFTVARLANAQLGVKDVLYEGSLKII. 181
404 5.000e-36UniRef50_W4L6E5 Uncharacterized protein n=2 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4L6E5_9BACT  ali  38  7KIYTRSGDKGMTRLVGGDQQRKDSLLVESYGEVDELNSHVGLLRALARQHSEASEPIFQTIQNDLFDIGALLATMPDNKKKPLEDGSDQRINTLEQQIDAWNEHLPELNSFVLPGGGVVNAQANVARTVCRRLERLLVQRQDTYPVAPVILAYINRLSDFFFVYGRWASAQLGEAELLW........ 197
405 5.000e-36UniRef50_A0A162SC74 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=16 Tax=Bacteria TaxID=2 RepID=A0A162SC74_9CLOT  ali  36  4.IYTRTGDKGTTALVGGSRAEKDSLKVEAYGTIDEVISNMGVAYSFME--NEELKAEIVDIQNKLFVLGAELASDENGLKYLKELVDQKDIDTLEKIIDKYMEKVGPFKGFVTPGKNRTSAMLHVARTVTRRAERVIITLSREDKVREEIRKYVNRLSDVLYAMARFEEEK................ 171
406 5.000e-36UniRef50_A0A2E1WHQ3 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E1WHQ3_9BACT  ali  32  5KVTTKTGDQGETGLGDGSRISKDHPXIVXXGXLDELNSHLGLAITAXK--SDGVRXQIQXIQQDLFNIGGEASMPGSD----IXLXNDDRVIDLEKIINKMNETLPPLEEFILPGGDEFCARIHVSRAVCRRAERSCISLVKAGDNKKNWLPYLNRLSDFLFVLVRYTNQIQGXNETLWVR...... 179
407 5.000e-36UniRef50_M9TVL5 Cob(I)alamin adenosyltransferase PduO n=375 Tax=Actinobacteria TaxID=201174 RepID=M9TVL5_9ACTN  ali  32  6RIYTRTGDKGTTALGDMSRTAKTDLRISAYADANEANAVIGTAVA-LGNLSEDVVKVLVRVQNDLFDVGADLCTPVVENPEYPPRVEQSYIDKLEADCDTFLEELEKLRSFILPGGTPGAALLHQACTVVRRAERSTWAALEVHGDVMNALTYLNRLSDLLFILARTANKEVG--DVLWVPGGE... 189
408 6.000e-36UniRef50_A0A1Y5GP45 ATP:cob(I)alamin adenosyltransferase n=1 Tax=`Osedax` symbiont bacterium Rs2_46_30_T18 TaxID=1856298 RepID=A0A1Y5GP45_9BACT  ali  37  12KIYTRGGDKGKTSLALGGRLSKADDHIKALGEIDELNCQLGVLIATLQ-AGHSLQQPLKQIQNRLFDIGAELAMN----SEDYPPLAQQFXXXXXXXXXXXXXXXXXXXXXILPGGSISAAHCHLARAVCRRAERQLIQLGTKQKQFPQACKYLNRLSDYLFVAARHLNLQDNGSEVFWQPSNK... 190
409 6.000e-36UniRef50_D8M4T4 Cobalamin adenosyltransferase n=2 Tax=Blastocystis TaxID=12967 RepID=D8M4T4_BLAHO  ali  32  27.IYTKTGDKGSSSLYNGERRKKYDDVFQALGNTDELNSFTGFARGYAEASNNGLAPKLIEIQSRLFDLGAAIATPPKSNKVEKTKFPEDNITTLEKWIDELDSQLPPLKTFTIPTSAPGGASLQMCRSICRRAERSVVPLVERDEVDSAVQRYLNRLSDFFYVASRWSVEFDKVEEIPWVPHK.... 222
410 7.000e-36UniRef50_A0A265EGX4 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Marinococcus halophilus TaxID=1371 RepID=A0A265EGX4_MARHA  ali  42  2KLYTRQGDRGDTSVVGGKR-NKGDARIEAFGSFEEVNALIGKALAAEEKSGRDLQTDLERIQHELFDCGSDVA---DIRAEAVRKVDNSTVVWLENRIDEYTEEAPPLQKFILPGGTSLSAELHLARTVCRRAERELVRAGENEDVPVPVLMYVNRLSDYLFSAARIANSRAGKTDVEYERSAKVF. 185
411 7.000e-36UniRef50_A0A0L0FM43 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Opisthokonta TaxID=33154 RepID=A0A0L0FM43_9EUKA  ali  39  68KIYTRTGDKGNSMLFSGERRPKDDIVFEALGANDELTSAIGVAREYVLDISEKHCAVLEDIQCALQEVSSCIATPRSDKRVEKTRFDGTKAALLEEWIDEMDQSLPPLTAFILPSGGKAASHLHVARTICRRAERRIVPLMRSEDVEMEAYVYINRLSDFLFAAARFVAVKEGKRTVAYKAGR.... 262
412 7.000e-36UniRef50_A0A1F3S9G4 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bdellovibrionales bacterium RBG_16_40_8 TaxID=1797388 RepID=A0A1F3S9G4_9PROT  ali  35  4KIYTKSGDFGETSLLGGPRVSKMNPQLEAYGNLDEVNALLELKRSSANASSKAIINTIEKVQHEIFTVCSHLACSDSKLLPKLPKLNDEIILLLEKNIDLMDNSIPQLKNFILPGGLIAAAQLHVTRTVVRRAERTVIGHFAINKILEKIIMFLNRLSDYLFVAARYINFSGKEPEKKWN....... 193
413 7.000e-36UniRef50_A0A1E7DFM9 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=15 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E7DFM9_ALTMA  ali  34  2KIYTRTGDKGSTQIYADKRVDKDDLVVQSYGDMDELNSHIGLLAAHVT---DKHKPMLQDIQRNLFQAGFAISAS--------STLTQTDIENLESLIDNITRQMPPNTSFVLPGGSKAAAQAHVCRAVCRRAERAVISLSKHYDVPEVVHAYLNRLSDFLFTFARFINIEAGVDEVP......... 170
414 7.000e-36UniRef50_A0A2A4P9M1 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Planctomycetes TaxID=203682 RepID=A0A2A4P9M1_9BACT  ali  39  2RIYTRGGDSGETGMFGGNRVDKDDLRVSAYGESDELNSALGWC---AVVAGDELSARLKREQQRLLDFGAWLATPDDAAEKIRGMLPTWDVTLLESEIDQAEAELEPLKNFILPGGSELSARLHLARTVCRRCERAVCGLNRKFGVADLQMAWLNRLSDWLFVQARFAD.................. 170
415 8.000e-36UniRef50_A0A2R5LGR2 Putative cobalamin adenosyltransferase (Fragment) n=4 Tax=Ixodoidea TaxID=297308 RepID=A0A2R5LGR2_9ACAR  ali  36  10KIYTRTGDKGTSATFTGERRRKDDAIFEALGATDELNSHVGYARSLLQXXXXXXXXXXXXXXXXXXXXXATPKSSASVGQLAKTSFPPEHVEELERWIDQHMQQLKPLRNFILPSGSPPSAALHVGRSVCRRAERRVTTLLHSSEVDEVVAKYINRLSDYLFVAARIAAQHDGAAE........... 186
