current user: public

If you have questions about the server, please let us know.

Query: d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}, from SCOP207

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# E-value Template Links and tools%idFirst TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQFLast
1 0.000e+00UniRef50_D8JCV9 3-hydroxybutyryl-CoA dehydratase n=4 Tax=Halobacteria TaxID=183963 RepID=D8JCV9_HALJB  ali  20  5....VLIERENDIATIIVNRPEKRNAMDIPTRKALYAAFEEVEDDDVRAIVLRGAGDSFIAGGDIDSFADFDHMDGMEYS-EKYAQGLYNYVADRHKPTIAAVDGYALGGGTEIALACDIRLATDDAKFGLPEVGIGVIPGGGTQRLVQVVGAGLASELILTGRIISADEAKRIGLANHVYAAEEFEVRAMAEDLASKAPVAQRLAKESIRRS-LDIDAGLEYERLAGAFLFGTDDQKEGANAFLEDRE. 252
2 0.000e+00UniRef50_UPI000401DB90 hypothetical protein n=1 Tax=Desulfatiglans anilini TaxID=90728 RepID=UPI000401DB90  ali  18  3.YKNVEFKTENDIGILTINRPKAMNALNEEVIQEVESVLRDIKNSAVKVLIFTGAGKAFVAGADVKNIRSWGLK--EGFDAVRIGHQMNYDIETLGIPTIAAVNGLALGGGCELAMSCTLRVVSENAKFGLPELGLGVIPGGGTQRLTRLIGKGRALWYLLTGDMIDAKTAVDFGLANLVVKPEELIKREIAGKIAEKAPLAVKSTLFAVYGSETDLETGLILESALANLTIASDDKNEGIDAFYGKRK. 254
3 0.000e+00UniRef50_Q39TJ0 Enoyl-CoA hydratase/isomerase n=1 Tax=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) TaxID=269799 RepID=Q39TJ0_GEOM  ali  23  2SFETIILDKKDGIATITFNRPKVFNAYSEQMSQELKAAVADVSDTSLRVLVLKGSGENFLAGADINMLNSWSKISAEQG--WEKVKEILDSLEKIPLPVIAAVDGMAWGMGSEIALGCDFRICTTRASFAQPEINLGIITGGGSQRLPRIVGKAKAMEMILTGKPINAADACKWGLVNEVVEPEDAAVARLAKAIMGKSPLMVKWAKDCVNVLDHDLLSGIDKELTQFAKTFATQDSKEGTAAFLEKRK. 259
4 0.000e+00UniRef50_D4C2I4 Enoyl-CoA hydratase/isomerase family protein n=11 Tax=Bacteria TaxID=2 RepID=D4C2I4_PRORE  ali  24  6....ILSQQHNRVLTLTLNRPEVRNALSTACLELLVQHLEQAQNDEVGAIVITGNPRFFAAGADLKELQQQT----IANAITDKRPQVWRRLSMISKPIITAANGYALGAGFELLLASDIIIAGESARFGLPEITLGLMPGGGTQRLIRAVGKSLAMQMVLTGEPINAKHALQAGLISEICVDELVVERALAERIAMHAPLAVQAAKALVHSQENHLTEGLQLERQYFVTLAGTNDRREGIEAFFEKRK. 251
5 0.000e+00UniRef50_A0A2D5UE47 Enoyl-CoA hydratase n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2D5UE47_9BACT  ali  18  16....VLYEVNDKIATITLNRPDKLNAYNEEMVGELYETWQRFADPDAWTAIITGSGRAFCSGHDMKVLVEGGETQYKDHDSPT----LWYGEVEIYKPIIAAVNGYAFGGGCSLSLGCDIRIASEDAVFAYPQPKYGVMSLGGHQRLPKLIPPGIAMEFMLTARNITAEEAARWGMVNKVVPKDRLMAREMAHLINQNAPLAVRHTKEALKGLRTDVREGINMAKLVSYRLQTSDDSREGLAAFTEKRK. 261
6 0.000e+00UniRef50_A0A098FA83 Enoyl-CoA hydratase n=26 Tax=Bacillaceae TaxID=186817 RepID=A0A098FA83_9BACI  ali  20  18.YETIKYSVENGVAWLTLNRPDKLNAFTSQMNKEIQKAIKSAGADEVRAIIVTGEGRAFCSGQDLSDVDEGMNLGQKLRED---YGPMMEQIANCEKPIIAGVNGVAAGAGFSLALACDFRLVSEKASFLNAFVNIGLIPDSGLYYLSRIVGHAKALELSLLGEKVTAGEAKNIGLATKVVDEWNEHLKAFAENIANKPTKAIGLIKRYLASYHLSLEEYLKEEAEGQRIAGLTKDYAEGVAAFTEKRK. 267
7 0.000e+00UniRef50_Q0KAX8 Enoyl-CoA hydratase/carnithine racemase n=11 Tax=Burkholderiaceae TaxID=119060 RepID=Q0KAX8_CUPNH  ali  22  7.YDTVFIDRDGPCAVVTMNRLEKYNALNTGLRTDLYAALSSLTERTVRGIVLWGGTKAFVAGGDIPEMLARRPIEAFVP--TSGAPDLWALIHHSTIPVIAAIAGPCFGGGLELAMACDLRVAADNALLGQTETNVGLIPGGGTQRLTRLVGATRAKEMIFTGEIIKPDEAYRIGLVNKVVPAGELLAEAKAHRIAEKSPHSIAMAKLMINGQDATLDMALMLEQLAFATLFSTEDMHEGGAAFLDKRR. 257
8 0.000e+00UniRef50_A0A1X7NJI6 Short chain enoyl-CoA hydratase n=17 Tax=Bacteria TaxID=2 RepID=A0A1X7NJI6_AZOLI  ali  19  23....VLVERRNGVGIVTLNRPDALNAINMAVRGGLTRACRALEDPEIRAVLIRAAGRGFCVGADIKEFRPVTSAVAARRTDPAI--AYVEAVAALSKPTIAAIHGFCLGGGFEIALACDIRVASADALFGLPEINLGLIPGGGTQRLPRLIGTGRALDLMLTGERFGAEEALRLGVVSRLAPSREALAEALAETIAAKSPTAAAYVKEAVTGADLDLKDGIALEKNLFTLLLTTEDRMEAAAAFREKRR. 272
9 0.000e+00UniRef50_A0A2V9JVX7 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JVX7_9BACT  ali  22  2TYETVSYEVKDRVAVVTLNRPKSLNALNAQMGKDLGAALRAASTRGVLVIVVTGAGRAFCSGGDLKAMAGAGTHSREMEAILRNFHDVVSFLQQIDKPVVAAIHGPAVGAGMSIALACDLRIASEDATFSQAFVRIGLSPDGGTWLLPRLIGPGRAAQLMMTGETLGASRALEWGLVNHVVPEGEHLSREFAQQLAALSPQAIASIKRLLRSSERNFFEQLEAEAAEQNANAMTPEFRAALEAFF-KRK. 258
10 0.000e+00UniRef50_A0A1I2N443 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1I2N443_9BACL  ali  23  2.YETIRLKQEDAVATIVFNRPQTLNAFNLTMHEEVYDALNRAADDDVRCIVLKGSGKGFSAGADLGAIDLSEEEPDLGKFLRKTYNRLLMRMVEVDKPIVASLHGPVYGAGLGVALACDFRIAAAGSTYCMAFIKIGLVPDAGTFFLPRLMGLGRALEMAMLGETLSAEEAFRAGLVNRVVPDEALETMKLAGRLAQAPTKALALTKRLMAGFEKDLATALEAEARGQSEAGKTRDFLEGVSAFFQKR.. 253
11 0.000e+00UniRef50_A0A2W4K454 Enoyl-CoA hydratase n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4K454_9BACT  ali  19  31SEQVLLVEREGEIAWFKLNRGKVMNCLNRPLLKALIEACHEVADRSVRVVAIIGAGKAFCAGADLAERKGMTQ--AETLDYLALIQKTMRTIETLPQPVICAINGSAYGGGTELALSCDLRVMVEEAQLRLTEVKLGIIPGGGTQRLPRLIGKSKAKEMILTGAPINAFEGQQFGLIHKVVPALMDTVREWVKEIATGAPLSLAAAKEAINGYDRDLEAGLALETKSYLTLLNTKDRLEGLAAFAEKRK. 292
12 0.000e+00UniRef50_A0A0T6AEQ9 Short chain enoyl-CoA hydratase, 3-hydroxypropionyl-coenzyme A dehydratase n=11 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A  ali  22  4.FETLRLDREGPIARLILNRPAQLNAINRQMLEDLSSACESIEDPSIKVVTLTAEGRAFCAGADLRTVQELSPDPQKWEAFTRLWHRAFNRIEALPVPVIAGVHGMALAGGLELTLVSDLVIADEEARLGDQHANFGLVAGGGSQRLPRLIGLRRAKELMLLGHWLTAREALEWGLINRVVPTGQVREKELAAQLAGLSGSANRTVKMLANGLDLPLAGGLELEIRGVTQHMSSADAREGLSAFVEKRK. 256
13 0.000e+00UniRef50_A0A2S6R6J6 Short-chain-enoyl-CoA hydratase n=66 Tax=Bacteria TaxID=2 RepID=A0A2S6R6J6_9PROT  ali  21  5....ILFTVAERVATITLNRPERRNAFTLAMIDEWADRLEECAARDVHAVLVTGAGKAFCSGGDIDGMKQGQGSGPQERELVGHIHRIPRILERLDKPVIAAINGAATGAGMDLALMCDLRYAARSAKFAETYVKLALMPGGGAYFLPRLIGRARALEMLWTGDFIDSEEAERIGLVNKALPDGDLMALAMARRLADGPTQTIRTIKRAIRGQASDLSTSLDFGASNYGILAMGEDHLEAVDAFLEKRKF 260
14 0.000e+00UniRef50_A9IBK9 Enoyl-CoA hydratase n=9 Tax=Proteobacteria TaxID=1224 RepID=A9IBK9_BORPD  ali  22  2NEEEIISEVRDGAMWITLNRPEAMNSLTPRVLAGISRALDQAQNDGVRAVVLTGNGRAFCAGADLKYVQSQGDTDNGTRHFLSEVLALMNRVESFPMPVIAAINGLALAGGLELVLCCDLVIAARSAKLGDAHANYGLLPGGGSVRLPRKIGPSRAKYLLYTGEFLPAEELLAAGLVNKVVEDAELLSAELVATLARKSPLGLRRMKALVDGLAQPIESALRLELLASEVHAHSADMKEGLAAFNEKR.. 255
15 0.000e+00UniRef50_A0A160VDR6 Enoyl-CoA hydratase n=1 Tax=hydrothermal vent metagenome TaxID=652676 RepID=A0A160VDR6_9ZZZZ  ali  18  1..........................MNNEVVAHLDATVQSIEDEQVGVIILTGAGKAFVAGADIKKMQSMGP--EAALEFGKAGQQMTLTIENSPKPVIAAVNGFALGGGCEISLACHIRVASETATFGQPEVLLGILPGGGTQRLPRLVGSGLANEIITTGRMVSAVEAKSMGLVNHVVPPDELIDMEIANQILNNGPNAIAKSLSCIQRMGMSMEDGLQIEVENFSKLFATEEAKEGLSAFVEKRK. 227
16 0.000e+00UniRef50_A0A1Q3V4A0 Uncharacterized protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Q3V4A0_9PROT  ali  17  4....LLETIEDGVATLTLNRPEALNALSMEIRHGLLEALDRLKDDNVGCIVLTGAGRGFCAGGDVKSMADRSAAGFEARAAIQFSGRVPAAMRACPKVIIGMINGVAVGAGMSMAMACDLRVAAASARFGTGFLKIGLSGDGGTWSLTQLVGTAKARELFFLGDMVKAEEALSIGLVTRVVDDADLATMAMARRIADSPRVALHYMKRNLNAAETPFATLIDLEAFHQARCSQTEDHREAVAAFKEKRK. 254
17 0.000e+00UniRef50_A0A1F8RCE8 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1F8RCE8_9CHLR  ali  18  3.FKTLLYELKDGIATVTLDRPDALNAIDMDMRADFTALSEELFNEAVRVVIFTGAGRAFSAGGDIAHF-EKGWLTPTFRAHSRRLIKFFDDLEALEKPVIAAINGPATGGGLELALACDIRIVSEEATLGFRENYIGLIPGGGCARFARLVGVAKAKELIFAGTMISAKEALEVGLVNKVVPGEKLMAREYAQMLLKRAPQSLGLAKKILNTANVDQTTGILMEGLAQSILLRTEDHHEGLRAFREKRK. 254
18 0.000e+00UniRef50_A0A2H5ZN18 Short-chain-enoyl-CoA hydratase n=36 Tax=cellular organisms TaxID=131567 RepID=A0A2H5ZN18_9BACT  ali  22  7....VDCHFEDRVAYVVIQRPQALNALNSEVLARLEHVLDELQEKAPRCVVFQGAGRAFVAGADIAEMEKMD--LVEARSFARRGQILLQRIEEFPAAVIAAVRGYALGGGLELALACDLIVASDDAQLGQPEIQLGIIPGGGTQRLVRRVGPGMARYLVFSGARISATEALRVGLVDRVVPAAELAVNALARELASKPWFALQQAKAALRAWHTDLVSGCEREADAFALAFAHPDRREGMQAFLQKRKF 257
19 0.000e+00UniRef50_A0A2H5ZPJ1 Putative enoyl-CoA hydratase echA8 n=1 Tax=bacterium HR30 TaxID=2035425 RepID=A0A2H5ZPJ1_9BACT  ali  18  2.YENIRVERAEGIVTIVLNRPETRNSMTPAMGEELSRVVAELRDSAVRVVILRGEGKAFSSGGNLGMLARDTGTGGEGPTMAREFYERFLSITRVHVPTIAALNGHAIGAGACLALACDLRIASRAAKIGFTFTRLGIHPGMGTYFLPRLVGTARACDLLFTGRIVDAEEALRLGLVDRVAPAEQFEVMAWAKEIASAGPIAVRLTKRAIRGVRHSLEEMLDFESLQQSWTFTTEDAREGLQAMLEKRE. 259
20 0.000e+00UniRef50_A0A0S8CPF8 Uncharacterized protein n=1 Tax=Nitrospira bacterium SG8_3 TaxID=1704023 RepID=A0A0S8CPF8_9BACT  ali  20  2TEEKVKYAEQNGIAYVTVNNPKKMNCLDFDVYEGLFSVFRTIQDDEVRVAIVTGEGKAFVSGQDINTFQ--MYPPPEAKRFLRNTLRMFIDLESLSKPIIAAVNGLALGGGTEIALACDIVVASENARFGLPEAGIGVAPIWGVIRLANAVGRYKAKELMMTGDIISAEEAHRIGLVNKVVPHEKLLAEEIAGKIMSKAPLAIDLIKSSINR-DM-LPKGAAFTTQANMHFFQTEDLKEGMEAFLHKRK. 250
21 0.000e+00UniRef50_A0A1S2R3A1 Enoyl-CoA hydratase n=2 Tax=Bacillus TaxID=55087 RepID=A0A1S2R3A1_9BACI  ali  21  2..EFIKHQIENFVAYITIQKPPA-NALSSTVLTEMSGLFDELENSEVRAILIHGEGKFFSAGADIKEFTTI-PSGEEFSALSSKGQKFFERIEQFSKPVIAAIHGAALGGGLELAMSCHIRLVTENAKLGLPELQLGLVPGAGTQRLPRYVGTARAAEMLFTSEPITGSEAVQLGLANHAYQDEELLAKELAQKIAKKSPLALKKTIELLNSKPESFHKGVEKEAAAFGEVFVSEDAKEGISAFIEKRE. 251
22 0.000e+00UniRef50_A0A1F4A1I4 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_64_12 TaxID=1797487 RepID=A0A1F4A1I4_9PROT  ali  18  2SYKAIRFDRDDGIATMTLNRPKQLNSFNQEMFREWREIVEKVADRDIKVLVITGAGRAFSSGVDLNVL-GSEKLPSEFRFYYRQNHRGLDDLEAVEKPVIAAVNGICYGGGVELALSCDIIFAAENAEFCLVENQLGCIPASGANRLIYFVGLARTKEMIISAEPIDAREAWRIGLVNRVVKPKNLLTDAYAAKLTKKSPFAMGMGKHIVNLVNTDMHTGRDLERLGQSVLVLSEDHKEGMSAFFEKRK. 255
23 0.000e+00UniRef50_A0A2E5J3D7 Enoyl-CoA hydratase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5J3D7_9CHLR  ali  20  6AFENTIYSKNNGVALLTLNNPEKMNSLGGDMVEGWLAALDDAEDPDIGAXVVTGSGRAFCAGAQPGNFAARNDAGQPGERFRYGIHXLNRLVEQFSKPYIAAVNGAAAGPGMDLASMCDIRFCSDQARFRMAYVRMGLVPDGGAYYLPRIVGVAKALDLIWTGKIIDAQEALRIGYVNEVVPHGDLLTYTIAEQLAKGPKIAIKFAKRLVNGLTMTLDQSLEAAAAAFSSVQQTEDHKEGPKAFLEKRE. 265
24 0.000e+00UniRef50_A0A2V7T7R3 Enoyl-CoA hydratase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7T7R3_9BACT  ali  18  2TYQTLLFDVRDGVAFITINRPDKLNALNDQVVNELADAAERVADDDIKGVLLTGAGKAFVAGADIADLANQGPFDGKARAL--RGQAMLRRFETCGKPVVAAINGYALGGGCELAMACHLRIAS-------------------AQRLPRIVGKGNALYLILTGEMIDAAEAHRIGLVSHVVPAGELVAKATLRGILAMGPLAVRLAIEAVQGLEMTLDEGLLLEANHFGLLAATQDMREGLTAFLEKR.. 233
25 0.000e+00UniRef50_A0A2N5MHK4 Enoyl-CoA hydratase n=9 Tax=Bacillus TaxID=55087 RepID=A0A2N5MHK4_9BACI  ali  23  3...SVLYEVCREIAHVTLNREEALNLLNTTVIQRLHNVVKDISDPQVRVVILSGAGKAFCPGADVKD--TVYQSPEEILRFKNQLGDLCNAIEALPQPTIAAINGFAFGAGLELALACDIRIAVDQTLLGLPETKLGLIPGGGTQRLPRLIGESRALELILTAKRITSLEAYQYGLVTKVVSHNKLEDEAIAEEILGNGPTAVRLAKFAVQGLKTDMESALKLEKTALLKALNTEDRDIGIKAFLEKRR. 252
26 0.000e+00UniRef50_A0A0D6JBM4 Enoyl-CoA hydratase-isomerase n=327 Tax=Bacteria TaxID=2 RepID=A0A0D6JBM4_9RHIZ  ali  22  5....LREEPSEGVKLLRLNRPDARNALNTALRKELASHFQELSDETARCIVITGDDKAFAAGADLKEIVDDTPVEIMN----RNVRRFWNVISSCPVPVIAAVRGVALGGGCELALHADIIVAGENARFAQPEVCVGVMPGGGTQRLVRAIGKYQTMKLVLTGEPISGRDAFTMGLASEVVPDDAVLDRALARKIASLPPISIRLTKEVLAGADAALDTGLLMERRLFEMMFATADQKEGMNAFIEKRK. 250