416 8.000e-36UniRef50_F2UEK6 Uncharacterized protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UEK6_SALR5  ali  36  55KIYTRTGDKGTSSLFTGERRSKGDAVFEALGSIDEVSSFIGLAIAKIDSDNLE--DLRSQLYEMLEHTSPRLSTSATEARIERTSVPASYTEDLEGWIDAMTQTLPPLKNFILPGGTELGAALHCARTACRRAERRVVEANAHDEISETAMQLINRLSDYLFTAARHATATVGGEELVYLSATK... 236
417 8.000e-36UniRef50_A0A1G1W6U5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Woykebacteria bacterium RBG_13_40_15 TaxID=1802593 RepID=A0A1G1W6U5_9BACT  ali  32  5KIYTRVGDKGKTFLANGKKVSKDSLEIQTLGAIDELNASIGVAASFIK--EKHIVQLLQDIQNDLLNIGAEIGNDGQSIKNTSKLYPKDKIVKLEHYIDLYDKKLPNLQTFIIPSGKREFALLNLSRTVCRRAERDLVSLSKKRKVNQDILSYFNRSSDLLFVLARYLN---NGQEKLWERR..... 183
418 8.000e-36UniRef50_UPI0007E5E0B1 cob(I)yrinic acid a,c-diamide adenosyltransferase-like n=2 Tax=Drosophila TaxID=2081351 RepID=UPI0007E5E0B1  ali  34  112RVVTRGGDAGQTSLGDGSRVSKDSARIEAMGCLDELNAVVGLLRSQTAAES-AAAAQLEQLQNWLFDMGADLCQPEGPKARPASRMSGDFLACLENWVEQWRQAQAPLTSFVLPGGTPAAAWAHLARTHARTTERRVVALAQLEAVNPELLKLLNRLSDYFFVLARHFNQ-DGATDLVWTP...... 290
419 9.000e-36UniRef50_A0A0M9DWS5 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A0M9DWS5_9DELT  ali  44  3.IYTKQGDNGTTQLIGGQHVSKNHYRISAYGVVDELSAIIGGIGVYIPNDCSYISDELYMIQNDLFDVGTILAAPEQNTFLSAQKLLSEKQVLLEKAIDRMTANMPPLKAFILPAGHISAVFAHMARTVCRRAERKVVGLIEKEKLSSDVQIYLNRLSDYFFALARFFNYQYKFQEIL......... 186
420 9.000e-36UniRef50_A0A133Y3Q3 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Aerococcus christensenii TaxID=87541 RepID=A0A133Y3Q3_9LACT  ali  50  8...................................................KALKQELEQIQQLLFDCGNDIATP--EGPSVYRLKQES-VDWLEERIDVYAQIPPEVSTFVLPGGCLAASMAHLVRTVARRAEREMITFQWTMPTNQVAIKFVNRLSDYFFALARLLNAKENYPETIYHNGQAVF. 139
421 1.000e-35UniRef50_A0A2S2DUX0 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Pseudarcicella sp. HME7025 TaxID=2183547 RepID=A0A2S2DUX0_9BACT  ali  33  3.IYTKNGDKGFTRLADGNGVSKSDLRIDAIGDIDELNSYLGLLNTQL---SDSLNTKVLGIQTSLFVLGAHVASDSTEFLGNMKLIELHDIVALEGLIDEMDEVLTPMRVFILPGGHETIALAQVCRTVCRRAERSLIRWVQAEEKEEISIAYLNRLSDYLFMMCRYLHHSLGIPEIPWNSGR.... 184
422 1.000e-35UniRef50_A0A2S2E215 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=32 Tax=Alteromonadaceae TaxID=72275 RepID=A0A2S2E215_9ALTE  ali  34  2KIYTRTGDKGNTQVYTVEPLPKNHRLLEVYGTLDELNAHLGLLASYLDISESHCQA-IFEVQQKLFHIGFTLSAS--------SELTDSDVTELEHQIDQWHTELPPQTSFILPGGCTKAAQAQVCRTVCRRAERHVVALSEQRDVSPQALCYLNRLSDWLFTLSRYLNHQQGITE........... 170
423 1.000e-35UniRef50_A0A2E2QEN9 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E2QEN9_9FLAO  ali  36  2KIYTKKGDKGLTKILGGTTLEKSNVRIESYGTIDELNAYLGLI--YNIIKEEEIKIIINKIQNKLFVIGSLLASDPDKNNIKIPKIKNEDVIFLEKTIDNYEKKLPEITKFIIPGGSKNEALFNISRCICRRAERLCVKLKKGHQI-ELIIQYLNRLSDCLFVLARYANMQDDGKEIYWEP...... 179
424 1.000e-35UniRef50_A0A0T6AJ57 ATP/cobalamin adenosyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A0T6AJ57_9BACT  ali  34  6KIYTKKGDEGQTSLFGGQRISKSDPRPEAFGTLDEVCAILGVARAAAD--NPDLQAVIHSIQEDLFLLGAELATAPEDRPRSVAQITPAHTARLESLIDERLAKIELPRAFIIPGSSYIPALLDWARAVLRRAERRVVELREAGLLNAEVLKYLNRLADLLFVLARYQEAQEGKGAVQWRGRR.... 189
425 1.000e-35UniRef50_A0A1F3Y0X4 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bdellovibrionales bacterium RIFOXYD1_FULL_53_11 TaxID=1797403 RepID=A0A1F3Y0X4_9PROT  ali  31  3.VYTGKGDHGETDLLGGERVPKDHLRVRTYGTADELSAFIGLA-ASPKAVKADIRRKLVRIQRELFTLGAELAMPKSGAGARIKLVGQAELVALKMELETFERKVPRLTNFILPGGSPAGAALGVARAVCRRLEREAVKLHRHEPLRPEVLRYLNLLGDWLFVCSRVVNKSDDVTEEAWK....... 184
426 1.000e-35UniRef50_A0A2E0BDV8 ATP:cob(I)alamin adenosyltransferase n=4 Tax=bacterium TaxID=1869227 RepID=A0A2E0BDV8_9BACT  ali  41  9KVYTKFGDKGKTMLVGGETVLKSSEKVASYGDIDELNSIIG--LSMTGDISKDVKKILSLIQNDLFIIGADLAS---NKETKVPRIKKARIGWQEKNIDKYNSKVGPLEEFILPSGSFTGSCLHLARTVCRRAERKIVKLDQEEWVNPNVMIYINRLSDLLFVLARDQNKLSNEGEI.......... 180
427 2.000e-35UniRef50_A0A2J8XLG6 MMAB isoform 10 n=5 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2J8XLG6_PONAB  ali  39  51KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAKELQKIQCTLQDVGSALATPRSSAREAHLKYTTFPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAER--------------------RLSDYLFTLARYAAMKQGNQEQIYKK...... 214
428 2.000e-35UniRef50_A0A238UDK8 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=75 Tax=Bacteria TaxID=2 RepID=A0A238UDK8_9FLAO  ali  32  2KIYTRKGDAGKTGVFGGKRTYKNSARIECIGTLDEVNSTIGLLRAKLG-PEHEWQTNLHRIQKDMMDMMSHLARPSDSKKENPNPKPIDGADFCEEWLDALEAGISPSDYFILPGGNEISALCHVCRTQIRRGERTLVTLMQEDPVEEYIMAYVNRLSDLFFTMSRAEMDKEGVAEEKWQ....... 183
429 2.000e-35UniRef50_A0A2E5YXN9 ATP:cob(I)alamin adenosyltransferase n=6 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2E5YXN9_9EURY  ali  32  6RVYTGTGDEGKTSLVDGTRVSKIHPRLQVVGTLDELNSIFGVERKNVKEVQHIVSKGVKRIQQELFDLGAELACPIDNIPEGIVLLQQEVSDMLLIEMDSMQKELKPLNSFILPGGVAPIANLHVARTVVRRAERNLVELVKEKSVRTFVKEYFNRLSDWLFIFARWISNRLDEEEFYWTPVERRE. 210
430 2.000e-35UniRef50_A0A2E5HY17 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5HY17_9CHLR  ali  31  9...TRTGDDGTTSTIQGKRVYKDAPLIKAFGTLDELNSAIGLILA-CKKLPNSYTKILRSIQNTLFHLGSDDINDKIDDTPSHPHIENKHITELNDLIAEIYSEVGPLKNFTHPGGTETAARLHMARAICRRAERDVITLSHTAKIGTLTITYLNRLSDMLFLMARSENKRDGFQEKTWDSH..... 187
431 2.000e-35UniRef50_A0A256CIH4 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Ignatzschineria TaxID=112008 RepID=A0A256CIH4_9GAMM  ali  34  7KIVTKTGDSGTTGIAGNIRLEKYHPRIETIGLIDELNSLIGIGIADLNEVVKEDDAPLLRQQHQLFNLGGELSMPGTE------LIREKAVTQLEEWLTDYNEQLPPLKEFILPGGTSTVAKTHYIRAISRKVERALWELNSHDPLNPHSLKYLNRLSDYFFVTARMIAKEERSAEIFWQK...... 189
432 2.000e-35UniRef50_A0A1L8PBD7 Uncharacterized protein n=1 Tax=Alkalibacterium sp. 20 TaxID=1798803 RepID=A0A1L8PBD7_9LACT  ali  46  2KIYTGRGDYGNTNLIGGGTIKKTDKRVEAYGGIDELNSHVGLLLSLINEEWNYIKNSLSRIQHQLFDIGSILA---DKDNKMEXXXXXXXXXXXXXXXXXXXXXLSEIKYFILPGGTKQASQAHVARTVTRRIERTMLSLHDVEPLPKEILIYVNRLSDYFFVLARYLNKIAEKEEVFYTKTGEVF. 188
433 2.000e-35UniRef50_G8TWK9 Uncharacterized protein n=10 Tax=Sulfobacillus TaxID=28033 RepID=G8TWK9_SULAD  ali  39  3RIYTRQGDHGQTRLGTGEKVSKHHVRVAAYGSLYELNSMLGHARALLTVYRPDRPDFLTELMHQLFMVGHDLSGGH---KNISVATQESDTQILEQWIDHWRSILPPWKPFTLPEGSIPGTALYQATTVCRRAEREIYRLNQEEPVARPVLMFVNRLSDFLFMAARYVNEVLGSSESPVRNPR.... 190
434 2.000e-35UniRef50_A0A2E5W4R1 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E5W4R1_9BACT  ali  38  25KVTTKTGDSGQTSLGNSERVSKNNIRVHVIGSVDKLNTIVGWARVHSNGHFD---NQLENIQQDLFNLGGEIAVPDVE----MNLLNESRLEWLDGKTNYYNDKLPPLDEFILPGGSELSSRLHIARAECRETERYLIGLSEKEFVSDLHKKYLNRLSDFFFVLARIAKSDDNIEEKSWRYEK.... 200
435 2.000e-35UniRef50_UPI0003B772E9 cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Desulfospira joergensenii TaxID=53329 RepID=UPI0003B772E9  ali  29  3.IYTGRGDDGTTGLLSDERVPKNHERIDAFGDIDELNATLGVLKSSLADDAVESTRQISRIQSDMLKIGAYSAWRDAPILERLEKIDDTDIRFMETAIDSMEVGLPPLNGFLVYGGHPCAAWSNFARAVCRRAERKVVGLSIELKVMKYILVYLNRLSDYLFLLGRKFNCLTGLPEDIWKS...... 189
436 2.000e-35UniRef50_K8FBF0 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Mamiellales TaxID=13792 RepID=K8FBF0_9CHLO  ali  35  68KVYTKTGDDGTSSLYNLERRKKSDLTFEALGDCDETNVAVGIARADMNCFDEDVLPHLEIIQSRLLDVGSAVATPMTSEKKMRCRFDESHVDAIESWIDAYEEELPALTNFLCPGGTKFAAFLHQARAICRRCERKVQPMVESGDVEKSVGMYLNRLSDYLFVAARVANHRVGVEDVSYKK...... 275
437 2.000e-35UniRef50_A0A2M6R882 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Berkelbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_43_14 TaxID=197451  ali  37  3.VYTRTGDDGTTGLLGGVRVKKTDARVEALGTLDELNASIGLSICMIPRTGKQIKQELIDVQNNLFSIGSNCATPSFPAPHIPSKPTTDDIFALEKAIDRYDTELTPLSGFILPGGSPEAAQLHVARSICRRAERRLG----AIKTNKVFMKYINRLSDYLFTCARVMNARTHVKDIL......... 188
438 2.000e-35UniRef50_A0A2X4T6C9 ATP/cobalamin adenosyltransferase n=5 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X4T6C9_SALCE  ali  35  3.IYTRTGDAGTTALFSGQRVSKTHPRVEAYGTLDELNAALS--LCACATHHPQHRRFIESIQQQIFWFSAELASESEQPNPGQRYISTEEIAVLEAAIDAAMSRVAVIHSFILPGRCEAASRLHFARTLARRAERRLVELSADIAVRQVLMRYINRLSDCLYALARAEDHDAHQRHII......... 177
439 2.000e-35UniRef50_D0DB70 ATP:cob(I)alamin adenosyltransferase n=11 Tax=cellular organisms TaxID=131567 RepID=D0DB70_9RHOB  ali  40  6KIYTRTGDKGDTALVDGTRVPKFNARVEAYGTVDELNAALGVTRHHAEGA---LAEALARIQNDLFDLGADVGRPDISKDYPVXXXXXXXXXXXXXXXXXXXXXLEPLRSFVLPGGSALAAHLHVCRTVARRAERRTVELASVEEVNEHAVKYLNRLSDWFFVASRIAN-DNGRADVLWVPGAN... 189
440 2.000e-35UniRef50_A0A061P9E6 Cob(I)alamin adenosyltransferase PduO n=1 Tax=Geomicrobium sp. JCM 19039 TaxID=1460636 RepID=A0A061P9E6_9BACL  ali  36  2RIYTRGGDEGKTSVIGG-RRKKHDQRIIAYGSIDEVNSFVAKARHSVAQKKISDRERTPRHSTRTFL-----WESCNVKEGPAYKVTARNAAQLEEWIDHWTSLSPKIERFILPGGSEASANLHVCRTETRRAEREVAALAEIETIHMPVLAYMNRLSDYFFTVARFVNHSLDVADIPYERSAIVFK 182