27 0.000e+00UniRef50_A0A2U3EJS0 Uncharacterized protein n=3 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3EJS0_9HYPO  ali  23  201SYEYIQVSTKPGVGQVTLNRPKALNALCTPLINELNEALNDFAADDTSVIVLTGSQKAFAAGADIKEMAPLTFSEAYTKSFIESWSLLTTQI---KKPIIAAVSGHALGGGCELAMMCDLIYCTENANFGQPEIKLGTIPGGGSQRLTRAIGKAKAMELILTGKSFSGAEAERWGIAARTFPTEALMEEKLAETIAGYSKVAVQACKEVVNSQDLPLRDGVEFERRVFHSLFGSQDQKIGMKAFAEKKK. 453
28 0.000e+00UniRef50_A0A1W9SVU8 Enoyl-CoA hydratase n=3 Tax=unclassified Desulfobacteraceae TaxID=231684 RepID=A0A1W9SVU8_9DELT  ali  21  5..ENVLLTKEQNNAIITLNRPKVMNSINFALLNAIKNEIEKLYRPDIRAVIITGAGKSFCAGADLKERSTLSP--DKVKKFILTIRNLLTMVQNLNKPVISAINGIALGGGTEIALASDIRIASNNATMGLTETRLAIIPGGGTQRLPRIIGIAKAKELIFTGKRINAKEAFNINLVNKICESEDLMDEKMVDMIKQTGPIAVEQAKYAINGIETDLNTGLAIESNAYQVTIPTKDRIEGLQAFKEKRK. 256
29 0.000e+00UniRef50_A0A1F3RQD4 Uncharacterized protein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1F3RQD4_9PROT  ali  19  8...NLIIEKKEGIAIVKISRPAALNALNIETLQELKISLEELADEAVRVVVLTGDGKAFIAGADILQMKDLSPND--GVRFSQLGHEVARILELMPKPTIAAVNGFALGGGTELAIACDFILASEKAVFGQPEVGLGIIPGGGTFRLARYVGFPMAKELIFTGRKVKAEEAKAIGLVNAVYPLDGFMAQEVAKSISLQSRSAIKAAKRLMTEFSESLNFKLDYEAQTFGQLMGSPDQREGMSAFSEKRK. 259
30 0.000e+00UniRef50_A0A0W8CT07 Uncharacterized protein n=4 Tax=Eukaryota TaxID=2759 RepID=A0A0W8CT07_PHYNI  ali  20  6.YENILTEVRGKVAIITLHRPKALNALCSPLIEELNGAAHAFADKNIGAIIITGSDKAFAAGADIKEMATKSFVD----AYKSNMFANWGDITKVSKPVIAAVNGYALGGGCELAMLCDLIIAGDSAKFGQPEITLGTIPGGGTQRLIRA--------------------AERDGLVARVVPADQLLDEALANKIASFSQPVVKMAKEAVNAYEQSLQEGIKFESRLFWSSFATKDQKEGMAAFVEKRK. 234
31 0.000e+00UniRef50_F5SD64 3-hydroxybutyryl-CoA dehydratase n=63 Tax=cellular organisms TaxID=131567 RepID=F5SD64_9BACL  ali  21  4....VEWERKEGISILTLNRPEVFNALNMPALEQLREIAEELRHSATRVVVVTGAGKAFCAGADLKERRDFTE--DQVRRYIHMIRETFHALASLPRPVIAAVNGVAFGGGMELALACDLRIADEHAVLGLTETSLGIIPAGGTQRLARLIGTARAKELIFTAKRITAREGETLGLLNRVVTGGTVMAMEVAAQINENAPLALAQAKYAIHGSETDLATGLAMETKAYEVLIPTKDRLEGLQAFKEKRK. 252
32 0.000e+00UniRef50_A0A1V5H791 Putative enoyl-CoA hydratase n=1 Tax=Deltaproteobacteria bacterium ADurb.BinA179 TaxID=1852872 RepID=A0A1V5H791_9DELT  ali  17  399AFENCSYDVDDGVAVMTIDNPP-MNTLGRKTKSDITRVLQAVADPRVRVILLTGKGRAFVAGADIEELKRFKTLDD-GIELAHRGYRMTNTIEEADKPIIAVINGFCLGGGLELAMSCHMRIASEKARLGLPEITLGLIPGAGTQRLPRIVGKAKGLEMILSGAHYSAKEAWEMGLVNRVVPHDRLMEEALARTIASRSRVAVSAAMDAVMGLEVSFEEGLLIEAENFARVAVSQDAKEGLDAFLTKRK. 651
33 0.000e+00UniRef50_H3KAT7 Uncharacterized protein n=9 Tax=Firmicutes TaxID=1239 RepID=H3KAT7_9FIRM  ali  21  2..QSVLMEKNEHLGIITLNRPKSLNAMNADLVEEFHRALDIVEDEDIRVIILTGAGRAFCAGGDLGYLESLND-DKKRKAFIERVGEMTLKLRNCAKPVIGMINGVTAGAGVNLMLACDIVCSSEDAKFIQSFVNVGLVPDGGMYLLKETVGLQKAKELMFTADVISAQEAEKLKMVMHVYTKEDLETEKIAQKIAQGAPMAIMYMKKMLNKSYANLKDFLDEEALVQTFCLGTEDCKEGILAFKQKRQ. 251
34 0.000e+00UniRef50_A0A1M6Q3E6 Short chain enoyl-CoA hydratase n=8 Tax=Bacteria TaxID=2 RepID=A0A1M6Q3E6_9BACT  ali  22  7.FATLLVEEDEGIVCCTFNRPEVRNALNLEMVQEVRQLLDQARRDAVRVLIFTGAGGAFVSGADIAELRERG----RAEALQRINNSLFREIEQFPAPTIAAVRGWALGGGCELAMACDLRIAGESARFGQPEVRLGIIPGAGTYRLPRLVGLGKARELIYTGRIIEASEALAIGLVNEVVPDDQVLARALAREIAAASPLAVRFAKMALNAAEMSTDVGLTLETMMQAILFEDEEKYRRMTAFLERRK. 259
35 0.000e+00UniRef50_A0A192IQV9 Uncharacterized protein n=2 Tax=unclassified Rhizobiales (miscellaneous) TaxID=41292 RepID=A0A192IQV9_9RHIZ  ali  22  4AWETLLYEPAGRVGTITINRPDQLNALNSTVFREMSELLAEVADPAIRVIVLKGAGKAFVAGADIKEMVGMSRREAETRSWT--GMRLYDQMRRMPQPLVASIQGYALGGGMLIAMACDIRVASTAASFGYPEIRLGIFPGGGTVLIDRLIGPATARAICLLGDRFSAERAFQLGLVNRLAEPDDLETAEVVETLANYSPVAMRELKTVLNALEMDFATAREFELDAYGRCFDSEDRREGTRAFVEKRK. 256
36 0.000e+00UniRef50_A0A1F9DTS7 Enoyl-CoA hydratase n=1 Tax=Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11 TaxID=1797852 RepID=A0A1F9DTS7_9DELT  ali  21  4..ETLILERKEHFLWIKLNRPEALNALNTQMAKDLLSVAQDAADQDIWVIGITSTDKAFGVGADLKERKDMTA--GEISSQRVLFTRTTLALKSLPQPVIAGVKGFALGGGLETALWADIIIAGENAQFGLPEVRVGLIPGGGTQNLPRLIGKNRAKEMIFTGKRIDAQKAFSLGIVSKVVPVGEEAVLQLAKEICAGAPVAVRQVKKAIDGMNTDLQTGLEIEIETYNVNLVTEDRQEGIRAFNEKR.. 253
37 0.000e+00UniRef50_A0A0P7XIC7 Enoyl-CoA hydratase Crt n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A0P7XIC7_9BACT  ali  20  4TYQTLTLETDEGIAVLTINRADKLNALNAEVMNDLEGAIMKLRDSAVKAVIITGAGRAFVAGADIQELAGLNTFT--GTALSERGQQIFSLIEHSAKPMVAYVNGYALGGGCELAMACHLRIASDTALFGLPEVTLGLIPGGGTQRLTQLVGKGRALQLILTGKPVKAREALEMGLVNWVTDPSEGMAREVLGQIVQRGPVAVAKAIEAVNAVADQPGKGYIAEAEAFGALCGTRDFKEGTDAFLKKR.. 255
38 0.000e+00UniRef50_I3RB65 3-hydroxybutyryl-CoA dehydratase n=159 Tax=cellular organisms TaxID=131567 RepID=I3RB65_HALMT  ali  22  25..ETVDVAVDDGVVTVTMNRPDARNALNATLRAELKRVLDAIEESSARVVVLTGADKAFVAGADVTELRER---DMLEQREASKRPRVYEYVDDLRQPVIARINGHALGGGCELIQACDVRIAHERAKIGQPEINLGIMPGGGTQRLARLVGEGHAMRLILTGELIPAAEAADIGLVEEVHDDEDDRVYELAEMMAAKSPVALEFAKKAVKAASMDLEQGIEYEAELFAQLFGSPDKDEGIDAFFEDRE. 277
39 0.000e+00UniRef50_A0A1M4VVY8 Enoyl-CoA hydratase n=2 Tax=Marinomonas TaxID=28253 RepID=A0A1M4VVY8_9GAMM  ali  21  4TFDCLLLTQQDDVWLITIDRPKALNALNKALLTSLSQAFQWLDAPTTKVILLTGNGKAFVAGADVVAMQAMTAL--EARDFSHLGMALMHQIEACSAPVIALVNGYCLGGGCELALSCDYILASENAVFSQPEVSLGITPGGGTQRLARYIGKGNAMQWILTGDRISAQDALKLTLCHQVLSPSELLGLAQAEKIAKNAPQAVRFAKQLIHGLNLSLHDGCQLETERFALSFTTQDQTEGMAAFAERR.. 256
40 0.000e+00UniRef50_A0A075WHK9 3-hydroxyacyl-CoA dehydrogenase n=22 Tax=Archaea TaxID=2157 RepID=A0A075WHK9_ARCFL  ali  20  401...TIKIEKDGGITKLVLNRPDRLNTISPEVLDELDRAITQLNDKDTRVIVITGAGRAFSAGADLG--GSIITHPFDFLEHNRKGERVFTRLREIPKPVIAAINGYALGGGLEIAMNCDIRLAKKSAVLGLPEVGLGILPGWGTQRLVKLVGISRAMQLALTGERITAEEAERWGLVNKVFDDDEEEVMNYAKNIAERAPISMALIKRLINGGEVPMDIGLEWECTAAGLLFATEDMREGISAFLRK... 650
41 0.000e+00UniRef50_A0A1H9SA41 E-phenylitaconyl-CoA hydratase n=4 Tax=Bacteria TaxID=2 RepID=A0A1H9SA41_9BACI  ali  20  3....IIFEVKNRIATITINRPEVMNAMDPETYKELSDAWIEVRDPDIWAAIVTGAGKAFTAGADLK--KTITQRPEKSDLFLTQKEQLLNRGLEVWKPIISAVNGYCLGGGVTLLLATDIRIATPSATFGLSEVKRGILPGGGTQRTLRQLPYPIAMDILLTGRNFSAEEALKYGLINEIVPQEELMNRALAERIIENAPLAVSAIKEAVKSQYLSIQDGLRMEQILQSHLLGTEDAIEGPKAFAEKRK. 251
42 0.000e+00UniRef50_D4GXV2 Enoyl-CoA hydratase n=74 Tax=Archaea TaxID=2157 RepID=D4GXV2_HALVD  ali  20  2SWDTLRLDWDGDVATITIDRPEQMNALNADTLDALEDALDEAEADGARVVVLTGAGEAFIAGADIGYMKDIGTPAAQN--YAEQGHRIATRLEGFPAPTVAAINGYAFGGGMEFALACDLRVASERALLGQTEIDLGIMPGGGSVRLPALVGDEVARRLIFFGERIDASDAHEYGIVGEVVAHDQLHVEDLVADLASKPRHALAGAKAAINSHDAPRDAALDFEARVWSGLFGTHDQREGMEAFLDKR.. 252
43 0.000e+00UniRef50_A0A0S7WVQ1 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=A0A0S7WVQ1_9BACT  ali  27  4.YTTIRCDVGDRVGRILLNRPEIHNAFNDVMITELLEVLSRLADEDVRVVVLTGSGKSFCAGADLHWMKAVKDYSDENVADALELSKLLYAIYSLPKPTIARVNGAAIGGGTGFVSTCDMAIAAETAKFSFSEVKIGVVPACISPYVVRKVGEGTCREFFLTGKRLTAAEVEQAGLVNRVVPVEQLAVDDLIKELLSSGPHALGVCKDLLNVPSMSLEDAQLYTAKILATLRMGDEGQEGMSAYFDKRK. 256
44 0.000e+00UniRef50_Q1AV57 Short chain enoyl-CoA hydratase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=Q1AV57_RUBXD  ali  20  5.FGHLEVSVEGRVAVARLNRPERYNAIGVRLAEELNRFVEGVEGADVRAVILTGAGRAFCSGVDLKERREMS--LEERWEHNRAVNGFVSRLARLQVPTIAAINGLALGGGFEMTLGCDFRIAAEHAEFALPEVGLGIIPGGGTQRLPRLVGPSRAKELILTARRIDARRALEMGILNAVVPAGRLMEEALAEEAAANSPLAVAYAKAAVDAMETPLEQGLRFETAAIRTTLDSEDYREGLAAFAERRR. 255
45 0.000e+00UniRef50_A0A0D8DB53 Enoyl-CoA hydratase n=15 Tax=Bacteria TaxID=2 RepID=A0A0D8DB53_9GAMM  ali  21  7....IKVEITGKVALLTLNRSQALNALSSELMHELIAKMQQLENPDIGCFVITGNSRVFCAGADIKEMQIKSCQQMIAEDYFSG----WDQFAAIKIPKIAAVSGYALGGGCELAMMCDVIYAGDSAVFAQPEINLGVIPGGGTQRLTHSVGKAKAMDLILTGRHMSAAEAEQGGLVARVFSDETLLEEALAQSISEKGRLSVALAKEAIDAMELPLAQGLVFERRVFHSLFSCREQQEGMAAFIEKRR. 252
46 0.000e+00UniRef50_A0A1H9TX85 Enoyl-CoA hydratase/carnithine racemase n=1 Tax=Salipaludibacillus aurantiacus TaxID=1601833 RepID=A0A1H9TX85_9BACI  ali  22  3..EFIHVEKTNGVAVLTIDRPP-LNVLSKKVFKELGEAFEALDDPEAVAVVLKSAGKAFVAGADIKEFPEMIGREDSKDSIME-GHRVLDAIDSFPKPTIVVLDGLTLGGGCELALTFDIRIAEEHAQIGLPEVKLGIFPGGGTQRLPRLVGKAKAKEMMYTGEPVSAKEAKEIGLVNQVTAKGESEAMKMAGKITGYSLQSLSRIKKAVNGLDVELNKGIDLEAGLFADIFQTEDVKEGVRAFIEKRK. 253
47 0.000e+00UniRef50_A5N093 Crt2 n=3 Tax=Clostridium kluyveri TaxID=1534 RepID=A5N093_CLOK5  ali  19  2TYKTLLLEKQNGITIIKMNTPHNLNAISQQSVEDLFAVLQVIKNDDCRVVILTGEGKGFIGGADIKHMACLDAI--EGGQFCFAVSKCTLEMEKMGKVFIAAVNGFALGAGLEVALGCDIRIFSKHAKIGFPETGLGVIPGGGAQRLQRLVGIGKASEIIFTGDIIGADDALRFGIANQVTEPESLMAMSMAEKILTKSPVGTRLAKEALQGRDTDLEKALEYDKNLFGLCFSTEDKKEGMAAFIEKRK. 253
48 0.000e+00UniRef50_A0A0M2U796 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0M2U796_9FIRM  ali  19  4..EKVKVDVQGPVAWLVLNEPETLNALSVQVRNDLDRALDLVREPGIRVAVIKGAGRAFCAGGDLRAMQENVDVAHWRNRILTGINVIIQKIVGMEKPVLAAVHGFAVGAGCCLAMACDLIIAEESARFGVSFNRVGLIPDGGTFFLPRLVGLPKAKELVFTGRVITAGEAERIGLVNRVVPDGQLAAEKLALEIAAGPAAALGMAKKLLNGAVSDLAGALEREAFAQSHCMALPDHKEGVAAFFAKR.. 255
49 0.000e+00UniRef50_A0A175XZK4 Enoyl-CoA hydratase n=2 Tax=cellular organisms TaxID=131567 RepID=A0A175XZK4_9SPHN  ali  21  4.YKTILVERRDAVTLITLNRPEALNALNAQVLADLLAALAAFDADSQGCAVLTGSAKAFAAGADIKEMAAMDFAAMYGTNHFAGYERLTQT----RKPVIAAVAGYALGGGCELAMMCDFILAADTAKFGQPEVKLAVSPGGGSQRLARAVGKAKAMEMCLTGRMMDAAEAERAGLVSRIVPAADLVEEAVAASIAAMAPLAVLANKEMVNAAETPLAQGIQFERRLFNGLFGTADQKEGMAAFVEKR.. 251
50 0.000e+00UniRef50_A0A2E5J281 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5J281_9CHLR  ali  21  2TYEAILVDKSDGVGTVTMNRPEKLNAHNRQMSREIRQSFLELADPEIGAIILTGAGRGFCAGADMGGFQERIDNNKKGSSAQPQSQPFPQLIRSMSTPVIAAINGVAVGIGFTMTLSCDIRLASESARMSAIFVRRGLTPAGSSYNLPRLIGFGKSMEMVLTGRMVGGQEAAEIGLVQHVYPDDELAAREMAQTISRNAPLAVKWSRDLMKGLDGSLDSQLLMERHIFDRATKTEDHAEAVKAFLEKR.. 263
51 0.000e+00UniRef50_A0A0A3HW98 Enoyl-CoA hydratase n=13 Tax=Firmicutes TaxID=1239 RepID=A0A0A3HW98_9BACI  ali  19  4...FVNVTLEDGIAIVTLMRSEAANALSIQMLHEINEELEKIQDRSIRVVIVTGDGKAFCAGADLKERKGMSE--EQVRQTVALIGLTVNHFELLAQPVIAAINGVAFGGGLELALACDIRIASSNAKVGLTETALGIIPGGGTQRLPRLIGVGKAKELIFTARRITADEALAYGIVEKVVPAKDLLEEALAAEMAKNAPLSLIQAKVAINGIQTDITTGLQIESLAYSRLLYTEDRLEGLRAFQEKR.. 252
52 0.000e+00UniRef50_A0A2C9DV65 Enoyl-CoA hydratase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2C9DV65_9RHIZ  ali  20  10...SLICDIDGPVVTVTFNRPQTLNALDMGVMAELNQVLDRIEDPAIRAVIFTGEGRAFVAGGDIADLNSRKALPHY-NEFAEEIHKLLRRIETLDKPTIGAINGFALGGGTELLLALDIRLVSDRAKLGLPEIKLGLFPGGGTQRILRQIPSCRAREIMYLGEMVSPDEAVQIGLANRVVPHESLLAEAMALKLAAQSPLILKLLKRLIDGADMPLSAALRHEQAVIGLVLDSHDAHEGCSAFLEKR.. 258
53 0.000e+00UniRef50_A0A1F8RTZ2 Uncharacterized protein n=12 Tax=Bacteria TaxID=2 RepID=A0A1F8RTZ2_9CHLR  ali  16  5.FEKILYQKDGHVALITINRPERLNAIDPQTSHEMHTAFCDFRDDKLWVAILTGVGRAFSTGNDLVAMAEMAGKGRDLSGMARAPFGGITRNFECWKPIIAAINGYCLAGGLEIAICCDVRVAAEHAQFGVPEVTRAIIPGGGTQRLPRMLPKGIALELLVTGARFDAQWALRYGLVNYVVPADKLLARELAQAICANGPLAVRAAKEALRGLELPLEEGLRQEIEFSRKVLATEDAREGPLAFAQKRK. 259