441 2.000e-35UniRef50_A0A1V4MM15 Uncharacterized protein n=1 Tax=delta proteobacterium MLS_D TaxID=1775673 RepID=A0A1V4MM15_9DELT  ali  35  2KIYTKRGDGGMTDLPGGKRVSKSHSFLEALGAIDELNSCIGLLRSFLPDSETSSAGELRAVQETLLRISSALCGSPVTE-------HDDSPAALENAIDRMEEKLPPLRHFILPGGNAAAATAHLTRTVCRRAERRVAELVELEKKNNKEIPFLNRLSDYLFVLARHLNRVAGTGD........... 175
442 3.000e-35UniRef50_A0A2H5XQ14 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=bacterium HR19 TaxID=2035414 RepID=A0A2H5XQ14_9BACT  ali  42  28.ITTKFGDKGQTYIVGGFVLSKHHPRVEAYGSVDELASFLGYAISVIDSNFSDIVEVLKRVQNHLFILAGDLARPSDSIDKEKKRVIKKMIDWLEDVERSYLKDLEPLEDFILPGGSEEASLLHIARVVARRAEREVSELMSYEKINENCLIYLNRLSDLLFIMARVINKRKGIKEEIWEP...... 214
443 3.000e-35UniRef50_P64804 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1674 Tax=root TaxID=1 RepID=PDUO_MYCBO  ali  35  7RIYTRTGDDGTTGLSDMSRVAKTDARLVAYADCDEANAA-IGAALALGHPDTQITDVLRQIQNDLFDAGADLSTPIVENPKHPPRIAQSYIDRLEGWCDAYNAGLPALKSFVLPGGSPLSALLHVARTVVRRAERSAWAAVDAHPEGVSVLPYLNRLSDLLFILSRVANPD---GDVLWRPGGD... 189
444 3.000e-35UniRef50_UPI0009392ED7 cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Fusobacterium massiliense TaxID=1852365 RepID=UPI0009392ED7  ali  37  11KVYTKRGDKGETDLLGGSAARKDSLKVESYGCIDEASSFIGLARFHTK--NKVMKDRLKGIQNKMLVLGGFLASDEKGKEMMKDQIKEDDIKLLEEYIDEYNQKLPPLTHFILPGDDGVAAYFHVARTVVRRAERRIVSLTAQEPLNPLIQKYVNRLSDLMFVLARYSEEVENKK---WRSS..... 188
445 3.000e-35UniRef50_A0A1I4MUP2 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Pelosinus TaxID=365348 RepID=A0A1I4MUP2_9FIRM  ali  34  60.IYTRTGDQGTTSLLDGSRVRKNSIRVDSYGTIDELNSLLGFGKHFV--ANSDIVEKIHIVQRELFAAASELADP--KGEKYAAKLGETEILRFEAWIDEYVKLMDPAPKFIVPGSSQASGILHVARTVCRRAERLMAALDETEPVSPSLMKYVNRLSDVLYTFARFLEEQQ............... 226
446 3.000e-35UniRef50_A0A1V6ELN1 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Bacteroidetes bacterium ADurb.Bin090 TaxID=1852803 RepID=A0A1V6ELN1_9BA  ali  30  19KIYTRTGDTGTSSLADGERVLKNDLRLEAYGTTDELSAQLALLRTLLKTEEEKNR--ILELQKHLFRISGRLAYRKPPENDNYARLDKELTHQLEKAIDCIQKKLPVTHSFVVPGGSAAAAQAHICRTVCRRAERKCIAVHQTEKLNESMLTFLNRLSDYLYILSRKLC-LDETDELFWDGK..... 204
447 3.000e-35UniRef50_A0A1R2ATX4 Uncharacterized protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2ATX4_9CILI  ali  39  6.IYTKNGDSGFTGLFSGEVLEKSHLVFEALGNVDELNSALGLCIS--SSMHEDLNTILETIQSRLIDIGSCLADEENQEKLQRVSFDCEYTGELEKIIDLLDSELPMLTQFILPSGGESSSRAHLARSICRRAERSIVKLKNSYKISQSVMTFMNRLSDLLFVVARTFARRDGVREKTYKKAK.... 188
448 3.000e-35UniRef50_A0A2M7AD16 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28 TaxID=1973917 RepID=A0A2M7AD1  ali  34  2.IYTRSGDNGETGLRGGPRVPKDNLRVEACGSVDELNTTLGVCLSFLD--SNELTSLIQRIQRELLVLGSELATPPRGAQGMKLSIRSTQVDDVEKQIDRFEADLNPLKEFIVPGGSPAAAHLHHARAVCRRAERRTVALNRSDPVSLNTLKYLNRLSDLLFVLARWTNKQAGVDDLRWEKDR.... 184
449 3.000e-35UniRef50_A0A131ZV57 Proteasome endopeptidase complex n=1 Tax=Sarcoptes scabiei TaxID=52283 RepID=A0A131ZV57_SARSC  ali  34  52RIYTRTGDNGSSGLFTGERRSKDDAIFEALGSTDELTSTIGFAREFVN--DTIIRNELEKIQCIIQDLQATIATPKSSSNQFQQERTKWNIDHLETWIDRHSENLPQLKNFILPSGGQAACALHMARAVCRRAERRLCPLLNE-GLELSVLQYLNRLSSYLFTIARVCSKQDGFEE........... 227
450 3.000e-35UniRef50_D8LH13 Flagellar associated protein, cobalamin adenosyltransferase-like protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LH13_ECTSI  ali  37  78.LYTRSGDKGTSQLYNMETRPKSDPSFEALGNMDELNASLALAVAHSELARNGLSEMLVAIQSLIIDASALVATPRDNSKISRTGFPTWCTDQLEACIDELDARTPPLKTFIVPGGGLAASHLHLARCVCRRAERSLQPLLGTGQGVEEVARYINRLSDLLFAAARYASVVDGKPERPWKK...... 260
451 3.000e-35UniRef50_A0A1F5EBP0 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Berkelbacteria bacterium RIFCSPLOWO2_01_FULL_50_28 TaxID=1797471 RepID=A0  ali  35  3.IYTKKGDDGTTGLPGKRRVRKDDPLIETLGSLDSSNASIGVAITAIS-GKSELPNALRQVQRDLLSIGAQLAAADGEKLEDSWLDR--RTSEMESTIDRWDKALPPLANFILPGGSAAGASIHLARTFVRTAERNLNHLDST---NGKILRYINRLSDFLFQAARFANYSTGNSEEIWQYGKK... 179
452 4.000e-35UniRef50_A0A2N2XU00 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-20 TaxID=2013689 RepID=A0A2N2XU00_9BACT :_  ali  34  2KIYTKTGDHGITSLVGGTRIEKSSDLLEVYGSIDELNAFLGLLIT------EKEIPFLTEIQQNLFVIGGIVATPTFYDQYWQNVNITEFISSIENEIDLLSDQIEPMKTFILPQGSKSISYAHICRTICRRTERKMFKLESENALLKSCMIYVNRLSDYFFILARFFHKIDSVNET.......... 173
453 4.000e-35UniRef50_A0A2E1N2D0 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A2E1N2D0_9FLAO  ali  32  2KIYTKKGDLGNTSLIGGKIVKKHNIKVDAYGNIDELNSFLGLVRDLSD--DDQVNDIIVTIQKKLFSIGSLLALGDYKRDNKKLQIKKIDVDYIENEIDKIDKNLTPITKFTIPGGHKLISYLHITRCVCRRAERKISYVNEIEKLDPNIPAYMNRLSDLLFILSRYFCKKLNVKELYW........ 182
454 4.000e-35UniRef50_A0A1V6BLB3 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Bacteroidetes bacterium ADurb.Bin145 TaxID=1852807 RepID=A0A1V6BLB3_9BA  ali  34  2KIYSCTGDDGTTSISGGKRLPKHHPRIEALGTVDELICWIGLLRVNEEVYNH--RNFLINIQKQLMIFSSALAAENIKRPEDMFLG-GDPVGILEKEIDSLQETLPGLKKCILPGGNPLISYIHISRCVCRRAERKLAKLAEKEIIPPLTAKYLNRLADYLFVLSRKISLDLHINEIMW........ 177
455 4.000e-35UniRef50_A0A075KM66 ATP/cobalamin adenosyltransferase n=3 Tax=Sporomusaceae TaxID=1843490 RepID=A0A075KM66_9FIRM  ali  35  2.IYTRTGDKGMTSLLDGSRVRKNSIRVDSYGTIDELNSLLGFGKHFI--MNPAIVEKIHIVQLELFAVAAELADP--KGEMYPAKIGEAEILRFETWIDEYVKLMNPAPKFIVPGSSQASGILHVARTVCRRAERLMTSLEEIEPVSSSLMKYVNRLSDVLYTFARFLEEQQ............... 168
456 5.000e-35UniRef50_A0A076K1C8 Cob(I)yrinic acid a,c-diamide adenosyltransferase CobO n=848 Tax=root TaxID=1 RepID=A0A076K1C8_9RHOB  ali  41  6KIYTKTGDAGTTALGNGTRVEKHALRVNAYGTVDETNATVGLARQHATGDMD---AQLAAIQNDLFDLGADLCRPDMEKEYQPXXXXXXXXXXXXXXXXXXXXXLEPLRSFILPGGSALAAQLHLCRTVSRRAERMTVELAGQEAINASALQYLNRLSDWFFVAGRIAN-DDGRADILWVPGAN... 189
457 5.000e-35UniRef50_G5GD14 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Alloprevotella rava F0323 TaxID=679199 RepID=G5GD14_9BACT  ali  35  2KIYTRSGDKGMTSLANGHRVKKCDDRVEAYGTLDELCSHIGLLAAMCP---EELRTNLYDIQRRIFAINGALA----LLKEPQGLPTAETIEAMEQLIDSVDTSEGRFCGFVLPGGAMPAAQADVCRTVCRRAERAIWRLGDEA-LPHETMVYINRLSDFFFLFARYLNKFMGSEEI.......... 170
458 5.000e-35UniRef50_F0Z8X0 Uncharacterized protein n=1 Tax=Dictyostelium purpureum TaxID=5786 RepID=F0Z8X0_DICPU  ali  37  32KIYTKTGDKGTSALFNGERRSKCNPIFNVLGSVDELSSHLGVAKEQLVCLKHKVIEEIESIQCLLLDVGSNVATPATTSSEQHLKFSDDHTTQLENWIDEHTLHLQPLKNFILPGGGLSASQLQVCRSVCRRSERELVLMREQDSVNPSVMHFLNRLSDYLFTVARLSTHIQKVEESVYKR...... 232
459 5.000e-35UniRef50_A0A1I7JC87 Cob(I)alamin adenosyltransferase n=3 Tax=Alicyclobacillus TaxID=29330 RepID=A0A1I7JC87_9BACL  ali  38  2RIYTRSGDEGQTSLIYGRRVSKASARVGAYGTLDEANSAIGLVLSWLPEQFDDLRRFLARVQRDLFDLGRDLATPLDKQAEFHTT--EADVGLLERMIDRLDADNPPLQRFLLPGGHPAAAALHLARTIVRRAEREVVALGEVEPVQPWIRRYLNRLSDLLFVMARSVHTRTGVAEP.......... 178
460 5.000e-35UniRef50_A0A1V5ZT11 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Candidatus Latescibacteria bacterium ADurb.Bin168 TaxID=1852850 RepID=A  ali  35  3RLYTRSGDRGKTRLADGSSVPKDHVRVEACGALDELNAQIGVARSLLEHND--MGRFLAGVQSTIIELTSGIANPVDSGAG----LTEGKIRALEEETDRADGCCPPLRSFVLPAGSPAACALQVARAVCRRAERAIVRLGTEAGLPKNALPFVNRLSDLLFAYARWANVRAGVEELPQIPGK.... 180
461 5.000e-35UniRef50_UPI00053494A2 cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Enterococcus faecalis TaxID=1351 RepID=UPI00053494A2  ali  51  2KIYTKTGDKGMTKLVGSSTVAKDSDRVESYGTIDELNSWVGYIISQLPQENQEIKEELEALQHLLFDAGTDLSTPIEAQR-PFKLQKES-VHWLEQRIDFYTAQSPDIDRFILPGGTPAASMVHVA............................................................. 125
462 6.000e-35UniRef50_C6JQ83 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Fusobacteriaceae TaxID=203492 RepID=C6JQ83_FUSVA  ali  34  10KVYTKKGDSGETGLYGGSRISKNDIKVDTYGNIDESAAFIGAARALVK--NKEIKEILYKIQEKFLVVGAHLASDKNGILKLKEKIEISDIENLEKIIDEYSKNLLPLYKFIIPGENIESAALHVARTVVRRSERKIVALKESEEVAPEILKYINRVSDVLFVLARAVEDEEAV............. 181
463 6.000e-35UniRef50_A0A1F3T5W0 ATP:cob(I)alamin adenosyltransferase n=2 Tax=unclassified Bdellovibrionales TaxID=404130 RepID=A0A1F3T5W0_9PROT  ali  35  2KIYTKMGDEGKTSLVNSSNIEKSDVRLDVYGTSDELNSCIGIAIAKLKKINFENKESLFDIQARMFDFGSLLACDKKDWSKYNLQLIDSNIKKIELEIDEMESKNSKINFFILPGGSEEAAYLQLARTVCRRLERNLVYFYNEDEKCSELLIYINRLSDYLFVLARYVNMSLGISEKAW........ 185
464 6.000e-35UniRef50_A0A2E1ZY60 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E1ZY60_9CHLR  ali  40  2KIYTKGGDEGNTSFYGGKRVLKNDLFVSAYGDVDELNSSIGITLSYLKNIHKNIIKQLEKIQNDLFNIGFELATPLDQVKKFKNFVNDKDIKDLEVAIDSMQETLPPLDNFILPTGILPAAQLQLSRAICRRSERSIVTAAQEAEISKNILVYINRLSDYLFVLARFVNVFDDKPEKMWDK...... 207