54 0.000e+00UniRef50_F5SCJ9 3-hydroxybutyryl-CoA dehydratase n=12 Tax=Firmicutes TaxID=1239 RepID=F5SCJ9_9BACL  ali  22  8.....KWEIRDRVAVITIDRPP-MNTLSRDTLVELEGILDQVEDEAVGCLLITGAGRMFSAGADVSEFGEMGGDREVAEKILKRMHDLFNRIEAFPKPVVACLNGKALGGGNELQMACHLAIAADTAELGLPEVRLGIIPGGGTQRLPRLIGRRRALELMLSGRRISAPTALEYGLINRIAPQDQVHEEAWAKELAAGPPIAMKGILDAVRGSEGDLSQGLSIERENMLSVIRTEDAIEGVTAFFTKRE. 256
55 0.000e+00UniRef50_A0A1X9MHN7 Putative enoyl-CoA hydratase echA8 n=35 Tax=Bacillales TaxID=1385 RepID=A0A1X9MHN7_9BACI  ali  22  3.YENIVAYKDGVIGVIKLNRPEMRNAIDSRTLEEVEEAIEIWEHEGIKVIIFTGEGKSFASGADIKQLKEKEAKD----ALLPGLSGVCQKIESSSKVTIAAINGYALGGGCELALACDIRIAAEHAKIGLPELNLSIIPGGGTQRLARIVGKGRAIEMILMGEVISAEKAENIGLVTRVVKIEDLTAYEIAAKIMEKGPLAVTLAKMVIHGFDLDMKNALLIEKLAQAILFNSEDKHEGVTAFLEKR.. 251
56 0.000e+00UniRef50_A0A2E1VP52 Enoyl-CoA hydratase n=35 Tax=cellular organisms TaxID=131567 RepID=A0A2E1VP52_9PROT  ali  23  22................TLHRPEALNALSRDLIDDLNHALDNAEDKKISLILLTGSKKAFAAGADIKEMNSKSFTDLINDDFIKP----WEKISLCKKPTIAAVDGYALGGGCELAMMCDLLIANENTKFGQPEINLGVFPAGGTQRLPKAIGKAKAMDMILSGRMMEAEEAEKLGLVSRIISSANFLEQEIAKEISEKSLPALIMAKDAINSYDTSLSQGIIYERRLFRSAFSLDDQKEGMQAFIEKRK. 255
57 0.000e+00UniRef50_A0A291BJS1 Enoyl-CoA hydratase n=11 Tax=Bacillales TaxID=1385 RepID=A0A291BJS1_BREBE  ali  20  4....VNVEKREKIAIVSIDNPP-MNALSAGVKEGLRVIFAELHASDVLAIILTGAGKAFVAGADIKELPKRIGNPNLLPQFMEN-HNFFNCIDYSPKLTIAVINGYALGGGCELALTCDLRIAEQHAFIGVPEVKLGLLPGGGTQRLPRLIGEAKAKELLFTGEHITADEAMRIGLINRVVPTGEGLAAALAQKICQNSPSALQHIKKAVDGMELPFQQALKLEAELFQDLFLKEDVKEGVQAFLEKR.. 251
58 0.000e+00UniRef50_A0A1Y1SBI2 Enoyl-CoA hydratase involved in phenylacetate catabolism n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y1SBI2_9GAMM  ali  22  2SYNTLLVENADGVTTITLNRPESLNALSFELLRELRDALVAAKDAECRCVVLTGAGRGFTSGADLKDMMELGERPDLGQPLHTTYHPVLREIRHLEKPVIAAINGVAAGAGLNIALACDVVVAAKSAKLIQAFVRIGLIPDGGTWSVPRLIGRARATRWLMSGDALDADTAFDWGLITDVFADDELQAQALAARMAAQPTRALAAIKQLMDSLDLDLEGQIAREARLQSQIGFTDDAMEGISAFVQKRE. 258
59 0.000e+00UniRef50_A0A1F4DBG4 Uncharacterized protein n=2 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A1F4DBG4_9PROT  ali  22  2TYSTLRTECSGAACIITLNRPEKRNAVSIRMMDEIISAAKQAEDPSVRAVILTGTDSFFSAGADLNEVLQV-KTPVEGLAYFERWHRLNSTLEDLGKPVIAAIEGFCMTGGLELALACDLRVAGEGSKFAITSSKIGTVAGGGTQRLPRLVGSANALDMLFSADPIDASEAYRIGLINRLVPKGQALAERMVRVYEQRAPLSLKLIKRAVHGVKMDLASALELETSIVTLIYGTEDKQEGVSAFLEKRKF 257
60 0.000e+00UniRef50_A0A060LYH2 Enoyl-CoA hydratase n=6 Tax=Bacillales TaxID=1385 RepID=A0A060LYH2_9BACI  ali  22  2..EHVMWQVEEGVAIVTLTRPPA-NALSRGVMAELNEVFENVKDNEIKAVVFHGEGRFFAAGADIKEFTEVKNE-QEFAQLGQIGQETFTKIEQSPKPVIAAIHGAALGGGLELALACHIRLAAKGTKLGLPELNLGLIPGGGTQRLPKLIGKAKAIELMLTSEPMTAEEGYLVGLINHVLPEEDVLARSMATVIAGKSPLTVQKTLELVEFSDSKLEVGLEKERAAFGDVFKQEDRHEGVQAFLEKRK. 250
61 0.000e+00UniRef50_A0A0Q6IGE4 Enoyl-CoA hydratase n=26 Tax=Firmicutes TaxID=1239 RepID=A0A0Q6IGE4_9BACI  ali  20  4.WETIILEKSDGVYIITLDRPDSMNALNTQMGNDLIECLKMLKQSDCRVLLLTGSGKAFCVGADLKERNGMTKEDWKNQHDI--FEEVTLLIREFPFPVLALLNGYALGGGFEIALSCDMRIAASNVKLGFPEVKIGILPGGGTQLLTRLVPTGLAKELLFSGKQISASEAEKIGLINKVISTDNNLEEALVKNIAKNAPISLQQIKMAVNGSQVDLTTALKIELQAYYKCADSEDRLEGIQAFNDKRE. 258
62 0.000e+00UniRef50_S8AH14 ATP-dependent DNA helicase n=1 Tax=Dactylellina haptotyla (strain CBS 200.50) TaxID=1284197 RepID=S8AH14_DACHA  ali  21  813.YENILLERADGVGQITLNRPKALNALSTPLFKELNDALQKLEDPSVRAILIAGSERAFAAGADIKEMKDLTFSKAYSSNF---IQPWSTTITNLNKPTIAAVSGYALGGGCELAMMADIMYCTADAKFGQPEIKLGVIPGGGSQRLTRAVGKSKAMEIILTGKTFSGKEAEIWGLASRTFTGDELMATDTAITIASYSMLAIKAAKEVVNSQELALSEGVKYERRVFHALFGSQDQKIGMDAFANK... 1062
63 0.000e+00UniRef50_A0A075FRI7 Enoyl-CoA hydratase/isomerase (Crt) n=7 Tax=cellular organisms TaxID=131567 RepID=A0A075FRI7_9ARCH  ali  22  5..ELVKVRIEDSIGIVTVDNPPV-NALNSSVLEQLDKVIDDVSDKEIVGIVLTGGGNAFCAGADIKSFAQLTDPND-VLAVIELGQKVFKKLSGVGKPVVAAINGAAYGGGNELALACDIRISSDRARFSQPEVNLGLIPAGGTQRLSRLVGVSKAKELIFTGQFVTAQEAYRIGMVNKVVPDGEELASDIVRQIASRAPLAIKAAKEIINAGESTLEEGLDLEVEAMKELVKTEDIQEGIKGFTEKRKF 260
64 0.000e+00UniRef50_A0A0W8E4P4 Enoyl-coa hydratase n=1 Tax=hydrocarbon metagenome TaxID=938273 RepID=A0A0W8E4P4_9ZZZZ  ali  21  3.WETLSFEKRDRIAILTLNKPETLNALTFKMGEEFAKVIDHLKDQEVRVLIITGQGHSFCSGGDLKDMYNDPPAQAQQNAF--NFYQGFLSIRSLDIPTIAVIRGHTIGAGLCLAMACDMIIASTDTKLSMSFIKVGINPGGGTYLLPRLIGTAKAMEMCLLGEAIDAQEACRIGLINHVVDHEQLMEFSLAGRIANNPPIPARFIKKSIQGLNKNLDEVLIVESFAQVTCSSTEDMKEAIAAFKEKR.. 255
65 0.000e+00UniRef50_O34893 Putative enoyl-CoA hydratase/isomerase YngF n=1106 Tax=Bacteria TaxID=2 RepID=YNGF_BACSU  ali  21  4...SILFTVKNHMALITLNRPQAANALSAEMLRNLQMIIQEIENSNIRCVILTGTGKAFCAGADLKERIKLKE--DQVLESVSLIQRTAALLDALPQPVIAAINGSALGGGLELALACDLRIATEAAVLGLPETGLAIIPGGGTQRLPRLIGRGKAKEFIYTGRRVTAHEAKEIGLVEHVTAPCDLMAEELAAAISANGPIAVRQAKFAINGLETDLATGLAIEQKAYEQTIPTKDRREGLQAFQEKRR. 254
66 0.000e+00UniRef50_A0A2E0G4C7 Enoyl-CoA hydratase n=11 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E0G4C7_9BACT  ali  20  3...YIKINNDNLVSEIIIDRSEALNAMNSDMLSELTKAMVKVKDDKTGVIIITGEGKAFIAGADIKAMQQMNAK--EAFEYGKAGQQLTMMIETSSKPVIAAVNGFALGGGCELALACHMRIVSENASFGQPEVKLGLLPGGGTQRLPKIVGVGKAIELITTGKIINAEESYRIGLANKICPQNQLMSEKLASIILKNGPKAISSSLRCIHGLILSVKEGMDIEVEEFAELFRHDERMEGLTAFIEKRE. 252
67 0.000e+00UniRef50_B3R7H1 Enoyl-CoA hydratase n=16 Tax=Proteobacteria TaxID=1224 RepID=B3R7H1_CUPTR  ali  21  4...TVLYQASEGVATLTLNRPDVLNALNADILRELREAVDRAAADEVRAVLLTGAGRGFCAGADLAARQG-GGVSDSGTLLRERYHPIIMALREMPKPVITAVNGVAAGAGMSLALAGDVVLAARSASFLQAFSKIGLIPDAGTYFLPRYAGEMRARALAILAEKIDAEEAHRIGLVWKVHEDAALQDEALARHLASMPTMAYAMIKEALNSFSNDLAAQLEVEATLQSRASRTEDCKEGVAAFVEKRK. 253
68 0.000e+00UniRef50_A0A2V9L0D0 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=3 Tax=Bacteria TaxID=2 RepID=A0A2V9L0D0_9BACT  ali  22  6....VVFAQEGPVATLTLNRPERLNALDDTIRDGLAEALSILSEPSIRVGVITGTGRGFCAGGDIHKMMELGHQSAAFRRYLEAGNELIKKIRRLPKPVLASVNGPAAGAGMNLALACDLRIASDQATFTQAFVRVGLHPDGGTFFLPRLVGIGRAIELFALGEPLSAADAHRLGVVNFLVPHPQLETRKLAERLAEAPALPLALLKQALYRLETQLDLMMEYEVGAQMKCFDSDDFTEGLRAFLEKRK. 257
69 0.000e+00UniRef50_A0A2G6AYF2 Enoyl-CoA hydratase n=8 Tax=Bacteria TaxID=2 RepID=A0A2G6AYF2_9BACL  ali  23  2..QEITYEQRDSVAYVMLNRPESMNAFNFQMLLELGQVVEGIRDPEVRAVVFLGSGRAFSVGADLKERKTLTE--AQVRRNLNKIGDVFTMIDQLPQPTIAAINGFAFGGGMELALACDFRIAADSAVMGLTETGLAIIPGGGTQRLPRLIGEAKAMELILTARRIAADEALRIGLVTQTVPLASLEDTKFLDSLLANGPVAVQQAKFAIQGMMADLQTGLAIERKAYEMTLPTEDRVEALIAFSEKRK. 252
70 0.000e+00UniRef50_A0A1Q7ZEZ2 Enoyl-CoA hydratase n=3 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7ZEZ2_9BACT  ali  22  3......LSTAEGIAVVTLSRPEARNAINLEVVNELHIALEALRDGSTRVLILTGAGKAFASGADIRELRERRAAD----ALRGINSSLFLAVERFPLPTIAAVNGYALGGGCELALACDLRIASESSRFGQPEVGLGIIPAAGTYRLPRLVGAGRARELILTGRIIDADEALAIGLVNRVVPDDRLLEEATALLIARKGPLALRAAKLTLQASAYGPDAGHAAERLAQAILFESDDKREGMAAFLEGR.. 245
71 0.000e+00UniRef50_A0A0W1RC73 3-hydroxybutyryl-CoA dehydratase n=3 Tax=Haloferacaceae TaxID=1644056 RepID=A0A0W1RC73_9EURY  ali  23  5..EFVRVEHGDGVLTITIDRPDARNALNAQVRSELTRVFEAVEDDEVRVVVLTGADEAFVAGADVKELRERTA--VEQHEVSKR-PRIYETVAGCSKPVVARVNGHALGGGCELAQACDVRLAREDAKLGQPEINLGLIPGGGTQRLTRLVGPGQARKLVLSGELIDGAEAAEIGLVEEAHPADDLDERELAGKMASKSPLAVARAKEALRAARMDLDSGLAYESELFVGLFDSHDKNEGIDAFFENR.. 257
72 0.000e+00UniRef50_A0A117SHD9 Uncharacterized protein n=1 Tax=Desulfosporosinus sp. BRH_c37 TaxID=1734396 RepID=A0A117SHD9_9FIRM  ali  21  2SYQRWLIHKTNGIVTLTLNRPEVRNALDNLSWQELGAIVSDIKDAQIKVVIITGAGESFAAGADVEWLLNRPTIE----SWDPGVQGVLNSLENLPQPTIAAINGYAFGGGCELVLACDLRIASQNARFGLTE----------TQRLPRLIGAGRAKEMIFLGKLVDASEAECIGLVNRVCPLTELVANELAHKLLNRAPLAVRMAKQAINGLQTDLITGMAYEKACQSFLYTTEDQREGMIAFLEKRK. 252
73 0.000e+00UniRef50_A0A226MBF5 Uncharacterized protein n=6 Tax=Amniota TaxID=32524 RepID=A0A226MBF5_CALSU  ali  23  110..........GSVGLVRLQRPEALNALCEGLMAEMRRALDTFEADGVGAIVITGSEKAFAAGADIKEMQNKTFQECYGGGFLAG----WDCIATIRKPTIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGGGTQRLTRAVGKSLAMEMVLTGERISAAEAKAAGLVSKVFPTDKLLDAAIAEKIAANSKLVAAMAKESVNAAETTLTEGNRTEKRLFYATFATNDRKEGMTAFVEKRK. 374
74 0.000e+00UniRef50_A0A1X4XVG8 3-hydroxybutyryl-CoA dehydratase n=1 Tax=Desulfurella amilsii TaxID=1562698 RepID=A0A1X4XVG8_9DELT  ali  18  2...NVLFESKNGTGYLTINRPDKLNALNIDTINELKETFLKVEDKTIKCVIVTGSGKAFVAGADIEYMQKLTPN--EALKFARLGQETLHLMEVSNKPYIACVNGYALGGGFEVALSCDIIFAQVNAKFGFPEVSLGILPGGGTQNLSRLAGKLIAKELIFSAKMIDAAKAKELGIVNEIYTREELLAKELAVQIQKNAPLAVGFAKRAIDGFGLSKEDGLRYEASLFGVVFSSVDAKEGLSAFVEKRK. 252
75 0.000e+00UniRef50_A0A2E5F6V4 Uncharacterized protein n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5F6V4_9CHLR  ali  19  10..KDVLYEVQDGVGIITMNRPDRLNASSTDMTESMIEILENLS-PDVRAIVLTGSGRAFCSGGDVKGMSKRLE-TDESWKQPHPEKAVSMAFWNCDRPIIAAVNGPAVGIGLSYACMCDFRIASESAQFGAFWVRRGYMPDGGTFFLPEILGTSKALELVWTGRPIAPQEALDIGLVTKVVPAEELMASELARQLSKGATLAMGMAKRGMYKSRIGLEAALEFESYGQAMLRQTADHAEGVKAFIEKR.. 257
76 0.000e+00UniRef50_A0A0M8K8C9 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=7 Tax=Bacteria TaxID=2 RepID=A0A0M8K8C9_9CHLR  ali  19  3..EKLLVHREGHITTLTINRPEIRNAVDPETMIAIREAVEACEDDGTRVIVLTGAGGAFSSGADIKAALSMGTPDKAYQALTEAYAPAIQAIHRSRCPVIAAVDGIAAGIGLDLALVCDLRLASERAAFAELFINVGLVPDGGTYTLPRLVGMGRALELIFTGERIDAHRAYEIGLVNRVYPTDTFAVHAFAAMLAEKSPLALARAKRAVRSLNATLEEAMAREAQFQYEIFNSEDGFEGFIAFLEKRK. 254
77 0.000e+00UniRef50_X0S7C6 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0S7C6_9ZZZZ  ali  21  9..ETLLVTEEDGLATITLNRPQAMNTINDTMASEIRHIMDTLSDDRIRAILLRATGRAFCAGYEISWQHDLSEFLFVVKERVADMNDVYLAILNMEKPVIGAVNGVATGGGFALVLSCDIVIASDAARFSVVYARRGLVPDGINYLLPRTVGLRKAKELIFTADMIDAKEAERIGLVNRVVPADSLDEEALAKRLASGATRAIGLSKSIIRGLGTDLASTMELESWGQALCIQSKDFQEGVNAFLEKRQ. 262
78 0.000e+00UniRef50_UPI0008344937 hypothetical protein n=1 Tax=Oceanobacillus damuensis TaxID=937928 RepID=UPI0008344937  ali  23  3..ENLLVEIQGSVGIITINKEEQRNSLNIETLNNLKNVLQSFSDKEVRAVIITGSGKVFAAGADLKEAIKLTKEDR--KTQTELGHEVFQMIENFRAPVIAAVNGHALGGGCELALACDIRIVEERAKIGLVEVGIGTIPGGGTQRLSKIVGLGNAKEMILTGIPLSAQEAKEVGLANKVAESGTVLALELAEKISKNSPYAVQVAKSLVNQSSLTLPTGIELEKKASDLIFISHDRTEGIKSFLEKRK. 253
79 0.000e+00UniRef50_G2SKB6 Enoyl-CoA hydratase n=15 Tax=Bacteria TaxID=2 RepID=G2SKB6_RHOMR  ali  21  6TFATLQVEADDGIVCCTFNRPEVRNALNLEMVQEVRRLLEQAARDEVRALIFTGAGGAFVSGADIAELRERG----RAEALQRINNSLFREIEQFPVPTIAAVRGWALGGGCELAMACDLRVAGESARFGQPEVRLGIIPGAGTYRLPRLVGMGRARELIFTGRILDASEALAIGLVNYVVPDDQVLARALAAEIAEGSPLAVRFAKMALNAAEMSTDAALTLETLMQAVLFEDEEKYRRMTAFLERRR. 257
80 0.000e+00UniRef50_A0A2H9SRZ0 3-hydroxybutyryl-CoA dehydrogenase n=2 Tax=root TaxID=1 RepID=A0A2H9SRZ0_9BACT  ali  20  4....INFQKNGQIGILTINRPKSLNALNRSTLNELLTCLAQACNEKLRALILTGEGKAFIAGADIKEMQQMGHL--EMQEFCELGQSVTLALERAPFLTIAAVNGYALGGGLEMALACDFIYASDSSKMGLPEVTLGIIPGGGTQRLLRAVGTRQAKELILTGKIMTAQKALEIGLVNKICPPATLLKDEVAQTVAENPSLAVKQAKKALNGSEMGLLEGLELEKNMCAVCFATPEREEKMTAFANKNK. 251