465 7.000e-35UniRef50_A0A142BGQ7 Ethanolamine utilization cobalamin adenosyltransferase n=12 Tax=Bacteria TaxID=2 RepID=A0A142BGQ7_9GAMM  ali  36  12RIYTRTGDKGTSRLGDGQALSKSDARFEAIGTVDELNSWMGMLLNGLQDVSDDQLANIEAIQHRLFDVGGELAMPGYQ------LIQAEHTEALEQLIDELNAPLPPLTNFTLPGGGTNACHCHMVRTVGRRAERAVVRLHESAEINAPLMTYLNRLSDVMYVLSRHCA-RQNEGEVLWQASPK... 192
466 7.000e-35UniRef50_A0A1N6IR14 Cob(I)alamin adenosyltransferase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1N6IR14_9RHOB  ali  35  7RIVTRTGDAGKTGLSDGSRVDKDTPRMEAIGTIDELNSQIGFARSLISEDMEDIRNMLVLAQHDLFDLGGALSLPGAD------LLTKAHIDRIEASAERLNAKLPALKEFILPGGSPAVGAFHVARTTCRRAERRLSQLDCDPQPGAFGLAYLNRLSDLLFIMARTVGASDGSGEQYWEAGKSL.. 188
467 7.000e-35UniRef50_A0A1N6VQT9 Cob(I)alamin adenosyltransferase n=4 Tax=Halanaerobium TaxID=2330 RepID=A0A1N6VQT9_9FIRM  ali  38  2KIYTKSGDKGKTSLFDNTRVAKDSLRVESYGTIDELNSSLGFAKNFVE--EKEVYNIIRSVQRKLFNLAGELATPDWESFPEKISQEDXXXXXXXXXXXXXXXXXXXXXMFIIPGSSKASGALHQSRTICRRAERRITALAKEADISSDLQKYINRLSDLLYTLARYLEKELDYVE........... 175
468 8.000e-35UniRef50_A0A239ZPR4 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Clostridium TaxID=1485 RepID=A0A239ZPR4_CLOCO  ali  38  2KIYTKGGDKGQTSLIGGERTYKYDDRVWAYGTIDELNSSLGLARAKLR--DENFRKVLLKIQKQLFELAAELAST--GTDKYKENISEKDVEFLEKIIDGLNEEMPSLNSFIVPGGTEESATLDVARTVARKGERYIVKLESNYYVNKNLLKYMNRLSDLIYTLARIIDYRQVLKE----SKKRV.. 178
469 8.000e-35UniRef50_F3KGT6 Cob(I)alamin adenosyltransferase PduO n=1 Tax=gamma proteobacterium IMCC2047 TaxID=434085 RepID=F3KGT6_9GAMM  ali  34  8.IVTGGGDKGETSLAMGNRVAKDCARIEAIGSIDELNSFIGLFLAAIDI-EPELFGLFRSIQNDLFDLGGELAMPGHDI------ISAAHWQKLEKHAGELNAELPPLENFILPGGNEVVARCHVVRSIARRAERRLISLTHEDNVNHNSLVYLNRLSDLCFIVSRWLSLQTEQGEVLWQSSSS... 183
470 8.000e-35UniRef50_F0SGY4 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Planctomycetaceae TaxID=126 RepID=F0SGY4_RUBBR  ali  35  7.ITTKAGDAGQTGLGDGSRVAKSSARVEAMGTVDELNSVLGMVVSTEP--PEPYRVWLRQIQNDLFDLGADLCFPTRPADYP-PLFSADHVNRLDSWLEELQPLLPPLESFILPGGASSPASLHWARTVCRRTERTVLRLQEEEPLEPLFVVYLNRLSDLLFQLARVCEDPA-HPAPLWKPS..... 183
471 8.000e-35UniRef50_A0A2E4DF00 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Halobacteriovoraceae bacterium TaxID=2026745 RepID=A0A2E4DF00_9PROT  ali  35  6.VYTKTGDQDETSLVSGTRKKKSDVRIDLYGEVDELNSHLGVLRTLIPNEKHNPESTLVHLQHKLFDLGSMLACESDKWESYKPVITIHSVQLLEDEIDKMDEILPKLKNFILPGGSRAGAYSHVLRTVSRRCERKLVEFHEGHKIPENSLELLNRMSDYFFILSRYLNFAESESETIWEKG..... 191
472 8.000e-35UniRef50_A0A2R6CCR2 ATP:cob(I)alamin adenosyltransferase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A2R6CCR2_9ARCH  ali  34  4KFYTRSGDRGDTSLYSGVRIKKSEKRVAAYGGVDELNSVLGLARSFIS--DEQTKQILFREQIRLFTLGADLATPLDAKTPKPLRRISEADIK-EVEDTIDTLKASPPHAFIVPGSSQSSALLHLARTVCRRVERDVWALAEDKQTNTATAVYLNRLSSLLFTLAVYVNQKMGVAEDYWQP...... 182
473 1.000e-34UniRef50_A0A085MFS6 Uncharacterized protein n=1 Tax=Trichuris suis TaxID=68888 RepID=A0A085MFS6_9BILA  ali  34 1567....GTGDKGQSSLFTGERRWKDDRIFEALGATDELSAAIGKMRHMCNEAGFDVTEKLIDIQCTLQDIGAHVATPLTSKTSDMMRKHTQYADELDEWIDYYANDLPPLKMFILAGGNLLSSCMHEARCICRRAERSLIPLLREGEIDKSAMQYLNRLSDLLFVLARYVCRKTNDEEIAYKKK..... 1749
474 1.000e-34UniRef50_A0A1G5NUM1 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Afifella marina DSM 2698 TaxID=1120955 RepID=A0A1G5NUM1_AFIMA  ali  33  3.VYTKGGDKGETSLLGGLRVSKDSLRVEVYGTLDEATSAMGLGRASCE--DDELRGDLHCLQRELIDVMAEVASPDKPRKGKVYRVEPHQVERLEKLIDAYQEERVPQRGFVTPGGTQAAAALDMARTFVRRGERRLIALGREEEINPVLFKYFNRLSDYLYMAARIDEQRAVVREVTKQIKKS... 186
475 1.000e-34UniRef50_A0A2K5YIC0 Methylmalonic aciduria (cobalamin deficiency) cblB type n=23 Tax=Euteleostomi TaxID=117571 RepID=A0A2K5YIC0_MANLE  ali  36  36.......DGDFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAVELVTEKGHIFAEELQKIQCTLQDVGSALATPRSSAREAHLKYTAFPILELEQWIDKYTCQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYKK...... 212
476 1.000e-34UniRef50_E8U8D9 ATP/cobalamin adenosyltransferase n=22 Tax=cellular organisms TaxID=131567 RepID=E8U8D9_DEIML  ali  37  2KLYTRTGDAGQTGLYGADRVSKAHPRVEAYGTVDEVNSVLGLVRAHLHAQDDAMDADLAYLQNALFDLGADLATRTESPAKNVARIDADDVQHLEQLIDQYQAGAPELKQFIHPGGTPASAALQVARAVARRAEREVIRLAHEEDVNAHAQVYLNRLSDLLFIMARAANARAGIREEEWHVKGR... 188