81 0.000e+00UniRef50_A0A0M9ECI5 Enoyl-CoA hydratase n=2 Tax=Bacteria TaxID=2 RepID=A0A0M9ECI5_9DELT  ali  17  5NYEDIRLDVTNNIAVLTLNRPDIRNAFTQQIINDICQALDEINEPDIHVLIITGADPSFSAGGNIKDMAGMFSGTPEQDNYKNFIQKIPLAFHRLDVPTIAAVNGPAIGAGCDLALMCDMRVASKRAKFAESFINVGLIPDGGAYFLQRIVGLPKALELTMTGDIVDANEALNLGMVNRVVPHEKLMEETLAQKLADKPKSALRMSKRLIYAQDMSLEQVLEQSATYQALCHQTDEHKDAVKGFLEK... 262
82 0.000e+00UniRef50_A0A2V8BSV3 Uncharacterized protein (Fragment) n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8BSV3_9BACT  ali  19  2...TVRFEVEDGIGTITLNRPDKLNALSNELSRDLLDVLTRAADDEVRGVMITGAGRAFSAGGDLDGMQRHVDSGDAISDLLQTGARVVSLLNAMAKPSVAVINGPAVGAGGSLALACDVRIASPSASFGLVFSRLGLHPDGGTYFLPRLVGTGKALELILSGDIIDASEALRLGIFSRVVPADQLNATALVKTFAAKSSLALMLARKAVDSVNMSLKDVLDLEVANQMQCFHSPDAKERITGFRERRR. 254
83 0.000e+00UniRef50_A0A0U5MI44 Enoyl-CoA hydratase-isomerase n=605 Tax=root TaxID=1 RepID=A0A0U5MI44_9PROT  ali  25  4....VLLEKPDSVALLRINRPEAKNALNGEVRRQLAGHLTELADPAIRAIVMTGNQEAFAAGADIKDMAEVGAIEL----MQRNNHLLWRAIASCPKPVIAAVNGYAWGGGCELVMHADIIVAGENASFSQPEVKVGIMPAGGTQRLTRAVGKFKAMLMVMTGQAISGVEAGQMGLASLVVPDSEVLDKALAKTISRMPPVAIAQIKELLAGQDASLDTALMLERKAFQLLFASADQKEGMKAFIEKRK. 250
84 0.000e+00UniRef50_A0A2E7TZ73 Crotonase n=5 Tax=Bacteria TaxID=2 RepID=A0A2E7TZ73_9BACT  ali  23  7....LLHDRNGHVAIITLNRPEKLNALNAELRDALLSKLDELEDDEVRAVVIHGAGKAFVAGADISEFAARSP---EQQREAVFGRRIYEGVADFKKPIIAAIHGFCIGGGCELALACDVRVADQTARMSQAEIRIGLIPGGGTQRLARLVGRGWTTIMSLTGDFVEAEDAHHIGLIDVLVEEGQHLALELATKMTRWSPVALRLAKDAIRAFEMPLAEGLEYEKNRFIDAFKSEDGREGVLAFVEKRK. 254
85 0.000e+00UniRef50_UPI000824EA3D hypothetical protein n=1 Tax=Bacillus novalis TaxID=220687 RepID=UPI000824EA3D  ali  20  4.FEVIQQER---IVKLILNRPPV-NALSLEVLEELRMHLEKVNNKENRVLIITSCGKFFAAGADIKGLKNVS--VEEGKVINQQFLHTFDQLAKLPIPTICAVNGLALGGGTELALACDIRIASENAQLGLPETNLGLIPGGGTQRMPRIVSIGRAKDLLFTGRRVSAQEALEIGLVEYVVPYHELSDERLAKTISEKSPNAIRTIKQAISGMNTDLPTGLEIELELGSHCFGSEDFQKGISAFLEKRK. 251
86 0.000e+00UniRef50_A0A0D8CS32 Enoyl-CoA hydratase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A0D8CS32_9GAMM  ali  22  5TFENVRVEITGKVALLTLNRDQALNALNSALMQELIAKMQQLENSDIGCFVITGNSRVFCAGADIKEMQSKSCQQMLAEDYFSP----WERFTAIKTPKIAAVCGYALGGGCELAMMCDLIYAGESAVFAQPEINLGVIPGGGTQRLTRSIGKAKAMDLILTGRYMAASEAEQSGLVARVFTDETLLEEALAQSISEKGRLSVALAKEAIQSMELPLTQGLLFERRVFHSLFASEAQQEGMAAFIEKRR. 257
87 0.000e+00UniRef50_A0A1V5L3C7 Putative enoyl-CoA hydratase n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1V5L3C7_9FIRM  ali  22  3....VHLEFREKTAVLRFDNPPA-NSLNAEILVEFQSKLKELAADETRVVVITGTGKFFIAGADISRFLELDSKG--GYEIARQGQVIFEELSSLPCATIAAINGYALGGGLELALACDIRLASANALLGQPEINLGLIPGGGTQRLTRLIGPGKAKELIYTGKNVSAEEALRIGIINQVVTEGELLDEALAESIAGKPPLALRAAKKAMQGLEKTLVMGIEAEAKHFGDLFSTEDQKEGARAFLEKRK. 253
88 0.000e+00UniRef50_A3K7Y3 Enoyl-CoA hydratase n=19 Tax=Proteobacteria TaxID=1224 RepID=A3K7Y3_9RHOB  ali  26  8.......EMAPGVGLLTLNRPDVRNALSFELRQQLIDALADARNETIRCVVLTGGPDVFAAGADLKQLSRMGPIDMLEASPERY----WQAISAFPKPLIAAVNGLALGGGFELVMHADIIVAGQSATFGLPEVKLGLLPGGGTQRLPRAIGKSPAMRFLLTGDPIPAPLAAELGLLSDVVPDDQVLAREIASKIARRPPLAVRMIKQCVNGADLPLDAGLEIERKSLQLLLASEDKAEGIAAFIEKRQ. 250
89 0.000e+00UniRef50_A0A2V7UMM4 Enoyl-CoA hydratase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7UMM4_9BACT  ali  23  2...NIGFTVQDRIATLTIDRPDVRNALDESTAAEIERALGNAEESEVLLVVFTGGGKVFVSGADLKDLHHRRSKQV----LEACLNRLFARIDSFPKPTIASMNGHAMGGGLELALACDFRIAVSGAKLGFPEVGLGILPGGGTQRLPRLVGLGRAKEMILTADPVDAEQALAFGLVNRVVPREDLATRELAEKLASRAPVALRLAKAALNSARVPVDSGLAFEVLSQTVLFETKDKKEGIAAFLEKRQ. 249
90 0.000e+00UniRef50_A0A1V4S0I5 Enoyl-CoA hydratase n=1 Tax=Desulfobacteraceae bacterium 4484_190.1 TaxID=1956167 RepID=A0A1V4S0I5_9DELT  ali  16  7.....LYEKKGYIAIITLNRPESKNSFSDEMLALWKQYLDSRADDNVRVIVVTGKGDTFCSGGNIRDMAEGKIQSWDMKRFLDGVHRIVLTLEDLDKPVIAAINGAAMGAGMDMSIMCDLRVCSDRAKFAESYINMGLVPDGGAWFLPRIVGTSKALELFMTGNIITPEEALNLRIVNRVVPHERLMEEKLAEQISNKPPLAIRMTKRAVYQSEASLRSHLDYISSQLSLLSETKDHLEAASAFLERRK. 256
91 0.000e+00UniRef50_UPI00042A7319 hypothetical protein n=1 Tax=Ruminococcus gauvreauii TaxID=438033 RepID=UPI00042A7319  ali  17  2..EYALIEQQGHVCTITINFPKKLNAVSTAVLTDLGEAFDQVEKKDVYCVIVKGAGKAFVGGADIKEMSEFGFY--EARDYAKFGGAVLEKIHQFRVPVIAAINGYCLGGGVEVALACDMRIAAENAKFAFPEVSLGIMTGGGSQRLQAIVGEGRARELLLTCDRIDAEEAYRIGLVNKVVPTEKLMEEAMAEKVAKNGPIAVATMKKAINASETDYPTSTEHMILSFGSLFTTQDAHDALSAFVNKEK. 252
92 0.000e+00UniRef50_A0A0F2PVF0 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4b TaxID=1629717 RepID=A0A0F2PVF0_9FIRM  ali  23  3.YKTIICEEHGKVVVVKLNLPESLNAISKDLTEDLDNVLNALEKDAVAALVITGAGRAFCAGANLNEILHLEGVTAFYN-MLKKVQLVINRVADYSKPVVAAVNGPALGGGLELCTACDICVASDNSVFGLPEINVGVLPGGGMTRLSRMVGPHRARQLVMTGDKISAGQAKEMGLVWQVAPPEKLTALELAARLAEKPPLAIQAAKRVINSSGIDLTTAMDYEAGSVAMLFGTRDCREGLQAFVEKRQ. 254
93 0.000e+00UniRef50_A0A1G1EF15 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1G1EF15_9BACT  ali  20  3.FKNIIYEKRGPGAWIYLNRPELMNPLNLEIIQEIGQAWDDLERDSIKALVITGKGKAFSAGADLKQLMEGGGDPRIFAEYGRTWERVFNGIENSRVPVIGAINGLCLAGGLELALVCDILIASEEARIGDQHTNFGLIAGGGTQRLPRKIGINRAKELILTGDWITPQKAMEWGLVNMVVPADKLAATEMVNKIVSKSSEASRIAKLLVNGMQMNIHEALKLEQWAIGLHYKGEDVREGLTAFKERRK. 258
94 0.000e+00UniRef50_A0A2H5ZAA9 Short-chain-enoyl-CoA hydratase n=19 Tax=Bacteria TaxID=2 RepID=A0A2H5ZAA9_9BACT  ali  19  6...TVLYEVSDFIATVTLNRPEVMNALNRQAYAELEAAFRRAHDPDVRCVILTGAGRAFCSGDDVREIMARDETVTRLREVRPRPTPAAAAVLECDKPVIAAVNGAAVGWGMDLALLCDIRIASTAARFGELFIKRGLVADGGLWRLPLVVGPSKAAELLFTGEIIDAAEAERIGLVSKVVPPEQLMEEALARKIAANPPIAMRYMKEGLRRSRHAMDEMGEFIGNALAYLFTTEDHKEGARAFVEKRE. 259
95 0.000e+00UniRef50_A0A285U887 Enoyl-CoA hydratase n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A285U887_9BACI  ali  22  2..EFLTWKIEEKVAVVTINRPPA-NALSRQLILEVNEMLNAFEDESVRVILIHGEGRFFSAGADIKEFTEVT-SGEEFSKLAAQGQEVFERLESFPKPIIASIHGAALGGGLELAMSCHIRYVAEDAKLGLPELSLGLIPGAGSQRLPRYVGTAKAAEMLFTSEPITGSEAVQYGLANKAFQNEELLQKELAKKIAEKSPIALKAAIQMLQSKDASYYEGVKAEAESFGTVFVSEDAKEGIQAFIEKRK. 251
96 0.000e+00UniRef50_UPI000786373A enoyl-CoA hydratase n=3 Tax=Bacteria TaxID=2 RepID=UPI000786373A  ali  21  2...SVTLEVRDFIATVTLNRPEAMNAIDPESAAQLHEAWNEISRKDVRVGILTGAGRAFCTGADLKKTMPPAESFAELHFGSRAGLPPVSTLQT-PKPMIAAINGFALGGGLEMAMLCDIRIAASTAVFGLPEVCIGSIPGGGTQRLVRAVGQSDAMLLLLTGERIDAQEALRIGLVSRVVPDLALAARSIAQRIASNAPLAVVTAKRLAQGRELPLTAGLELEQQSFGNLRDSDDRIEGRRAFAEKR.. 251
97 0.000e+00UniRef50_A0A2G6AZB9 Enoyl-CoA hydratase n=5 Tax=Sporosarcina TaxID=1569 RepID=A0A2G6AZB9_9BACL  ali  20  6.YEAISVHVENGVCTVTLNRPEIKNALVQEMRDELMEFFSVVSDDDVKTIVLTGKESVFSAGGDLKALQNL--NSTQVRNRLKTSQGLIRSILNLEKPVIAVVNGVATGAGFSLAVACDIIYAAKSAVFIQGFIKIGVVPDMGSYFLPRLIGRHRAMEMMLLGEKVQAEQMQKLGVVNAVHEDDSVLDEALARKLAASPRLAMGLTKRLTNSSVLDIEDTFELEAFAQGMCFESDDFKEGVQSFFEKRK. 256
98 0.000e+00UniRef50_A0A2V6ZVG0 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=6 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6ZVG0_9BAC  ali  23  5...SVLYQRHDSIVTLTLNRPETLNAMNEAMMGEMERVLIELEADAVRAVVLTGAGRAFSSGGDQKRSGESPPEGDLGGALIERLNRCILRMQRLQKPIVGSINGVAAGAGLNIALATDLRIAADTARFGEVFARVGLVPDGGTYFLPRLVGTAKAMEMILLADIIDAPEALRIGLVNRVVPAEQLAQEKLAERLALGPTVAYGLAKTLYQGLGMSLEDVLNMEARNQAIAARTPDRAEGVAAFREKR.. 257
99 0.000e+00UniRef50_A0A158RPX4 3-hydroxybutyryl-CoA dehydratase n=161 Tax=Bacteria TaxID=2 RepID=A0A158RPX4_BACC3  ali  19  7....VTWSKENGIATIIIDNPP-MNVLDSAVVEQLTVAVDTIEDDEVIVVLLTGAGKTFVAGGDIKSFPEWIGKGSEAEEKSLWLQNPLNKIERLPKPVIAAINGLALGGGCELALSCDIRIIEEHAQIGLPEVKLGLFPGGGTQRLPRLIGTASAKEMMFTGEPLTAEAAWRVGLVNHIVPRGESLAKELAAKMARFSLPALSLMKQSIDGLSSSLEEGLKIEAENFGHVFQTSDVREGVEAFIEKR.. 256
100 0.000e+00UniRef50_A0A0M2HQ01 Putative enoyl-CoA hydratase echA8 n=126 Tax=cellular organisms TaxID=131567 RepID=A0A0M2HQ01_9MICO  ali  23  11.YETILVEQRGRVGWITLNRPEALNALNSRVAEEVTAAAVAFDDEGVGAIVVTGSEKAFAAGADIKEMESMSAAEMIATDHF----GIWRDFASVRTPVIAAVSGFALGGGCELAMMCDIILAADTAKFGQPEINLGVIPGGGTQRLIRAVGYYKAAELVLSGRFMGAEEAERSGLVSRVVPASDLLAEALATTIASKSPSVYAAKAALDAAMETTLSEGLAHEKQAFAALFDTADQKEGMAAFREKR.. 258
101 0.000e+00UniRef50_UPI000D366DBE enoyl-CoA hydratase n=1 Tax=Limnohabitans sp. MMS-10A-178 TaxID=1835767 RepID=UPI000D366DBE  ali  21  8TFETIKQELRGRVAILTLNRPEAMNAINMKMRSELRTALDDLRRDSVGAVILTGAGKAFSAGMDLREFSAMNANIPIA-EMKRYRWEQGEGIAAFDKPIIAAVNGLAIGGGVELTLLCDFAFAADQSSFAFGEVKRGLIPGGGTQRLSRRIGTARALDMILTGRTVSASEALSIGLVQYVVPQNELIEQALAEMMAANAPVAVRSAKAAIRGADLALADGLRLEQDMAAFLYTTEDSKEGPQAFLEKR.. 260
102 0.000e+00UniRef50_D3HQR8 Enoyl-CoA hydratase-isomerase n=44 Tax=root TaxID=1 RepID=D3HQR8_LEGLN  ali  18  4....IEHELDNGILTLTLNRPEKLNALSSEVLDALAESFGDARNSKVKALMITGNGKAFCAGADINRLAECTAQT--GYEFACRGQEVFKLLETLGKPSLAAVNGFAFGGGCELAISATMRIASIKAQFGQPEVKLGVIPGGGTQRLARLVGKGRALDLCLTGRFINAETAFQWGLVSEVVEPDALLEKGILQGILSMAPLAIAGVMEVIHGYDLSLDDALHLEAIHFAKVCASQDKKEGVAAFLEKRKF 255
103 0.000e+00UniRef50_A0A2H5ZLM0 1,2-epoxyphenylacetyl-CoA isomerase n=77 Tax=Bacteria TaxID=2 RepID=A0A2H5ZLM0_9BACT  ali  22  3TFETVRYSVENHVAWVVLNRPEQRNAVNATMRDELIRIFTDAQNGEIRAVVLTGAGKGFCTGADLSGPRGQTPQGPGATRLVMKGQRLIRALWELEKPVVCAVNGVAAGLGAHLAFAADFVIASSEARFIEVFVRRGLVDAGGAFLLPRLIGLQRAKELVFLGDDLSAEQAQQWGLVTRVVPPDQLEARQWAERLAQGPTLALGFSKRLLRSLDCDLETCLEEEGLAQAIVAQSEDVREGVQAFLERR.. 257
104 0.000e+00UniRef50_A0A0Q3RS94 Enoyl-CoA hydratase n=11 Tax=Firmicutes TaxID=1239 RepID=A0A0Q3RS94_9BACI  ali  19  4..QHLLVEVKARILTLTLNRPESLNSFSYEMLNSMTEALNQANNPEIKAIVLKGAGRSFSAGGDVKTMGNVTPN--AVYEHIGILNTVIKTIREIEKPVIASVHGFAAGAGFNLALACDLIIAADDSKFALSFSQVGLISDGGSYFLPRLIGPYLAKQFFFTAEPVPAERLYQLGMINTLVPPENLAVEKFANKIAAGPGKANGMMKKLINSFTSTLDEMLELERITQPLMVATEDHQEGVAAFKEKRK. 253
105 0.000e+00UniRef50_A0A1F8MZP6 Uncharacterized protein n=3 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8MZP6_9CHLR  ali  21  3.YKDIILEKKDHIATLTINRPEKMNAMSLETREEVIAALTEVQDDGVRVLILTGAGRAFCAGVDVSVMSSAIAGQAPVPTRRQITYRMVSLFRKLRVPTIAAINGVAAGMGVSFIAACDIRIASEKARFACSWVNRGLVPDGASTFLPQIIGIEKSLELFYTGDIINADEALRIGLVGRVVPHGDLMATALAEKIGAGPPIPIEMAKYGVYGLESDIEGALDYENYAVKVCTGTEDYKEGVTAFMEKRK. 259
106 0.000e+00UniRef50_E4TP43 Enoyl-CoA hydratase/isomerase n=2 Tax=Marivirga TaxID=869806 RepID=E4TP43_MARTH  ali  21  2.HEFLKYELQDGVCTITFNRPDFYNAFNDGISYEFQDALKSAKDPEVRVVVITGEGKAFSSGQDLKSARDEDDK-MFYNSLEKRYNPIIRAMRKLPKPIIARLNGVAAGAGCSLALAADMIIAAESSKMIEVFINIGLVPDSGSFFLPNLVGYQKAFELCAMGTKITAQEAYELGIVNKVVKDEELAVKSYTDYFAKAPTKSIGMIKKMLNAATSSLDDMLEYEKYSQQIAGTSEDYKEGKQAFLEKRK. 253
107 0.000e+00UniRef50_A0A165SJI6 Putative enoyl-CoA hydratase echA8 n=16 Tax=Bacteria TaxID=2 RepID=A0A165SJI6_9RHOB  ali  21  2.YETIETSVEGRVATIRFNRPKALNALNSQVLEEVLDAATKYADPAIGCLILTGNDRAFAAGADIAELNVQDYASM----YASNFFAGWDRFAALRIPKIAAVSGYALGGGCEVAMMCDIILASDTARFGQPEVKIGCIPGGGSQRLTKLVGKARAMDLILTGRMIDAQEAYDMGLISRKIPADELMANETAKTIAGYARDITMMARACVNAADNSLENGIRFERQMYHALFGSPAQKEGMAAFLEKR.. 249