477 1.000e-34UniRef50_A0A1Z9VE65 ATP:cob(I)alamin adenosyltransferase n=1 Tax=bacterium TMED274 TaxID=1986781 RepID=A0A1Z9VE65_9BACT  ali  36  5KVTTRNGDSGKTGLARGGSVYKNDAIIHALGDIDELSSVIGVCNTACK--NSSIVDQFKLIQNDLFDIGGQISLNEDGA----NIITSESITSLDNYIDQYNSSLDPLKEFILPGGDLFSANLHVARSVTRRAERAVVELYSDSLENNNVVMYLNRLSDYFFVLSRFYNKSENIPENTWKR...... 179
478 1.000e-34UniRef50_A0A2E1FIB5 ATP:cob(I)alamin adenosyltransferase n=7 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2E1FIB5_9EURY  ali  26  9RVYTGTGDDGTSAFVDGSRHQKSHLRFEVVGTCDELNATLGLIIMECNRLQSHENSALSRXQNELFDLGAELACLPSELPEYMELIXEAQSDLLLNEMDAWQEHLEPLRNFILPSGQGPEAMIHFSRTVTRRLERSIVRLMKNDSVRKLALVYVNRLSDWLFVLGRWVSFSLGNDETIWKPLATREQ 213
479 1.000e-34UniRef50_A0A2E3HPB3 ATP:cob(I)alamin adenosyltransferase n=5 Tax=Flavobacteriaceae bacterium TaxID=1871037 RepID=A0A2E3HPB3_9FLAO  ali  32  25KIYTKKGEDGTTGLFSGERVNKHNIRIKTCGNLDELNVWIGMIRNF--KMDKNTQNTLITIQQELMSIAAHRAYEVSKKKHTLKPTDKNNVVFLENQIDLISKELPELKNFIIPGGYRIISHTHLARCSCRKVERLISELNDKESVPNVIIAYINRLSDYLFTLAIKFTYDMDVSEIKWIS...... 207
480 1.000e-34UniRef50_A0A1A6BAL1 ATP:cob(I)alamin adenosyltransferase n=3 Tax=Mycobacterium TaxID=1763 RepID=A0A1A6BAL1_MYCGO  ali  37  7RIYTRTGDDGTTGLSDFSRVSKNDPRLVAYADCDEANSAIGVAVA-LGGPSEQIGDVLRQIQNDLFDAGADLSTPVVDNPEHPPRITQAYIDRLEDWCDTYNESLPALNSFVLPGGSPLSALLHVARTVVRRAERAAWAAVDAHPDDMSVLPYLNRLSDLLFILSRVANPD---GDVLWRPG..... 187
481 1.000e-34UniRef50_A0A2D7DY52 ATP:cob(I)alamin adenosyltransferase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D7DY52_9RICK  ali  46  6KIYTKGGDSGLTSLGDGKRVEKYSLRIRAYGEVDEVNSILGIAVC---YSNKFLKKIILKIQNDLFDIGADLCIPSLKENKXXXXXXXXXXXX--XXXXXXXXXLKKLNSFILPGGTKASSFLHYARTVTRRCERTIVELGSKEKINQDIVKYINRLSDFLFVAARIENIKDG--DILWIPNK.... 181
482 1.000e-34UniRef50_A0A1H9CFV4 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Ignavigranum ruoffiae TaxID=89093 RepID=A0A1H9CFV4_9LACT  ali  48  4..YTRTGDYGQTRIIGGHVYDKSHIRIDSYGKVDSLNALLGYTISQLQSGKKHYVPELVQIQQDLFDCGNDLAQINHERDYH---IQEDHWQKLEKMIDSYTEILPPLEKFILPGGSPEASLIHLCRTMTRDVERKIVTLFQIKDSNQEVLRYINRLSDYFFVLGRLINYELNCKDIHYYNSKPVFR 189
483 1.000e-34UniRef50_E3DQP7 ATP/cobalamin adenosyltransferase n=59 Tax=Bacteria TaxID=2 RepID=E3DQP7_HALPG  ali  39  7KIYTKGGDKGKTSLYDNSRVPKDSVRVESYGTVDELNSVLGFAKNFVD--DEEIYDLIRSIQRKLFNLAGELATPNWN--KFPEKITEEDIKFLEDKIDYYLEQMNKKEMFIIPGSSKASGALHQARTICRRAERRITKLAGKADISLDLQKYVNRLSDLIYTLARYSE.................. 173
484 2.000e-34UniRef50_U3QP23 ATP--cobalamin adenosyltransferase n=1 Tax=Ralstonia pickettii DTP0602 TaxID=1366050 RepID=U3QP23_RALPI  ali  35  111KIATRTGDAGTTGLGDGTRTGKDSLRIAAIGDVDELNCHVGVLLTEA--LPDNVRAALLHIQHDLFDLGGELSIPGY------TLLKPEQVAQLDTWLADYNANLPRLAEFILPGGSRAAAQAHVCRTVCRRAERSLVALGAAEALNEAPRQYLNRLSDLMFVLARVLNRAGGGSDVLWQRDR.... 285
485 2.000e-34UniRef50_UPI0009F2680D cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Mycobacterium sp. 1245111.1 TaxID=1834073 RepID=UPI0009F2680D  ali  36  77.IYTRTGDAGETSTGGRARVAKDDPRIEAGGDVDELNAQLGVVLTELR--EEPFAGWLAEIQNELFDLGADLSCPV---DRDALRIDGGYVDRLERRCDEANARLAPPESFVLPGGGPASAALHVARTVCRRAERRAVSVD---DLSPEVVRYLNRLSDLLFIIARAVAADQ----RTWVPG..... 245
486 2.000e-34UniRef50_A0A2H1CC41 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Digenea TaxID=256429 RepID=A0A2H1CC41_FASHE  ali  37  2KIYTGTGDKGTSALFTGERRPKTDVVFDALGTVDELTSVIAMALAQIDLYSKELCDQLDSIQRRLQALSSSVATPIPSSRFKHVNFPEDASKELEAWIDAMTEVLPPLRQFILPSGGTPGTTLHFARSICRRAERCVVALNEEVTVETAVIIYMNRLSDYLFTAARYVSCALEFPEKPYTVSR.... 206
487 2.000e-34UniRef50_A0A0G0X5T1 Cob(I)alamin adenosyltransferase n=5 Tax=candidate division WWE3 TaxID=422282 RepID=A0A0G0X5T1_9BACT  ali  28  5.IYTKNGDTGDTSLYSGGRYSKSDEVFEVLGTLDELSASLGLVKA---PKNKEINTIINDLQEDLFAIGAFIA--NLKSPDVELIDLTQKTEEMEKEMDEFSKLLPELTNFILPGGSTTSAQLHFSRAVCRRLERSLIAYLDRNELDNELNKYFNRLSDLLFVLARYSNNKSGVHDIIWEGK..... 182
488 2.000e-34UniRef50_W7X0U2 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=3 Tax=Proteobacteria TaxID=1224 RepID=W7X0U2_9BURK  ali  33  7KITTKTGDSGETSLASGMRVQKNSPYISALGAVDELNCALGMLAS--KPLSSDVGGVITAIQNDLFDLGAELSQP------GRFILASDRVEFLGQEIERFNASLPPLEEFILPGGSETAAICHFARATCRSVERMIVSLEEIDPAQSSVLPYLNRLSDLLFVLARVLNREAGTAEVYWSSS..... 181