108 0.000e+00UniRef50_A0A2W1API0 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W1API0_9CHLR  ali  25  2AYEHILVEKRDGVGVITLNRPEKMNALNRRMADELLAALNEWRDDEIRAVVLTGAGRGFCAGADLSGATDTSALPDTAQRPRWPLGNWVRHLNEFPRPIIAAVNGACVGAGLGLAAACDMRVAAASARFSAIFVKRGLSLDFGTYFLPRLIGQGRALEIACTGRMVGAEEAERIGLANRVVPDEQVLDEALAQDVAEAGPLAVEFSKKAVASLGNDLERQLFFESYAQEVCRYSEDAKEGIQAFLEKR.. 263
109 0.000e+00UniRef50_A0A1F7N1K5 Uncharacterized protein n=4 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1F7N1K5_9BACT  ali  21  3.YQTLLVDRSEAIATLTLNRPEARNALDLVMRRELLGALDELEDPAVRVVILTGAGGHFCAGGDVKSMRTR-HTAAEGRARVESLNRLVLRLVDFPRPTLAMVDGYAVGAGSNLALCCDIIVASDRAKLGELFCKVGLVDGGGSWLLPRVVGMARAKELILTGDVIDAAEAARIGLVNRVVPAAELATRALAQRIAANPPLALRLDKHMLNRAASDLAAALDLEAYSQALALTSEDHAEGVAAFLEKR.. 253
110 0.000e+00UniRef50_C8V3K8 Enoyl-CoA hydratase (Eurofung) n=324 Tax=cellular organisms TaxID=131567 RepID=C8V3K8_EMENI  ali  21  30SYEHILTSTKPGVGLITLNRPKALNALSSPLFKEVNDALSKYESKDIGAIIITGSEKAFAAGADIKEMAPLTFASAYSNNFIAPWSHLANSIR---KPVIAAVSGFALGGGCELALMCDIIYCTASATFGQPEIKLGVIPGGGSQRLTAAVGKSKAMELILTGKNFSGKEAGEWGVAAKVVDKEELLEEAVAETIAGYSRVATVAAKEVVNSQDLGVREGVEYERRLFHGLFGSQDQKIGMTAFAEKKK. 283
111 0.000e+00UniRef50_A0A2A4V597 Enoyl-CoA hydratase n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A2A4V597_9PROT  ali  22  17..........DGIATVTIDRPKKYNALNLKVKRLLETAFVSLADPAVKVIIITGSEGVFVAGTDIAEMMDMASDD----HHREESGKIFQILRSCPKPVIAAVEKYALGGGMELALACDIIIAGENTRFAQPEIRVGIMPGGGTQVLLRTIGKYRTMRMILTGEQISAREAFEWGVVSEVVESSQALAEKMATLIAAMPPLAIKAIKTVVEGLNIGQSEALKLERQAFTSLFDSQDQREGMKAFLEKRK. 256
112 0.000e+00UniRef50_A0A136Q022 Putative 3-hydroxybutyryl-CoA dehydratase n=1 Tax=Christensenella minuta TaxID=626937 RepID=A0A136Q022_9FIRM  ali  19  5...TIIYEKRDAFAYITFNRPKVLNAINREMLDDLARITDDLRRDEIRAIIVTGAGKAFIAGADIAAMRDFTA--AEGREFNLYVQQQINNLENLPVPVICAINGYALGGGLELALACDIRIIAQDAKIGLPEVALGIFPGGGTQRLPRLINNGYAKYYIYTGEHIPAQRAYELGIVQEVTGSGDLRAQEIADKIAKQGPIAVRMAKRVINGANLGLRPSIVFDSEAYATTFATEDRITGMTAFLNKTK. 253
113 0.000e+00UniRef50_F9PXJ7 3-hydroxybutyryl-CoA dehydratase n=52 Tax=Bacteria TaxID=2 RepID=F9PXJ7_9STRE  ali  20  4...TVLLEVKDGIGYITINRPAALNALSSEVLTDLNLVLDEVEHEDIRVVIVSGQGKAFVAGADIKEMDQMSPI--QAFEYMTYANDTFTRLSDLTQPTIAVLNGYALGGGLELALSTDIRIGFEKTMVGFPEVGLGIIPGAGTQRMSRLIGTSKTKELIYTARIVKGNEAYDLGILNKLVPAEELLAEELAKSIMKNAPLAVEKAKHVIQGSELPLKNAIRLETEAEALLFSTEDKVEGMRAFVEKRK. 253
114 0.000e+00UniRef50_UPI00037ADBED hypothetical protein n=1 Tax=Desulfurispora thermophila TaxID=265470 RepID=UPI00037ADBED  ali  21  101SYTKLIVEKTDNYLVATINNPPA-NALGQAVLGDLNNLLDELEDPGVRAIVLTGAGKLFSGGADIKEFSTYHSGGKPKI----NGHDVFLKIERYPKPVIAALQGSAYGGGCELALACHLRYMSEKAVIALPEVKLGIIPGGGTQRLPRLIGKTRALAMMLTGDPISAADAFTYGLVNKVCPADQVLARAMAARLAKGAPLAIREILKAVAGLETTIEQGIKIERAGSDVVFASEDSKEGSRAFFEKR.. 349
115 0.000e+00UniRef50_E9DSN3 Enoyl-CoA hydratase n=19 Tax=Opisthokonta TaxID=33154 RepID=E9DSN3_METAQ  ali  22  32SFEYIQTSTKPGVGQVTLNRPKALNALCTPLIDELNEALNEFNADETSVIVLTGSERAFAAGADIKEMAPLTFSEAYTKSFIESWSLLTTQI---KKPIIAAVSGHALGGGCELAMMCDLIYCTDKANFGQPEIKLGTIPGGGSQRLTRAIGKSKAMELILTGKSFSGAEAEKWGVAARTFPTEALMEETLAETIAGYSKVAVQACKEVVNSQDLGLRDGVEFERRVFHSLFGSQDQKVGMKAFAEKTK. 284
116 0.000e+00UniRef50_A0A1D1W3P3 Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1W3P3_RAMVA  ali  23  55.YENLLVEVKGNVGFIQLHRPKKHNAISPALSKELRQALDIFEDDAIGAIVYTGGERVFTVGADISVMEGFTFPGVFKTDFSL----LWNKFHDCRKPIVAAVNGYCVGGGTETVMMCDIVYAGERAQFGQPEINIGTLPGGGTQRLIRAIGKSKAMEMIFTGDRITARQAEGWGLISKVFPSDQVEAIKLAELIASRPRMAALMAKDAVKAQEVPLRQGLRQEKYMSSAMAATNDFKEGTSAFLEKRKF 309
117 0.000e+00UniRef50_I5B2X5 Enoyl-CoA hydratase/carnithine racemase n=19 Tax=Bacteria TaxID=2 RepID=I5B2X5_9DELT  ali  23  2SFENIILEMDNAIGMIYFNRPKALNALNNALLDELDTALDQLANKEIRVLIFTGTGKAFVAGADISELTQMDALAAKY--FSRKGQKIFSKIEALPFPAIAAVNGFALGGGSEVALACDFIYASEKAIFGLPEINLGLIPGGGTQRLSRVVGRNRAKEMIFTGSNITADKALEYGMVNQVCPHESLMDEKTARRIAAKGSVSLRAAKEAIQGLGCDLETACLFENDAFAITFASPDAKEGTSAFLEKRK. 254
118 0.000e+00UniRef50_A0A1F9KAL9 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9KAL9_9DELT  ali  21  5...TVIYEVTNQIGWITLNRPDVMNAINQEMSGEIVSACRQAEDETVRIVIFKGAGKAFSSGMDLKERAQGAPVSVIERRQVKTASEATKAVATIAKPTIAAINGYAVGGGLELALACDLRIATEDSKLGLTEVRHGILPGGGTQRLARAVGIAKALEICLLGQLIDGKEAFRIGLVNQAVAREELAAERMAQTLLKGAPFSLRYIKEAIRGFDLPLEEGLRLEADLSALIGTTEDSKEGPRAFTEKR.. 258
119 0.000e+00UniRef50_B8FIU2 Enoyl-CoA hydratase/isomerase n=4 Tax=Desulfobacteraceae TaxID=213119 RepID=B8FIU2_DESAA  ali  19  4..KYVLYSTEDGIAWIRLNRPDKLNALNHVVFDEIGQAVAAAAADDDVRVVLTGSDKVFAAGADIEHMSKGTISDAF--KLTDGSFRIQESLADIPKPTIAAISGYALGGGLELALCCDFRIASETAVVGLPEINLGIIPGGGTQRLPRLINYSLAAEMVMTGGMVKAEKAERYGILNRVVPQDQLMDEKLASKLMSKSSVALRAAKTAMRGLNVSLKDGLHIEQDLFCMLFGTEDQKEGMAAFLEKRK. 253
120 0.000e+00UniRef50_G7ZH09 Enoyl-CoA hydratase involved in phenylacetate catabolism n=25 Tax=Bacteria TaxID=2 RepID=G7ZH09_AZOL4  ali  22  5..KTILLDIADGVATITLNRPDRLNSFTAAMHEELRGALAAVEDKSVRCLLLTGAGRGFCAGQDLSDRAPGQEAPDLGASIETNYNPLVRSLRELPMPVVCAVNGVAAGAGANIALACDIVLAARSASFIQAFCKIGLIPDGGTWTLPRLVGHARAMGLAMLGDKVSAEQAEAWGMIWKAVDDDKLAEEALARQLATQPTHGLALIKRALNSLDNDLDTQLDLERDLQREAGRTQDYREGVAAFVAKRKF 261
121 0.000e+00UniRef50_Q13AV7 Cyclohex-1-ene 1-carbonyl-CoA hydratase n=2 Tax=Rhodopseudomonas TaxID=1073 RepID=Q13AV7_RHOPS  ali  21  6....IIVEREGRVGIVTLNRPEVLNALNDELMDALGAALLAFADDGIGAIVIAGTARAFAAGADIAGMAEWSYSDVYSSNF---ITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPGGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLETMKLATTIASFSAPALMALKESLNAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRK. 252
122 0.000e+00UniRef50_A0A257EIJ6 Enoyl-CoA hydratase n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A257EIJ6_9BURK  ali  22  11...TLLLQRAEGVLQVSLNRPDVGNAINTRMGQELLDLWLQLSSDAVRCVVLTGAGRIFCAGGDLKERKGMTR--AQWTQQHEVFERMSWALVDLPLPVIAAINGHAYGGGLEMALCCDFMYASDNARFALPEVTLGIMPGGGTQNLPRAIGERRAKELMLTGQAFTAEQALEWGLVNQTLPADQVLDEALAQTLSRNAPLSVRQVKKSIRGGQMELRTAYRFEVEAYNQLVDTEDRHEGVLAFNEKR.. 261
123 0.000e+00UniRef50_A0A0K2G7D1 Putative enoyl-CoA hydratase n=2 Tax=Nitrospira TaxID=203693 RepID=A0A0K2G7D1_NITMO  ali  22  5.....LLTISHNVARITLHNPPA-NALNAPLLNELQQILSQVEDDDVRAVIVTGSGRFFCAGADIHELSHL-HTSHAGTEFALRGQALFNRLERCDKPVLAAINGTCVGGGLELALACHIRLAASGVQLGLPEIRLGLIPGGGTQRLPRLVGASKAAEMILTGETLSAEDALKIGLVSRVVPPQELMAEAVAALITARGRAAVEAALHAIRGLDIPLSEGLAREAELFGKLCVTADMQEAVRAFLERRQ. 251
124 0.000e+00UniRef50_A0A072NGF5 Short chain enoyl-CoA hydratase n=3 Tax=Bacteria TaxID=2 RepID=A0A072NGF5_BACAZ  ali  20  8........IEDQIAFITIDVPPV-NALNEEVLHQLSKALDDISNSEIDVVIISGAGKAFVAGADIREFPTLNKDTGE--ALCRRGQSVFTKIEGFPQPVIAAIDGFTLGGGLELALACDFRIASKSSTFGLPEVKLGILPGGGTQRLARLIGIGKAKQIIYSGEFFTAEEAFKFGLIEEITDESPLEAKEWAEKIKQRGPLAVEFAKKAINGIDLPLEEGLEWEARFFGELCETADKNEGVTAFLEKRKF 252
125 0.000e+00UniRef50_A0A2K9NUX0 Enoyl-CoA hydratase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2K9NUX0_9PROT  ali  21  6SYTTLKFELQEKFGVITINRPTKLNALNTEVLSELKELLTDLKSDDMLGLILTGEGKAFIAGADIAEMADMTPSDAY--TLGQLGQQVTVLFETIQVPVIACVNGFALGGGCEMAMSCDFIYATENAVFGQPEVKLGLIPGGGTQRLAKLVGRNNAKELIFSGRNVKADEALRMGLVVRTFATKDAMAMKTLKSIAANSPFAVGIAKKVMNGIDLTIAEGLQLEKRQFSGIFSSEDMHEGTKAFVEKR.. 260
126 0.000e+00UniRef50_A0A2N1J8M4 Uncharacterized protein n=1 Tax=Malassezia vespertilionis TaxID=2020962 RepID=A0A2N1J8M4_9BASI  ali  22  622.YENIIVSTQDGVRLVQLNRPKALNALNSSLFHELNHAAKEADNESINAIVITGSDKAFAAGADIKEMRNMTYAQAYKTNFLGH----WSELTQVRKPIIAAVSGYALGGGAELAMMTDIILAAPTAVFGQPEINLGVIPGGGTQRLTRAIGKSRAMEMVLSGRNMSADEAERAGLVSRVVREGSVVDEAIAATIGKKSQVAVQAGKEGVNAAEMTLQEGVRFERRLFQSLFSTHDQKEGMGAFAEKRK. 871
127 0.000e+00UniRef50_UPI00040C5166 hypothetical protein n=1 Tax=Desulfatiglans anilini TaxID=90728 RepID=UPI00040C5166  ali  21  2.YRNIILQKADSIATIILNRPEAMNAMNLEMFEELESAQKDIVDKDVRAVVITGKGKAFSSGADVSYLLTLT--SERFKETLRYLQRVVTMVEEMDKPVIAAINGYALGGGLDLALACDLRLAVSHAKLSEHYVKVGIIPDGGTQRLPRLIGLSKAKEMIFFGDMVDAEYAERIGLVDRVLSEDDFVAKTYAARLASGPSVAIGLAKKALHAGYEAVRSGLEHEVHGQEICMRTADVKEGISAFHAKR.. 253
128 0.000e+00UniRef50_UPI0009888587 hypothetical protein n=1 Tax=Caenibacillus caldisaponilyticus TaxID=1674942 RepID=UPI0009888587  ali  23  7.....LVETKAKVCVITINRPP-MNTLNRETLHEIGAILDRAEDDDIRAIVLTGAGRMFSAGADISEFGEWADRERAEQSL-GRMHALFNRIEAFSKPVIACLNGSALGGGNELQMACHLAIASANAELGLPEVRLGIMPGGGTQRLPRLIGRRRALELMLTGERISAQTALAYGLVNRVVPQEEVREEAWAYRLAAGAPLAMKAILGAVRGGDASLEEGLRAERENLLSVIHTEDAAEGISAFFSKR.. 253
129 0.000e+00UniRef50_A0A1H0WAM2 E-phenylitaconyl-CoA hydratase n=1 Tax=Acidovorax cattleyae TaxID=80868 RepID=A0A1H0WAM2_9BURK  ali  20  4....VEFTVDDHVATVLLNRPEALNAVDPEMRLELFAAWDRIRDPQIRVAVVTGAGKSFCTGSDLKKTLPPPETPAQQVYGDVPGAGSLIANLRTDKPLIAAINGYAMGGGLELALACDIRICSENAQFALSEVKVGSMPGGGTVRLPRYIGRSDAMLMLLTGDRVDAAEALRTGLVSRVHPQAELVEAALARKIAGNAPLSVRAVKRMVQGQDMPLDAAMDAERNAFGLLYASEDRIEGRKAFAEKR.. 253
130 0.000e+00UniRef50_A0A2E3FCM7 Enoyl-CoA hydratase n=12 Tax=cellular organisms TaxID=131567 RepID=A0A2E3FCM7_9RHOB  ali  22  5AFSTVLTQTDGPVGIVQLNRPEALNALNQQITTELGLALDAFEDESIHVIVLTGNDRAFAAGADVKEIQHKTSSDVYEEDF---ITATWERAARCRKPMIAAVAGHAVGGGCELALMCDIIIAADSARFALPETRIGVIPGGGTQRLTRIVGKAIAMDMILSGRTLSAQEALAHGLVSRISTPDSYLDDALAMNIAKSSRPILRLAKEAVNAYETPLSAGIHLERRLLYATFATEDRLEGMTAFIEKR.. 254
131 0.000e+00UniRef50_A0A1F8RWQ2 Uncharacterized protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8RWQ2_9CHLR  ali  21  2SFKNILLEKDGPIYTLTLNRPERMNAISIETVPELIQALSQVGDDDARVLVITGAGRAFSAGADVADMVRRSA--PEAAAIVRMYLDYIMAIRNLAVPVIAKVNGVAAGGGCCTAIACDLRVASEQARFGFVFVNAGLTAAGATYFLPRLVGFGRACELLLTGAVIDAQEAERIGLVNRVVPHDELATDELSRKLAAGPPIALRLTKEALHGLDKDIASEFQFETYAQTLCLVSEDHLEGAQAFREKR.. 254
132 0.000e+00UniRef50_E6W696 Enoyl-CoA hydratase/isomerase n=4 Tax=Bacteria TaxID=2 RepID=E6W696_DESIS  ali  21  3.YRHLILERDEHTALVCIHRPKALNALNAEVVMELQQALQELENSAIGAIILTGAGKAFVAGADIAAMVAMTP--AQALNFARQGQELLRRIVSMKTPVLAAVNGFALGGGLELAMACDFVYMSSTAKVGLPEVTLGIMPGGGTQRLPQLVGRNRANELIMTGRMISAREACEWGIANALCEPAELLERECARRIAANSRNAVASAKEAIRGLDMGHDDGLAYESALFAGLFAGADQREGMQAFLQKR.. 253
133 0.000e+00UniRef50_A0A1W9SDG7 Crotonase n=1 Tax=candidate division KSB1 bacterium 4572_119 TaxID=1971636 RepID=A0A1W9SDG7_9BACT  ali  19  15................WISRPKALNALNSKFFSEMDDLIISIESPEIRVMIITGEGKAFVAGADIAEMVNMDSENATL--FSRVGQNTFRSLEKLPIPVIAAVNGFALGGGCELMMGCDFRIASSSAKFGQPEVSLGLTPGAGTQRMPRQVGKANGLYMLLTGDMISAEDALRIGLVQKVVEPDRLMEEALANIIKSKGPKAVSKVKKLVHGMETDFASGSKMESEEFGSLFG-NEGAEGMKAFLEKRQ. 249
134 0.000e+00UniRef50_R5G0Y0 3-hydroxybutyryl-CoA dehydratase n=4 Tax=Bacteria TaxID=2 RepID=R5G0Y0_9PORP  ali  22  1..............................MLEELGDALNHLA-PSTRVLIITGAGRSFVAGADISEMSQFTP--EEALTFGQRGAKVFRQLELLPIPVIAAVNGFALGGGCELAMACDFRIVSEKAKFGQPEVGLGIPPGSGTQRLPRLVGAGEASELIFTARIIPADEALRIGLVNRVVAPEELLVQAIAEEIAAKSPHAIALSKMAIRGLQADIDTAIAIENHLFSNAFASPEQKEGMSAFLEKRKF 223
135 0.000e+00UniRef50_A0A225MFS5 Enoyl-CoA hydratase n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A225MFS5_9BURK  ali  19  3...SVEITVEDHIATIVLNRPEALNAVDPDMRVLLHSAWDRIRDDDIWVAIVTGSGRSFCTGSDLKKTLPSGETAGQQLLGAHASAGSLIANLNTDKPMIAAVNGYALGGGMELALACDIRICTENAQFALPEVKVGSMPGGGSVRLPRYIGRSDAMLMLLTGARTNAAEALRIGLVSKVVPADHLLVEAIAQAIAANAPLSVRAVKRMVRGEDMPLSHAIDVERTLFALLYNSDDRIEGRKAFAEKRK. 254
136 0.000e+00UniRef50_A0A248TDV8 Enoyl-CoA hydratase n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A248TDV8_9BACI  ali  20  2..EQIQLDINDYIATIKLNRPDALNAFNYETLIELQQQVENVANPEVRVVILTGTGRAFSVGADLKERRNLT--DEEVRRNLYKMGDVFNMIAELPQPTIAAINGFAFGGGLELALCCDFRFAADVAKVGLTETGLAIIPGGGTQRLPRLIGETKAMELILTAKRLSAIEAQQYGIVNEVCNEDILLDTQFASKMLNNGPIALKQAKFAVQGMNTDLHTGLHIERKAYVVLLPTKDRVEALQAFAEKRK. 252
137 0.000e+00UniRef50_S6GLY1 Phenylacetate degradation, enoyl-CoA hydratase paaB n=2 Tax=Bacteria TaxID=2 RepID=S6GLY1_9GAMM  ali  23  2.YNTIQYEVNKSIACITLNRPDKLNSFNVEMHTELAQAMLQVEDNQVRCVIITGAGRGFCAGQDLSDRAEVSNPVDLGASVEKFYNPLIRRISQLDKPVICALNGVAAGAGASIALACDFVIASDKASFILAFCAVGLVPDSGSWHMIRSLGLARTKALAMLGNKLSAQKALEWGLIWQVVEPQQLLQEALAQQLADKPPLAVAATKHLINSFDKVMHQQLEEERLLMQKLGRSYDYKEGVSAFMEKR.. 258
138 0.000e+00UniRef50_A0A2N1TQD1 Uncharacterized protein n=1 Tax=Spirochaetae bacterium HGW-Spirochaetae-1 TaxID=2013832 RepID=A0A2N1TQD1_9SPIR  ali  21  2NYSNIILREEDRLAFIELNRPDKLNALSWELVMELDQCLTYVRSRDLGALIISGRGENFAAGADIADMVERTPQESIKYTF----NRVFNELEDIPFPVIAAVRGYALGGGLELALACDFRFCSGDARLGLPEIKLGIFPGGGTQRLPRLVGLSRAKEMIFTGQYITAEKAREYGLCDYVTAGDPVIAEAFARQLLERPPIALSCAKKVINGTGRDLPAGIAMEEEVWASLFSTEDQKEGMRAFLEKRK. 250
139 0.000e+00UniRef50_A0A2H5ZAQ7 2,3-dehydroadipyl-CoA hydratase n=6 Tax=Bacteria TaxID=2 RepID=A0A2H5ZAQ7_9BACT  ali  19  2SEEHLLATREGHVLILTMNRPDRLNAISGPMLAALSRELQQANDPDVRVVVLTGAGRGFCSGLDLKDFGGLGVGGDGAYRLFDLQNSPPVVLHRMDKPVIAAINGPAAGYGMDLALGCDIRIAAESAKLGAVFVRRGVLPSGGCWYLPRLIGWARAAEVAFLGEVLDAQRALELGLVNRVVPDDRLMDEALARRIASNAPLSVQATKRMMRGLDETFEATVDHTYLQLLPLFRTKDFEEGVRAFAERRE. 255
140 0.000e+00UniRef50_A0A2G5WI40 Enoyl-CoA hydratase n=6 Tax=Bacillales TaxID=1385 RepID=A0A2G5WI40_9BACL  ali  21  2NYKKILVEKTGKLAYIIINSPEQRNALSNETLNEIRDALEKLKDNDAECIIFTGNGESFAAGADISQLKNRMPLDILEN---GSMQNLYDFIEAYDKPTIAMINGYALGGGCELAMACDIRIASENAKFGLPELNLGVIPGGGTQRMARLIGKGRAIDLILTGKIISAEEAVKIGLVSETVPLNQLAVERTASQILDKGPLAVKLAKVVIHGFDTDMKTGQLIESLAKGILFSTADKNEGATAFMEKR.. 252
141 0.000e+00UniRef50_A0A2E2XX66 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A2E2XX66_9BACT  ali  19  3.YEILNTEITDGIALVTISRPKAMNALNTKFFNEMDQLVAELSNDLVRVMVITGDGKAFVAGADIAEMVNK--NSAEGSEFSRLGQKTFSSFGKMSIPVIAAINGFALGGGLELAMGCDFRIASSKAKFGQPEVNLGLIPGAGTQRLSRLTGIGDALYLLMTADMIGAEDALRIGLVQKVFEPDVFMDEKVAKLIASKGPQAIRKLKMVVRGLEKSLYDGEKLEAKEFGTLFGGKEGREGMLAFLEKRK. 254
142 0.000e+00UniRef50_H3F653 Uncharacterized protein n=2 Tax=Pristionchus pacificus TaxID=54126 RepID=H3F653_PRIPA  ali  20  92..EMIKFELVGNVALVTLNRPKALNALCGQLMTELRDVLIQLDDKSVGAIVITGSEKAFAAGADIKEMINRPFHETFGGRFLEE----WTAISDINKPVIAAVNGFALGGGCELAMMCDIIYAGDKAQFGQPEINIGTIPGGGTQRWARTAGKSVAMEMCLTGERMGAKEAKEVGIVSKVFPAADTAAIKLGEKIAAQSPLIVQICKEAVNAYETTLREGLHVERRLFHATFATKDRKEGMTAFAEKRK. 356
143 0.000e+00UniRef50_A0A1J0LMM6 Enoyl-CoA hydratase n=128 Tax=Bacteria TaxID=2 RepID=A0A1J0LMM6_9FLAO  ali  19  4..ETILVEKKDQNAIVTINRPKALNALNAQVFLDLAKTLKELRDDTVRSVILTGSGKAFVAGADIKEFASFNDKQGSKLA-KKNQQKIFNKIENFPKPIIAAINGFALGGGLELALACHVRIASENAKLGFPETTLGLIPGGGTQRLPQLVGKGIASELIFSAEMIDADKALALGLINQKTTAEELLAEEMANRFNKNSGNAIKNAIQAINLAGTP--KGYRKEIKNFGKGFKHTDFKEGVDAFLNKRK. 252
144 0.000e+00UniRef50_A0A2E0CGE1 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E0CGE1_9BACT  ali  20  3.YNHLEFSTSDNICMLKINRQECLNALSKELIQELIIFFNWVIDDEIKAVILFGSGKAFVAGADIKEMSELEYDYKKTKSYSKLGQELTLKIEELSKPVIAAINGYALGGGCELAMACHIRYASENAKFGQPEVGLGLIAGGGTQRLPRLVGKGYAMELLLSGKMITSKEALQIKLINKVLDKEELLLEKIAKEIIKNSPIAIKKTIKAINDGESDLHDALEIEADIFADTLSNNDSKEGLTSFLNKKK. 258
145 0.000e+00UniRef50_A0A1V5CU66 Putative enoyl-CoA hydratase echA8 n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5CU66_9DELT  ali  19  5...TVLYEVKDRVGYITLNRPDHHNSINKDILDQFSTILSACKDDNCRILIITGAGKAFCAGADINMFTEVIHDALGGRDWSRYGQTIFSMLDNLGKPSIAAINGMALGGGFELALACTFRIASQKARFGFSEISLGFIPGGGIVRMTRILGKTKTAELVLTGRHIDAGEALDLGVVNSVVSPEELLSEALALKIMNNSPVAVRLALEALHAEDLSFDEALMVESNIAGLACNSEDAKEGIKAFIEKR.. 255
146 0.000e+00UniRef50_A0A1J5RI48 2,3-dehydroadipyl-CoA hydratase n=5 Tax=root TaxID=1 RepID=A0A1J5RI48_9ZZZZ  ali  24  3...TVILERIENIALVRLNRPEAKNALNTELRGLLAEHFRQLDDPSVRCIVLTGNAGVFAAGADLKEIVDADPVNMMQRRILY----FWKIIAGCPKPVIAAVNGPALGGGCELALHADIIIAGEGASFGQPEVCVGVMAGGGTQRLVRAIGKYRAMKMLLTGQLVSAKEALEMGFVSSVVADQDVLDTALAARIASMPPLAVMQTKELLAGADVSLDTGLMLERKAFELLFASRDQKEGMRAFIEKRK. 250
147 0.000e+00UniRef50_A0A0A6VSP7 Enoyl-CoA hydratase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A0A6VSP7_9MICC  ali  20  2.....LVETRGRVGIITLNRPRALNALDAATLREVVAASTALDDPGIGAIVLTGSEKAFAAGADIKEMAGRSAPEMYLADWFAG----WDAFTRVRTPVVAAVSGYALGGGCELAMMCDLLIAADTARFGQPEINLGVIPGGGSQRLARAVGKAKAMDMVLTGRHLDAAEAERAGLVSRVVPAADLLAEALAGTIAAKSLPSVLAAKEAVDAFETTLAQGVHLERRLFHALFATEDQKEGMAAFAEKRE. 246
148 0.000e+00UniRef50_B9NVR2 Enoyl-CoA hydratase protein n=14 Tax=cellular organisms TaxID=131567 RepID=B9NVR2_9RHOB  ali  20  2.FETIKTETRGRVATIRFNRPDQLNALNTQLMHEVLAAATAFDDPDIGCLILTGNDRAFAAGADISELAVQTYATMQASAFFAE----WDRFAALRLPKLAAVSGYALGGGCEVALMCDVILASEHAKFGQPEIKIGCIPGGGTQRLTRLIGRARAMDMILTGRMIDAAEALQMGLVSRVVAADTLMAHEVAETIADYASDIVDMARACVNMAEQSLDAGLRYERQMYHALYGLPAQQEGMSAFLEKRK. 250
149 0.000e+00UniRef50_A0A1E4DJ45 Enoyl-CoA hydratase n=1 Tax=Nitrospira sp. SCN 59-13 TaxID=1660252 RepID=A0A1E4DJ45_9BACT  ali  20  2....LACHRDGAVATVTIHHPPA-NTLTPELLAELSQIFETFADDAIKVVVLTGTGRFFIAGADIRVLA-SISSSQEGSSIARQGQAILNRIESLEKPVIAAINGVCLGGGLELAMCCHIRLVAEGSRLGQPEVNLGIMPGFGTQRLPRIVGQSKALELILTGDPISAQEAKSLGLVSEVVPPEDLLAQGLARKMATKSLPALRASLRSIHSADMNLLEGLALEARLFGALCETEDKREGLAAFLEKRQ. 249
150 0.000e+00UniRef50_A0A2B6LHP8 Enoyl-CoA hydratase n=3 Tax=Bacillus TaxID=55087 RepID=A0A2B6LHP8_9BACI  ali  20  4...TILTTIHNHVQTITLNRPEKKNALNKEMIDEWVAALQSAENDDVHVILLTGSGNAFCSGGDVGGMTTDPTPLNNKNKLWENIHRIPLALRDIDKPIIAAINGPAVGAGLDMALMCDIRTMIDDSKVSEGYVKVGLIPDGGAFFLPKIVGEAKALELLWTGNFIGSQEALSLGIVNHVYPQNEFMTIELAEQIANGPQIAIKMTKRAVYSRNMELEPALDLISSHYAIIKETKDHKEGVAAFKEKRK. 254
151 0.000e+00UniRef50_D7CKN4 Enoyl-CoA hydratase/isomerase n=1 Tax=Syntrophothermus lipocalidus (strain DSM 12680 / TGB-C1) TaxID=643648 RepID=D7CKN4_SYNLT  ali  20  2.YETLKLDVDGAVALVTLNNPSQMNALSHQMLAELSKLLDELENDSIGVTVFWGGERLFGAGANIKEV-SQIEKSYDAFVWSRGIQKVFNRIENSSKATMAAIGGIALGGCLELALACDLRIASRSAKVGLPEINLGVLPGGGTQRLPRLIGASKAKEMLLIGEPVPAEEAYRLGLVNRVVEDGSLLEEKMAKQIAAKAPLARAMIKSAVNGIGLDIEKGLEHEAKCFAILFNTDDLREGTKAFLEKR.. 252
152 0.000e+00UniRef50_A0A2T2YFR6 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=87 Tax=Bacteria TaxID=2 RepID=A0A2T2YFR6_9BACT  ali  23  2.YETLLLQISDGIATITLNRPEVYNAVNEKLTDELQDILKQARNNEVRVLVLTGSGKAFCSGQDLKEAAQLENRS-LSDSLHKRYNPVIRAMRELPKPIIGKLNGVAAGAGCSLILACDMIIASEAASLSQLFINIGLVPDSGSFFLPRLVGSLKAFELCTLGTKVNAHDALELGLVNQVVTAEALTVQQLAERYAAAPTKAIGLIKKMLQSGSATLNDMLDYEAYCQDIAGQSTDFREGVAAFLEKR.. 252
153 0.000e+00UniRef50_A0A1M6LT89 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=40 Tax=cellular organisms TaxID=131567 RepID=A0A1M6LT89_9FLAO  ali  20  3...SITNEINDKIAYLTLNRPEVFNSFNREMALLLQSELDAAENPEVRAIVITGNGKAFCAGQDLKEVTSPELNPGFKKILEEHYNPIISRIRKIEKPIIAAINGVAAGAGANIALACDVVIASENASFIQAFSKIGLVPDAGTFFLPRLIGFQKASALMMLGDKVSAADAEKLGMVYKVVSSENFMDENIATTMANMSTKALGLTKRLLNSLESSLEEQLALESKLQIEAAQSEDYAEGVDAFVNKRK. 253
154 0.000e+00UniRef50_A0A1V4S384 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium 4484_190.1 TaxID=1956167 RepID=A0A1V4S384_9DELT  ali  21  3.YETLLVNLDDHVAMVRMNRAESMNALEYRLRADLVDCLQTLEDDEVRVVILIGSGNAFCAGGDLRELRHKMKI-EQARKYVLHVSRVILAIQKMEKPVIAAVNGAAMGAGFSIVMACDLVVASETARFSQSFVHVGLIPDGGTYFTPRVFGLQRAKEFAFTGKILSSNEIARLGLINQIVSPEELEAIELAHQIVEGPPLALELTKKLLNQSWNPLEEMIELEAQYQAACMQSEDHMKGIRAFYEKRK. 254
155 0.000e+00UniRef50_A0A2H5YJ86 Short-chain-enoyl-CoA hydratase n=8 Tax=Bacteria TaxID=2 RepID=A0A2H5YJ86_9BACT  ali  20  3.FEQVIYEKEDGVAVITLNRPERLNAFTRQMLDEWYAALQDAHDPDVRAIVVTGAGRAFCTGADVSALMDRARTLVENRNFLRDVQRIPRLLAQMDKPYIAAVNGPAVGAGMDMASLADIRFASQTARFGMTYVRMGIIPDGGCWLLPRIVGMAKALELIWTGEIIDAEEALRIGYVSKVLPPDELMTLEFARKLARGPAVAIQLSKRLARGMFTDLDEALEAAQAAMLIAQMTEDAREGPRAFLEKRE. 262
156 0.000e+00UniRef50_A0A2H5ZDZ6 Putative enoyl-CoA hydratase echA12 n=5 Tax=Bacteria TaxID=2 RepID=A0A2H5ZDZ6_9BACT  ali  20  3.FRHITYEVRDAVAWLTLNRPEKLNAMTWASWAEVENAISAADDDGVRAVVITGAGRGFCAGTDLTAADQGEDEVPRREALTRSRYRATELVWNCRKPVVAAVNGPCVGAGFSLALACDIRIASEQARFSAIFVRRGLSADMGTWFLPRIVGLSEALRMLYTGRMVDAQEALRLGLVSEVVPHEELLAEAFAADIAHGPTVAIETMKRLARSLTADLASHIEREEYLQQAVRRTEDFQEGVRSFLEKRE. 259
157 0.000e+00UniRef50_A8X7A3 Protein CBR-ECH-7 n=13 Tax=Opisthokonta TaxID=33154 RepID=A8X7A3_CAEBR  ali  21  11..........ENVALITLNRPTALNALCRQLMQELSETLLKVEHDSTYVIVLTGSEKAFAAGADIKEMAKLEFADVFQKDD---FFANWDTLYHIAKPVIAAVNGFALGGGTELALMCDIIYAGENAVFGQPEVSIGTIPGGGTQRWPRFTNKSIAMEICLTGDRISAHDAKEVGLVSKVFPTQQLVAEALADRIAKNSPLIVKTVKKSVTAYETSLNQGLEVEKHLFQSTFATNDRREGMSAFSEKR.. 250
158 0.000e+00UniRef50_F0S7S0 Enoyl-CoA hydratase/isomerase n=4 Tax=root TaxID=1 RepID=F0S7S0_PSESL  ali  20  5.YENLKIEKADNILLVTISREKQLNALNKQTIEELYELLAEKENQTTSGVIITGAGKSFVAGADINEFLNLDK--GQAIALSERGHHVFNTIEDFPKPIIAAINGYALGGGLELALACHLRIASENARFGFPELNLGIIPGGGTQRLPELIGKGRAMEMILTTQQITSNQALDYGLINDLVLKDQLLAKELIQKIISKSPEAVKSAIRAVNGNCRD-KNGFKIEIDEFSKCCGTQNFREGVAAFLEKRKF 257
159 0.000e+00UniRef50_A0A0F2S745 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0F2S745_9FIRM  ali  24  1.................MNIPESLNALNINMREEMLEALLAAEDDEVRVVVITGRGRAFCSGGDIKAMNK-EFTPAEGRARMQKVGRLIKCINGMNKLVIAAVNGPAIGAGCNLALACDFIIAAEEATFGQPFGRLGLVPDGGLYYLPRRVGLAKAKELIFTWQIIDAREAERIGLVNWVVPLSDLEVKKLAEKLVKGPALANGLAKGIINSLESTLDQILEEEAYAQGLCFMSQDFQEGVRAFLEKRK. 236
160 0.000e+00UniRef50_I0SIV3 3-hydroxybutyryl-CoA dehydratase n=30 Tax=Bacteria TaxID=2 RepID=I0SIV3_STRAP  ali  21  3..KTVLLEVKNSIGYITINRPEALNALSSQVLTDLNDVLDQVEQEEIRVVIVTGAGKAFVAGADIKEMDVMSPI--QAFEYMTFANNTFTRLSDLRQPTIAVLNGYALGGGMELALSTDIRIGFEKTVVGFPEVGLGIIPGAGTQRMSRLIGTSRTKELIFTARTVKGQEAYELGILNRLVSAEELLAEELAAAMIKNAPLAVEKAKHVIQGSELPLKNAIRLETEAEALLFSTEDKVEGMRAFVEKRK. 253
161 0.000e+00UniRef50_D3S017 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein n=2 Tax=Archaeoglobaceae TaxID=2232 RepID=D3S017_FERPA  ali  18  391AYMNIKVEVEEGIAKLVLNRPHRLNALTIETLDEIVRALEELEDESVRVLIITGEGRAFSAGLDLQATLEGDMKPAVAMMLAMKGQQTFTAIEKFSKPVIAAINGYAFGGGCELALACDFRIMAKGAQIGLTETALGIIPGGGTQRMAKIVGIAKAKELIMLAKRLGAEEAEEIGLVHKAVDQEKFEVMNLARTLAKGAPIALRLAKYAINGYELPVEAGQALESAYFGVVASTEDVQEGFAAFFEKRKF 649