489 2.000e-34UniRef50_A0A0P0GHS1 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=35 Tax=Bacteroidales TaxID=171549 RepID=A0A0P0GHS1_9BACE  ali  36  3KIYTRTGDKGMTGIHGGERVPKDDIRIEANGCIDELNTVIGIVRSLLPI-DDVWQGLLHDIQRELMVVMSHVATPRPGSGNPNPLHAAEMTVQCEQAMDAMMLQLEDNDYFLLPGGTQISAQLQFARAVARRAERRLWTLNREDSVPEDILRFINRLSDLFFVMARMEMQRQGWDEERWQ....... 190
490 2.000e-34UniRef50_A0A1Y4C2Y2 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Flavonifractor TaxID=946234 RepID=A0A1Y4C2Y2_9FIRM  ali  38  4.LYTKTGDKGQTSLVGGTRVSKDSPRVESYGTIDEANSMLG--LAYAQTDRAYIRTTLHTIQGRLFSLGAELASDEEGMEKLKGILSEEDVAFLEQVVDTCTQTTGKQTHFVIPGVDPCSAALHVARTIVRRAERHIVSMSQKYPVRQVVLRYVNRLSDAIYALARLQEDLVQED............ 175
491 2.000e-34UniRef50_A0A1E7RVX7 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1E7RVX7_BUTME  ali  37  4.VYTRGGDKGETGLFGGNRTPKDDIRVEAYGTMDEANSAIGLAYSLSE--DNDIREILHHLQERIFVLGAELASDEKGKAMLKDGISQADIDFMEEKLDYYLSVIGPQKSFIVPGKNPVSSALHLARTVVRRGERRIVEYTHKDPVRPELVKFANRLSDLLFVLARTEEYNE............... 173
492 2.000e-34UniRef50_A0A1E7IQK4 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1E7IQK4_9DELT  ali  39  2KISTGTGDGGQTSLTGGQRVSKNSLRVCAYGTIDELNSLIGVIVA--ETAPDGVSGSLQQIQNDLLYLGTDISTPNPAHPMIASTRIETHIERLEQWAESATKKLPVLREFILPGGSRTAAWLHLARTVTRRAEREVICAVEGDAINQLSITYLNRLSDLLFLWARIAN-DFGQKDVTW........ 180
493 2.000e-34UniRef50_A0A2E8UVK3 ATP:cob(I)alamin adenosyltransferase n=12 Tax=Proteobacteria TaxID=1224 RepID=A0A2E8UVK3_9PROT  ali  34  7KIFTKKGDDGTTDLGGNNRVEKFDSQIIVYGELDELSAAIG-LITCQENIPPDIQDFLQSAQQEMFNIAGELSAPEFQS------LDEKKVVAVEDFIDQINENLPALKEFVVPGEEIRSAQTHMARAICRRAERSLVKLSKERDVNSFALKYLNRLSDAFFVIARLLARESSTEEXLWK....... 179
494 2.000e-34UniRef50_H6LEP3 ATP:cob(I)alamin adenosyltransferase PduO n=6 Tax=Firmicutes TaxID=1239 RepID=H6LEP3_ACEWD  ali  32  4.VYTRGGDKGETGLFGSSRTPKDNIRVDAYGTMDEANSAIGLAYSLCE--DQKIREILHYLQKRIFVLGAELASDEKGKHMLTDKISQADVDYMECTMEEYLAIIGPQKAFIIPGANPASAALHVARTVVRRGERLIVKYNREHESRPELVKFVNRLSDTLFVLARTEEYNGTVKEIADRVKEKLKQ 188
495 2.000e-34UniRef50_A0A1F7BR32 ATP:cob(I)alamin adenosyltransferase n=6 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F7BR32_9BACT  ali  41  4.IVTKTGDAGMTGIIGGKRLSKTNPCFHACGTVDELNALIGVTLAE-EHVPLHIREQLECTQHLLFQIGADLATPL-ESGFTLERMRPSQIEIVEEWICTLEESLPPITYFILPSGSRPGALLHQARTICRRAERWVVAFSQEENINKYIQIYLNRFSDYLFLAARKVNMEN............... 172
496 2.000e-34UniRef50_A0A1F5BZX7 ATP:cob(I)alamin adenosyltransferase n=13 Tax=root TaxID=1 RepID=A0A1F5BZX7_9BACT  ali  35  3.IYTKAGDKGQTSLFGGKRVSKADATIAAVGEIDEFNGCLGLIIAKFENLPDKLTEFFPALQNDLFAIGTVLTGGKSKXXXXXXXXXXXXXX-----XXXXXXXLPPLSNFILPGGSEIAACVHVGRSVCRRAERGIVALAEKQTVDPSIIKYFNRLSDLLFMTARLVNDRAGIKEKIWK....... 178
497 2.000e-34UniRef50_A0A2G6BWM5 ATP:cob(I)alamin adenosyltransferase n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2G6BWM5_9BACT  ali  36  2KVYTKRGDLGQTDLYDGTRINKQSLRVESYGTLDELSSFIGLAKCAA--GEDKIKEVLNIVQLKLFDISAELAT--IKKEKQKNRINEEEIAQMEDWIDMFLENIPPAKSFIVPGSNQCESYMNVCRTVCRRAERNILRLAETEEVSPFILKYMNRLSDLFYALGRKTE.................. 166
498 3.000e-34UniRef50_A0A1V6I232 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=1 Tax=Bacteroidetes bacterium ADurb.Bin035 TaxID=1852799 RepID=A0A1V6I232_9BA  ali  37  6KIYTKNGDKGYTHLLSGENVPKYDPRVEAYGTLDEACSFIGYFYEIIDLPD--IRNDLFTIINDIFIIESHLANKSMSSD-TLPVFSYDRVVFLENKIDQYSSELSELTNFILPVGDPDMSFCHIIRTVVRRAERKICELAENESINDLIMAYINRLSDYFFVLSRKILLLKGKSEIFWK....... 184
499 3.000e-34UniRef50_A0A174C2D7 Cob(I)yrinic acid a,c-diamide adenosyltransferase n=10 Tax=root TaxID=1 RepID=A0A174C2D7_9BACT  ali  31  2KVYTKKGDKGLTSLVGGERVFKTDERVEAYGTVDELAAFLLGDNMRAEAALSPYVDDLNRILSRLMTVEALLACGKTGCGKVAPLA-PEAVTWLEGRIDAMQDALKPIDKFTIPGGNAVVSMCHVCRTVCRRAERAALRADEKYGTDAIVLMWLNRLSDYFYLLGRTLTEHYGVEETLWIP...... 183
500 3.000e-34UniRef50_C7RCM3 ATP/cobalamin adenosyltransferase n=1 Tax=Kangiella koreensis (strain DSM 16069 / KCTC 12182 / SW-125) TaxID=523791 RepID=C7RCM3_KANK  ali  33  7RITTGQGDKGMTRLANQQHVKKSHPRIEAIGTVDELNAVLGMLVASIKKPQHEIISALKNIQNQLFSLGGELASPSQ------VLLKTSDIAQLEAWIKTWNQKLPPLKEFVIPGACVASAKAHFARCVARRAERRLVALIEQEEVTELSIIYLNRLSDLLFIISRMIARTESTKEAQWQR...... 182
501 3.000e-34UniRef50_A0A2D6PPZ3 ATP:cob(I)alamin adenosyltransferase n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D6PPZ3_9BACT  ali  37  8......GDEGNTRLFGGRQVAKDDERIEAHGAVDELNATIGLAR--VSPLPVALDTMLERIQSDL