162 0.000e+00UniRef50_A0A1I2BNX1 Enoyl-CoA hydratase n=2 Tax=Alteribacillus iranensis TaxID=930128 RepID=A0A1I2BNX1_9BACI  ali  19  6SFEHMKLEVKEQVGIITIDRADKRNSMDVDSWVELEKAIQDMNNDDVRAIIITGAGKSFAAGADIRWIRDRVPLDIYGSA----VQDVLLAVYRSYKPVVAAVNGFALGGGCELMTACDIRIASEEAKVGQPEINLGILPGGGTQQLTKLVGLAKAKELILTGKVITAQEALNIGLLNEVVPKEDVLEKAMAVLLASKPPVAVKLAKIALNSATADLNSGMALEKALQAVLFGTKDKKEGVDAFLDK... 254
163 0.000e+00UniRef50_Q4JXA7 Enoyl-CoA hydratase n=12 Tax=Bacteria TaxID=2 RepID=Q4JXA7_CORJK  ali  22  10TYENIKVAVQGAVATITLDRPKALNALNSAVLSEIIPAAEALADPQVGAIVITGSEKAFAAGADIKEMKDETYPEVAEKRLFGD----WEKLAQLKTPLITAVSGFALGGGCELAMLGDILLASESAKFGQPEITLGIIPGGGTQRLTRAVGKYKAMDLILTGRMMDAEEAERSGLVSRVLPAEAEEVQKVAAKVASMSHVATAAATEMVDAYRSTLEEGVEAERQQFWRLFGTADQKEGMAAFVEKRK. 259
164 0.000e+00UniRef50_A0A239IUP5 Enoyl-CoA hydratase n=13 Tax=Bacteria TaxID=2 RepID=A0A239IUP5_9BACT  ali  19  3SYENLALDLADSILTITINRESKMNALNRATMLEIKDAFQYVQDKDIRGVILTGAGKAFVAGADISEFTGLSE--MHARKFAEEGQEIFQEIENCHTPVIAVVNGFALGGGCELAMSAHMRVAVSSAKFGQPEVNLGLIPGGGTQRLTQLIGKGKAYEYLMSADMISADQAKEMGLANHVEDSKDAAAKELLQKIATKAPVAIGLVIDSVNAHYETAVNGYQTEANAFAGCFGTEDFKEGVAAFLEKRK. 256
165 0.000e+00UniRef50_A0A2M7ABE6 Uncharacterized protein (Fragment) n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_40_9 TaxID=1973916 RepID=A0A2M7ABE6_9  ali  22  3.YQNLLIFREEGVGVITINHPPT-NALNAQTLEELGSVFEEMEDEEIKAVIITGSGRVFASGADINEFKDLDKETA--LKMVNQGKRVFNQIETFPKPIIAAINGACLGGGCELAMCCDLRVAVEGARFGQPEIRLGIMPGGGTQRLPRLIGKTRALELLLSGNMIKADEAKEIGLINKTVPSDKLISQAIAHRLVKLAPLAIKEIKRAVNGLNTGLFEGLKLEGDCFLKVLETEDAKIG.......... 244
166 0.000e+00UniRef50_A0A1I5XYG7 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1I5XYG7_9BACT  ali  20  2.YQNLIYEIQEGICRITLNRPQVYNALSSDLIQELTRAIGEAENEKVRVVILTGAGKAFSSGADLK--AGMGEMSSLGESLRKNYNPMIQAIRNLPKPVICRLNGIAAGAGCSLALACDLIVASENASMSQIFVNIGLIMDAGSFFLPRLIGSQKAFELCSTGRMVGSEECLELGLVSKVVTLAELAVNQLANHYANAPTFAIGLMKKVLNASQHSLDQMLEMEAANQDIAGKSADFIEGVSSFLQKRK. 253
167 0.000e+00UniRef50_UPI000771A8C0 uncharacterized protein LOC107267086 n=1 Tax=Cephus cinctus TaxID=211228 RepID=UPI000771A8C0  ali  21  496.YQYIKIEKAGNVGVVTLNRPKTLNAICDKLMRELADAVKKFDDASVGSIVITGNEKAFAAGTDVNELANITFSQTLKSGFMSH----WATISKVTKPVIAAVNGYALGGGCELAMMCDIIYAGHKARFGQPEIILGYFPNGGTQRLTRILGKSKAMEMILTGSQITAQEGEKLGLVSKVFPADRLLSEALGEKISINSQLIMAMAKEAVNAYETTLQEGLKFEKRLSYATFATADLKEGLKAFMEKRKF 750
168 0.000e+00UniRef50_A0A2V8NLT3 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8NLT3_9BACT  ali  20  4.YKNIRFSVERGIATLTMNRPENLNAVNLEMLDELLRAFSSTNNRDVRVIILRGEGRAFSSGGDIKVMEKMIHEDAYDRDWIHRVHLLEIQLRTIPKPVIASVHGIASGQGMNMALACDLRIASESASFNQSFVRLGLTSE-GTYFLSRLVGVGKATELFFTGDTLAAAEALSLGIVNRVVPDDKLEVEKWASRMASGPTEALGRTKLLINGYRNQLDQHLAQESTLIAETARTADFKEAVRAFLEKRE. 256
169 0.000e+00UniRef50_A0A1B9AS50 Enoyl-CoA hydratase n=13 Tax=Bacillales TaxID=1385 RepID=A0A1B9AS50_9BACI  ali  21  2.YSLLRVEKENNVATVVINNPP-MNVLSELLASELCDAFTELRDDSVVTVILTGEGRAFMAGADIKEFPNMINQSTEAKVQPSKKNEVFQLISDFPKPTIAYLNGITLGGGFELALVCDLRIAKETAQLGLPEVKLGLFPGGGTQRLPRLIGSAKAKELMFTGDSITAEEALKLGIINQTEEEEIEAARKLARKISRHSLQALRRIKQAVNGTDGHLQDGLELESNLFQEIFTTEDMKEGVTAFLEKRR. 254
170 0.000e+00UniRef50_A0A1Q8ANE3 Uncharacterized protein n=3 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q8ANE3_9BACT  ali  22  3....VLLDVDDGIGTITLNRPEKLNALSNELSKELAEVLRVAGNTRVRAVVITGAGRAFCAGGDIDSMRRHAEEHHSIRDILQAGATIVETLHAMPKPTVAAVNGPAAGAGGSLALACDFRIASEAASFGLVFSRLGLHPDGGTYFLPRIVGTAKALELILSGDIIDAAECVRLGIFNRVTDADHLLAREFAVTFAAKAPLALTLARQAVNSVNMPLKEVLALEIENQLRIFPTADAKEGIRAFLEKRR. 255
171 0.000e+00UniRef50_V6M4L7 3-hydroxybutyryl-CoA dehydratase n=26 Tax=cellular organisms TaxID=131567 RepID=V6M4L7_9BACL  ali  19  2...SVLLQKEGAVAVLTIDRPHVHNCLNFAALCSLRERIAQLADRGTRVVVVTGSGKAFCAGADLKERRGMEPQQVE--AYIRMIRETFSELERLPKPVIAAVNGLALGGGTELALACDLRVMSETAQMGLTETSLGIIPGGGTQRLPRLVGKGLAKELIFTARRVLPDEALQIGLVNRVVPAERLLPDELARQISEQAPLALAQAKVAIDGSEVELATGLMMESQAYQLLIPTKDRLEGLAAFQEKRK. 251
172 0.000e+00UniRef50_A0A2S6U008 Short-chain-enoyl-CoA hydratase n=11 Tax=Bacteria TaxID=2 RepID=A0A2S6U008_9PROT  ali  20  2TDKYIELDSREGVATIILDRPDKLNAWNTLMREQLREAVSNIDDDDVRVLIITGSGRAFSAGEDVQGMGDLSNVGPKGRRRVRMIHNVFDDLEQIEIPVIAAINGVAAGGGLELALSCDFRIASENAKFGLPEGNVGLIPGGGISRLVKLVGPAISKKLVMTGEIIDASRALEVGLIEEVVAPDKLIDREFAQTLAARAPLALGTAKLVINQLNTDLETGRNLERLGQSTLKLSDDHEEGVKSFLEKRKF 259
173 0.000e+00UniRef50_A0A0N1D9G6 Enoyl-CoA hydratase n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A0N1D9G6_9PSED  ali  22  20.YESILVERRERVGLITLHRPKSLNALSVAMSREVVAALHDFDDDNIGAIVIAGSPRAFAAGADIEEMADKTFVDLQQHD----VFAAWSQLLTVSKPIIAAVSGYALGGGCELAMMCDFIIASEDAQFGQPEIKLGILPGGGSQRLTRSVGKALAMDMILTGRTINASEAKAAGLVSRVVPSADLLQTALAHTIAGYNAPAVRMAKEAVNAQEVSLAEGMLHERRLFQAAFATDGQKEGMQAFLAKR.. 267
174 0.000e+00UniRef50_A0A125YGH9 Enoyl-CoA hydratase/isomerase family protein n=15 Tax=Eukaryota TaxID=2759 RepID=A0A125YGH9_TOXGM  ali  21  114...YLIVERASAVMMIKINRPNSLNALCLALCDELVYTLEQLADDSVRCVVLTGVGKAFAAGADVKEMQRLNFADIVT---SGDLLAKWARIHSFRKPIVCAVNGYALGGGCELAMMCDVVIASTQAMFGQPEVRIGTIPGGGSQRLPRAVGKSLAMEMILTGEPINAERALQAGLISRVVPPSHVVDEAVATSISSHSLPMLIAAKECVNAYEMPLQEGLLFERRLFHGTFAYEDRREGMTAFVEKR.. 364
175 0.000e+00UniRef50_A0A0B6X372 Enoyl-CoA hydratase/carnithine racemase n=18 Tax=Bacteria TaxID=2 RepID=A0A0B6X372_9BACT  ali  23  3..EHIKVSCEAGIVTITLNRPERLNAFAGHMRRDLAEVLERASDPRIRVVVITGAGQAFCAGGDVEAIAELMEDTDEFARLLGAGRRVVTAIRQMPKPVIASIPGPAAGAGCNLALACDIRLAARSATFTQSFVRLGLHPDGGTYFLPRIVPPNIACEMFFLGETITAEEAWRFGLVNRVFPDEELEAERFAERLRDAPPAVITAAKHAVYMSDHTLDQMLQYELESQLRCFQTQDAREGVRAFLERR.. 255
176 0.000e+00UniRef50_L8MFD5 Enoyl-CoA hydratase n=78 Tax=cellular organisms TaxID=131567 RepID=L8MFD5_9PSED  ali  22  3.YETLLVSVQERVGLITLNRPKALNALNSQLVAELNQALDQLEADAVGCIVITGSAKAFAAGADIKEMSAFGFPQI----YLDDFFAAADRIGARRKPLIAAVAGYALGGGCELALMCDFIYAAENARFGLPELTLGVIPGGGTQRLTHALGKAKAMEPCLTGRQLTAEEAERAGLVARVLPAESLLDEAVARGIAGKSLPAAMMTKECVNAFELGLNEGVRFERRLFHSLFASADQKEGMNAFVEKR.. 250
177 0.000e+00UniRef50_A0A101V8J8 Crotonase n=2 Tax=Desulfitibacter TaxID=293136 RepID=A0A101V8J8_9FIRM  ali  20  2.YKNIKFTVEEDIGSLIVNRPNSLNSLTIEALKEIISVLDNLS-PKVKILMVAGAGRAFIAGADIKEMAEFTP--EEAMEYVKLGHRVFCTIEELPIPVIAVIQGYCLGGGLELAMACDIRIASDKARFGQPEVGLGIIPGGGTQRLPRLVGKGIALELMMTGNIIDSKRAYQIGLINHVVNPKSLPEREIANILKAKSSNAISLVKDSVNGSNMAIKEALAYETRLFGYCFTKEDFKEGFKAYFEKRK. 251
178 0.000e+00UniRef50_A0A2D6N5L0 Crotonase n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2D6N5L0_9CHLR  ali  21  7..EVVTVERDGSVAVVQLSRPEARNAMDAAMLRALTTHLTTLEQPEVRVLIITGSGKTFSAGADIKQMVQMDAAG--GRSWAMLGQSLMDLVEELEKPVIAAINGVAVGGGCELALACDLRYAASGARLAQTEINLGITPGGGTHRLTRLVGPGVAKELILTGRLLSADEALHLGLVHGVLADEELRALDIAHQVAEKPPLALARAKRALNVAGMDRRAANALEAELFGEMFGTEDRAEGMRAFLEKRQ. 256
179 0.000e+00UniRef50_A0A2E2TBH4 Enoyl-CoA hydratase n=9 Tax=Bacteroidetes TaxID=976 RepID=A0A2E2TBH4_9FLAO  ali  19  3TFTNLLAENIDGILTITINRPKSLNALNKLTIQEIGAAIKEVSNQEIKGAILIGAGKAFVAGADISEFISLSQEDA--KALSKAGHDIFNAIENCPKPIIACVNGFALGGGCELAMACHMRVASPNARFGQPEVNLGIIPGGGTQRLIQLIGRGRAYELLTTANMIDAEQAXEWGLVNYVEXHXDXIVKASANKIAKKAPLAIAKTVXXINAYFDKNKDGFKTEIDEFAACAATXDFKEGASAFLEKRK. 254
180 0.000e+00UniRef50_G8NQ56 Enoyl-CoA hydratase n=6 Tax=Bacteria TaxID=2 RepID=G8NQ56_GRAMM  ali  18  7.HKTLRHEREGAIATVTLDRPEVLHALDATMFDELVHTFSTLADEAVRVILLTGSGRAFAAGADIRGLLETDALS--GRQISDRGQQVFAQIERCGKPVIACVNGVALGGGCELALACTLRIASDKARLGLPEVKLGLIPGGGTQRLTRLIGHGAALRMMLTASIVDAHEALRIGLVEEVVPAAELMTRALAETIAVMAPLAISGVLEAVRGEGLPLSEGLRAEADIFGRLCGTADKQEGLTAFLAKR.. 257
181 0.000e+00UniRef50_A0A1F9BHR0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_60_28 TaxID=1797833 RepID=A0A1F9BHR0_9DELT  ali  22  3.YNTIILSIDGPVATLSFNRPEKLNAVSPEMLAEFSLAVDEVRNTAIRVLLLMGQGRAFMAGADIKLFLELDPLGA--RDFAARGQELVSKLEELPIPVIACVHGFALGGGCEIAMACDFIYAAAKAKFGQPEINLGFNPCGGTQRLARLVGKALAKELCLTGRLIDAEEARTMGLVAQVFPEATFLEESAARALAAKGRVALEAVKRVIDGVDVDLKTGCALEAETFALCFTSPDVKEGVTAFLEKR.. 252
182 0.000e+00UniRef50_A0A257K2T6 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=11 Tax=FCB group TaxID=1783270 RepID=A0A257K2T6_9FLAO  ali  23  4...SILLKIENNIGFITLNRPEVFNSFNREMALLMQDTLDQCADDNVRAIVITGAGKAFCAGQDLKEVTTPELMPGFRKILEEHYNPIIQKIRTIEKPVVGAVNGVAAGAGANIALACDIVVASENAAFIQAFSKIGLVPDAGTFFLPRLIGFQKAMALMMLGDKVSSAEALQMGMIYKVFTPETFEAEKLATTLATMPTKALGLTKRLLNSMTNNLEQQLALESKLQIEASSTNDYNEGVTAFVEKR.. 253
183 0.000e+00UniRef50_A0A2K9IUR7 1,2-epoxyphenylacetyl-CoA isomerase n=51 Tax=Bacillales TaxID=1385 RepID=A0A2K9IUR7_VIRPA  ali  22  2.FQTIHYEEKDQVAWLTLNRPEKLNAFTSTMNQEMIEVFQSVKDHKIRALVITGAGKAFCSGEDISSLQPEMQLGEIIKS---RYQPMMKELARVEKPIIASINGATAGAGLSLALACDFRIASEQASFMEAFIHIGLIPDSGLYYLPRIVGLAKALELVILGEKLTAKEAKEVGLVTKVVPPDQLEAETFVDRLAHMPTKAIGLIKRMYQSFETNLNNMLDYEAFGQEIAGKTEDYAEGVQSFLDKR.. 250
184 0.000e+00UniRef50_H2C5H1 3-hydroxyacyl-CoA dehydrogenase n=1 Tax=Metallosphaera yellowstonensis MK1 TaxID=671065 RepID=H2C5H1_9CREN  ali  21  395TFTTIYVKREPPVAWIVLNRPSRYNALNWDMVKELSEALDELEDPEIRVIAVKGEGKAFCAGADVQEFLSLTPVKAMMV--SRKFHEVFFKIQFLTKPVVAAINGVALGGGFELAMACDVRIASKIAEMGQPEVNLGLIPGGGTFRLPRLA-KRRGLELVITGERLKAQEALELGLVDKVVEHESLEDEKFAETVSSRPPLAVALGKMAVNGRETNSWVSSAYEASLFGLLFSTSDFKEGVRAFLERRR. 645
185 0.000e+00UniRef50_UPI00082FC05E hypothetical protein n=1 Tax=Christensenella timonensis TaxID=1816678 RepID=UPI00082FC05E  ali  19  4....VTVQKQGPVGIMTLSSDKGLNIFSVELFEKMTACIDKLADPDIRAIIITGEGKAFMAGSDVKYMLQL--NIEQGMYFTHVGVQFFRKLELLRKPVIAAVNGYSMGGGTEMSMACDIRIASSKAVFCQPETGLGIIPGFGTQRMVRLLGPGKAKELIMTAERIDAQEAYRIGLVNKVVEPEKLLDEAMANRIAANSPMAVAAAKLAIRGAETDLETGIVLEEMLTRQCYDSPDRVEGMTAFVEKRK. 251
186 0.000e+00UniRef50_UPI0009F81EA9 enoyl-CoA hydratase/isomerase family protein n=1 Tax=Desulfosarcina cetonica TaxID=90730 RepID=UPI0009F81EA9  ali  23  80...TTRVEICGAIGKLIFNRPEVLNAYNRSVSETLTAGLETLGTDEVRVIVITGAGNAFMAGADINMLNDWNQKGDRAHSLEATFNPTM--LEDCPKPTIAAVNGLAFGIGCEVAMGCDYRIASQDAKFALPEIKLGIIPGGGSQRLLRLVGATKALEMISTGDPIDAAEALRIGLVNQVVAPDKLAIDAFASRLTSKSALALKIAKQLVQGGNRSLYQGIDYERDCFCEILLSEDAAEGTRAFIEKRK. 331
187 0.000e+00UniRef50_A0A1R1PMZ1 Putative enoyl-CoA hydratase, mitochondrial n=1 Tax=Zancudomyces culisetae TaxID=1213189 RepID=A0A1R1PMZ1_ZANCU  ali  22  29.YNTILVERVGRVGIITLNRPKALNALCGELTTEMLDQLVKFDADNIGAVIITGGSKVFAAGADIKEFEGKGMVDLMNKDSLN----WTLGFKNIRKPIIAVVNGYALGGGCELAMMCDMIYAGESAVFGQPEIKLGIIPGGGTQRLVKAVGKSKAMEICLTGTVMKAQEALQFGLVSSVHPVEKVMQAALATIIASQSQPVISLIKASINSFEVPLQAGLDYERKAIQMAFGTKDKIEGVKAFIEKRK. 278
188 0.000e+00UniRef50_G8AWU2 Putative enoyl-CoA hydratase n=16 Tax=Bacteria TaxID=2 RepID=G8AWU2_AZOBR  ali  20  7....ILTSRDGAVGLITINRPTTLNALDVPTLLELERALGELEDDGVHVIVVTGAGRAFVAGGDIADLDSRQGLAHY-LDFAEVVHRVFRRFETCDKPTIAAVNGWALGGGTELVLSLDIRIAADTAKFGLPEINLGLFPGGGTQRILRQIPPCRARELVFTGDQFTAAEAVAWGLVNRAVPKADLMAEAMAQKIAAKSPLILKLTKRTLRGAEMPLGASLAYEQAMIGLVLDSQDAHEGCRAFLEKRK. 256
189 0.000e+00UniRef50_A0A0A8JGB0 Enoyl-CoA hydratase/isomerase n=5 Tax=Bacillales TaxID=1385 RepID=A0A0A8JGB0_BACSX  ali  20  4.YEFIETSVDNMTGVIELNRPRQYNSINRKMVSEILHAMQTFDDDEVRVILVAGKGKAFSAGADIDEMAEADSMSLELLNQFED----WDRLALIKKPVIGAVHGFVFGGGFELALCCDVILAAKGTEFSFPEVSLGVMPGGGTQRLTKLVGRAKAIEWLWTGERIPAEELLKYGAINRIVSPEVLREEALANRIAKMPPLSLRLIKDSVNAVDYSLYEGMQYERKNFYLLFSSEDQKEGMNAFIEKRK. 252
190 0.000e+00UniRef50_A0A1V5DNK4 Putative enoyl-CoA hydratase echA8 n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5DNK4_9DELT  ali  21  2NFEKILFSVKDKTAVITINRPKALNALNSEVIAELDAVVQIVENPQIRVVVI-GSDKNFAAGADIKAMIEMNPEQARAFGFT----PTFNKLENLSKPTIAAISGYALGGGLELALVCDLRIAAPDAKLGLPEINLGIIPAGGTQRLSRLIGTSRAKELVFQGAIIDANKALQYGLINEIADNPMEAAMKHAEKIAVKAPLALKAVKECIATAKTDIRSGLEYEEVAWSRLYATKDQKEGMRAFAEKRK. 248
191 0.000e+00UniRef50_A0A151BEG2 Crotonase n=1 Tax=Candidatus Bathyarchaeota archaeon B25 TaxID=1779369 RepID=A0A151BEG2_9ARCH  ali  20  7....VLYEVKGKAAWITLNRPKALNALSPEVFQKLNEALDKAEDPNVMVAVITGAGKAFSAGADVSEFK--TSDVAKVRDFIRLGQQTMLRIAFFPKVTLALVNGVAVGGGCELALACDLRIASENARFGQPEPRLGLIPGGGTQNLQRIVGQAKARELLLTGRIIDAREAEKIGLASKVASREELAALDLIGEITALGPLAVKAIKEVLTKPGKDLEAGLNLEMEKFMECFQTEDRAEGVAAFFEKRK. 255
192 0.000e+00UniRef50_A0A1F9BZY6 Uncharacterized protein n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1F9BZY6_9DELT  ali  19  2SYKNLFFETDGNVGIIKINRPEVRNVFNWETWMEFEMALKELHAPEVRVGVITGAGEAFIAGADLNMLKVRTP--EMAVDASKKANEILLFLESMEEPVIAAINGWALGGGCEIALACDIRIASDRAKIGQTEARVGIMPGGGNVRLMRLIGPGRAKEMIYTGRILDAEEAERVGLVNRVVPHEKLMEEALAREIA-KGPRAIHIAKKAMQIAQLPFLEGLKADSELYGEVYKTEDFKEGVTAFLEKRK. 253
193 0.000e+00UniRef50_A0A1Y5Q1F7 Enoyl-CoA hydratase-isomerase n=405 Tax=Bacteria TaxID=2 RepID=A0A1Y5Q1F7_9SPHN  ali  19  2TYETLLIEQRGAVTLVTLNRPQALNALNSSVLDDLAAFAAFEADDSQRCAVLTGSGKAFAAGADIKEMADKPASDFYLEDFFSKWTSDF--VKKVRKPWIAAVNGFALGGGCELAMMADFIIASDKAKFGQPEIKLGVAPGGGSQRLTRAIGKAKAMEMCLTGRMMDAAEAERSGLVARVVAHETLVDEAVATTIAAMPPMAAMVNKDMVNAAETTLDQGLIYERRLFQILAATEDKAEGMAAFIEKRE. 254
194 0.000e+00UniRef50_A0A101WLG2 Uncharacterized protein n=1 Tax=Desulfosporosinus sp. BRH_c37 TaxID=1734396 RepID=A0A101WLG2_9FIRM  ali  20  3.YKTLLYETVERVTTITVNRP-KLNTLSYETLEELKHAFLRADDPETKVVLFTGSGRAFIAGMDLKEFKLLSAL--MGKVVAEKGQALTLLMESIGKPTIAVVNGICLGGGTELALACTMRVASPDAKFGLPEVGLGIMPGGGTQRLPRLVGEGRAMEIVLSSEPIDAQEAYRIGLVNKIFPKESLMSMRFARKFSQKGAISLSSAMQAVHSLEIPLEQGLKLEASLAGLTWDTEDSREGATAFMEKRK. 253
195 0.000e+00UniRef50_A0A1V4XEZ5 Putative enoyl-CoA hydratase echA8 n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V4XEZ5_9DELT  ali  20  7....VLYEKSESIALLTVNRPEALNALNTAVNLKLIELLDRAEDPEVRVVVLKGSGKAFIAGGDIKEMVDKDAMGAREYALAAK--RVIDRIWNLKKPVIAAIQGLCLGGGLEYAMACDLRTASEKARFGQPEINIGIMPGAGTQRLSRLIGITKAKQLCFTGDMIGADEALALGLINEVYPADSLMEKELAKKIASKSAPALTLIKSAINGTGMDLESASLFEIDCFGLCFATEEQKEKMLAFVGKKK. 255
196 0.000e+00UniRef50_A0A1V5BKK8 Putative enoyl-CoA hydratase echA8 n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5BKK8_9FIRM  ali  22  5.YKNLIVTKEDGVATITLNRPEVFNCMTPELMSELTNALGSIADDEAKCVVITGAGKAFCSGGDVALMNKMTPL--ESREYLQKFVKPINLIYSMEKPVIAAVNGLAGGGGCDLAMACDIRVASESAKFATFYVRMGITPALGCFFLPRLVGLGKAKLMAFTGDIIDARQAEHFGLVDVLVSESEFAVQNLAHRLAKGPTKAIGMTKIAMNSMNMDLEASMDYARNLVVLTTQTEDYREGFQAFLEKRK. 259
197 0.000e+00UniRef50_A0A2V6Q0D2 Uncharacterized protein n=3 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6Q0D2_9BACT  ali  21  61.YETLIVERTGALATITMNRPEARNAIDLAMRHELLAALDEVEADAVRVLILSGAGEHFCAGGDVKSMRARRSTAAEGRERVQMLNRMVLRLVDFPRPTIAMVDGFAVGAGTNLALCCDLVVASDRARFGELFNKIGLAPDGGTWLLSRLVGLARAKELIFTGDVFDAAEAARLGLVNRVVPAAELRARALAEKIAAGPPGVLRMAKHMVNRATTDLAAALDLEAYSQGLAIASDDHQEGLAAFFDKRKF 316
198 0.000e+00UniRef50_A0A075HPC6 Enoyl-CoA hydratase/isomerase (Crt) n=16 Tax=Thaumarchaeota TaxID=651137 RepID=A0A075HPC6_9ARCH  ali  20  7...FLTTTNEEGICVVKINRPEKLNAMNTDVAKEIISTFKQLEDDKVKVIIITGEGKAFSAGADIEYMSKISPDESEV--YAKLGQELTDTVENITKPTIAAVNGYALGGGCELAMSCDIRIASNNAKIGQPEVTIGIPPGGGTQRLMRIVGIAKAKELVFTGKPVNANTAKEIGLVNHVFEQSSLMDEAMAKQIASNAALAVHMSKTAINGRNADLDTGLGVELLAWRNCFSDPEREKRMTDFVSKSK. 256
199 0.000e+00UniRef50_A0A1Q8UM46 Uncharacterized protein n=5 Tax=Bacillales TaxID=1385 RepID=A0A1Q8UM46_BACPF  ali  21  6....VLFEVENGVATITLNQPEQMNALSKAIIEGLKSSLARIEDPEIRAVILTGSGKAFCAGGDIKEFPGDGNNAAISRDYMKFGLPFMADLAQLEKPVVAAVDGYAVGAGFSIAIAADFVLASENATFAMSFNKIGLVPDGGLYHLPRLVGMARAKELAMTGRSITGIEAKEYGLVLDVLPKEQLLARELAERLANSATQALGLTKHILRSYELSLEQVLREEAMVQAIAFSTDDHKEGVKSFFEKRK. 255
200 0.000e+00UniRef50_A0A1G6MQ43 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=1 Tax=Melghirimyces thermohalophilus TaxID=1236220 RepID=A0A1G6MQ43_9BACL :  ali  19  2.YETILYEKKEGVAAITLNRPKSLNAYNMQMHQELTRAIDAAEDDQVRCIVLKGSGRGFSAGADLSVFKG-TESPDYGAFLRDTYNPLLMRMAEVEKPIVAALHGPAFGAGLSLALACDFRIAADNATLCMAFINIGLVPDAGSFFLPRIVGYSQALEMAMLGETYTADQAKSMGMINRVVPAAELATKEFARRLAQAPTRALSGIKRNLKSFEKDLPALLEAEAREQSACGRSVDHSEGVTAFFQKR.. 252
201 0.000e+00UniRef50_A0A0A2UZD8 Enoyl-CoA hydratase n=38 Tax=Bacillales TaxID=1385 RepID=A0A0A2UZD8_9BACI  ali  20  6...FVEATVVDGVGLIELNRPEVLNAINRQVVSELVELMTAFRDPEVGVMVITGKGRAFAAGADIHEMAGDSPIDLELLDQFAD----WDRLLSIKKPVIGAVNGFALGGGFELALACDLLFTTETAQFGFPEVNLGVMPGGGTQQLTKIMGKRKALEWLLTGEKMSAQEALHFGVVNRLIAPELLLEETMAKKVAKQPALAVRLIKEAVDAVDYPLDEGMKFERKNFYLLFSSEDQKEGMSAFMEKR.. 251
202 0.000e+00UniRef50_A0A0M9YS69 Enoyl-CoA hydratase n=5 Tax=Bacteria TaxID=2 RepID=A0A0M9YS69_9ACTN  ali  23  4....VLLERHSPVAIVRFNRPEVRNALNTEVRQLLHEHFTAAADEDVRVVVLTGSERVFAAGADIQEQAERDVVGAIK-------AYTTAAIADFPKPVIAAVNGYALGGGCEFALQCDFVIASERAKFGQPEVNLGLIPGGGTQRLPRVIGRPNASYMLMTGLPVTADQALRMGLVSEVVADDALRALELAELIAGKAPLAVRQVKEVLRGLDGPLEAGLRMERRGYQLMFGTADFREGVKAFTDKR.. 245
203 0.000e+00UniRef50_UPI00082C57F9 enoyl-CoA hydratase n=1 Tax=Streptococcus marmotae TaxID=1825069 RepID=UPI00082C57F9  ali  22  4...TVLLEVKEGIGYITINRPEALNALSSQVLADLNHVLDQVATEEIGVVIVTGAGKSFVAGADIKEMDKMTPT--QAFEYMTYANDTFTKLANLRQPSIAAINGYALGGGMELALSTDIRLGHEKILLGFPEVGLGIIPGAGTQRMARLIGTSKAKELIFTARNVKAQEALELGIINHLVDVDSLMAEKLAKAILKNAPLAVEKAKHVINGIDLPLSHAIRLETEAESLLFSTEDKIEGMGAFVEKRK. 253
204 0.000e+00UniRef50_A0A0M2PKJ8 Uncharacterized protein n=3 Tax=Bacillus TaxID=55087 RepID=A0A0M2PKJ8_9BACI  ali  18  4.FNTLEVQKKNYVGWIILNRPDKYNAFNEEMMAEIKDALSYFKNDDVKVVSFKGTGKTFASGADIADLQKMTSLD----ALFPSMQPLYDLIYNYEKPTIAAIQGYAFGGGMELAAACDIRVATNNVKFGLPECKLGVMPGGGTQRIVRLLGEAKVKELVFLGDVLDAHQAKQLGFVSEVVSQDELTVLALAGKILERGSLALRVSKLAIRSSDIPLEVGLLLENALQSFLFSTEDKQEGVAAFLEKRK. 252
205 0.000e+00UniRef50_A0A2D5USJ1 Enoyl-CoA hydratase n=1 Tax=Dehalococcoidales bacterium TaxID=2026733 RepID=A0A2D5USJ1_9CHLR  ali  24  4..QDVLYVKEEGIATLTLNRPDVRNAYVPGIVEGIYQGLEQARDSEVRVLVITGTGQAFCSGADVKSMGTNEQQPSTLRYNRSRLNWLSLALQKCDKPIIAAINGVAVGGGLDLALGCDIRIASDKARFSEIYVRRGIIPAGGVFLLPRLIGLDKACQMILTGEMIEAHEAERIGLVTKVVLHEELETRDLAEKLAKSAPLAVQEAKRAIYSLDTDLASSLEYTDSVQRDLIASDDHKEGAAAFIEKRE. 258
206 0.000e+00UniRef50_A0A1V4S839 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium 4484_190.1 TaxID=1956167 RepID=A0A1V4S839_9DELT  ali  21  6.YKNILVKTENQITKVILNRPEKFNAISPGLINDLTDAMPLISDDDTRAVVITGTGKAFCAGGDIQEIPVSKMSPKEWRAYIGSFCDVIRTLNRLPKPVIAAINGVTVGGGCDLAMSCDIRIASDKARFGYGYIQMAIISDMGGHFLPRLIGPGRAKLFAFTGDLIDAAEAERIGLVDRLAPDDQFAVDKLATKIATGPTAAIVLIKEAIRSATMDLDTSLDYALNLQSSILDSEDLKEGCSAFLEKRK. 260
207 0.000e+00UniRef50_A0A2H6EKC0 Putative enoyl-CoA hydratase echA8 n=5 Tax=Bacteria TaxID=2 RepID=A0A2H6EKC0_9BACT  ali  20  3.YQNLIFKVENKIAAVIINRPEKLNALNNKTIEELG-------------IVFTGAGKAFVAGADISELNSLNAIT--GKRFSEKGQDVFSQIENLGKPVIAAINGFALGGGCELALACHIRLASGNAMFGQPEVNLGIIPGGGTQRLARLINPGRAAEYILTGDMISAEEALRIGLVNKVFEQSELIAYKMAEKIISKGQIAVQMAKAVVSSSELNLNEGLKIESGLFALTTSTKDFKEGTKAFLEKRK. 254
208 0.000e+00UniRef50_D7CMS2 Enoyl-CoA hydratase/isomerase n=6 Tax=root TaxID=1 RepID=D7CMS2_SYNLT  ali  19  3.YTVVTLDKEGAVGVLTLNNPATLNALNSTLVAEIGRALEVIAADNIRGLIVTGGEKVFAAGGDIKAMMECTPLAA--KKYVASIHTVFNRLAEISIPTIAAICGYALGGGLELAACCDFRFAGEGARFGFPEVTLGIFPAGGSQRIPRLIGVGKAKELMFSGDIIDAKTALGLGLVNRVVPDSEVIAKEFAQKLSTRAPLALRYLKASIHGLNTDLNTGLEQELEKVAILFSTRDQKEGMRAFMEKRK. 253
209 0.000e+00UniRef50_A0A2A8IF02 Enoyl-CoA hydratase n=1 Tax=Bacillus sp. AFS006103 TaxID=2033483 RepID=A0A2A8IF02_9BACI  ali  18  10...TVQVIVEEQIAILELNNPPV-NALTSTVMAELIVALDQLEEADLRAAIITGAGKFFVAGADIKQFPSLTEAT--GKELITYGRMIFDRIADLKFPVLCAVNGLALGGGCELALACDIRIASANAKFGFPEVGLGIFPGGGTQRLPRLVGLGKAKEIIFSGEPIKADEAYRIGLVDKLTPEGELVAKELAHKIIAKAPMAVSMAKKVMNGVETSLHEGLELESEFFSKLCGTEDKNEGTQAFLEKR.. 257
210 0.000e+00UniRef50_A0A1F8RG67 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_64_32 TaxID=1797658 RepID=A0A1F8RG67_9CHLR  ali  23  2TFGNILYEQAEGVVTITINRPQRRNALNIDTVNEMMAALAQAADDSIRVVVITGAGDAFCAGADLKDAPEMSPTVA--HEIVGLYLDYVLAIRSVEKPVVAKVNGLAVGGGCCTALASDIRIASERASFSLAFVNIGISGAGATYLLPRLVGYGRACEILMTGEPVDAREAERIGLVNRAVPHEELATQTMVERLSSRPPLGLKFTKKALYGLDKDLKTEFDYEHFAQVTCLLTEDYQEGRRAFFEKRQ. 254
211 0.000e+00UniRef50_A0A1W5ZUC3 Enoyl-CoA hydratase n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A1W5ZUC3_9BACI  ali  20  2NYKYLLTEVKDGVGIITINNPEKRNALNLSALSEIESVLGAWRDDRIKVLIFTGAGKSFVAGADINQLKERTAVSALEPNMTATY----RKIEEYEKPIIAAINGTAVGGGLELALACDIRVATSNIKLGLPEVHLGIIPGGGSQRLARIIGKGRAMRMILTGEIITSEQAIDYGLITDLVEQDQLMTLEIAEKIAVKGPLSLRVAKTLLNGADIDMDTALMFEKYAQAMLMATDDKTEGISAFLEKR.. 251
212 0.000e+00UniRef50_A0A1Z5HU94 Enoyl-CoA hydratase/carnithine racemase n=2 Tax=Bacteria TaxID=2 RepID=A0A1Z5HU94_9THEO  ali  23  3.FKNIKFQVDEGVATITLDRPEFYNAINVPMAEELSRALELCNDSQIRAVIITGSGKAFCSGGDLKVMQEGKQLDKVIGDITKVLHRAITDLRILPRPVIAAINGPAAGAGMSLALACDLRIASDTAKFRQAYTANGLVPDGGTVFVPLLVGLGKASELVFTDPVIDAQEALQMGLVSKVVPPEELLAQEWGQKLAAGATFAFAQAKMLLNSFLLPLETQLEKERQAMIAAGKSEDSREGILAFLEKR.. 256
213 0.000e+00UniRef50_UPI000D34C619 enoyl-CoA hydratase n=1 Tax=Mangrovicoccus ximenensis TaxID=1911570 RepID=UPI000D34C619  ali  20  2AYETLIVEVDDHIAQIKLNRPDAKNSLNKLMIAELTDALQSARNDKVRCILLCGNEKVFSAGIDVSELAEASFADLFCGSYLGSDADP---LIRCRKPVVASVSGYAVGAGCELAMMCDLVIAGDSAKFGMPDVNLGVIPAGGTQRLVRAIGKAKAMDMLMTGRFMSAEEAERAGLVSRVVPVKKLAEEARASRIGEKSTVSTRAVKEAVNAFETPLREGLLYERRLFHALFGTNDQKEGMAAYLEKRE. 252
214 0.000e+00UniRef50_A0A2A8IIK3 Enoyl-CoA hydratase n=16 Tax=cellular organisms TaxID=131567 RepID=A0A2A8IIK3_9BACI  ali  24  4...TIVVNKENGIVLITLNRPEAANALSIQMLEGLKDAILTCKDRSVRCIVITGAGKAFCAGADLKERAGMDP--VQVRKTVSLIRDTINSLEFLPQPVIAAVNGVAFGGGTELALACDIRIASETAKLGLTETSLGIIPAGGTQRLARLVGKGRAKELIFTARRIEAKEALEIGLVEYTVPVASLMDKALAGQIVRNGPIAVAQAKFAIDGYDVDINTGLAIEQNAYEVTMPTKDRLEGLQAFKEKR.. 253
215 0.000e+00UniRef50_M8EBP1 Enoyl-CoA hydratase n=25 Tax=Bacteria TaxID=2 RepID=M8EBP1_9BACL  ali  21  2.YSHWNVHKEDRIAVVSVNRPPA-NALSHETLKELAALLDELENDAVKAIVVTGEGRFFIAGADIKEFTELSPADAE--EMARSGQKLFDRLESFPKPIIAAINGACLGGGLELAMACHIRLAAPEAKLGLPELNLGLIPGGGTQRLPRLVGRGKATQMILTSEMIGGEEALRIGLVEAVYPLDELLAKALAAVIAQKSSVTMKLALNAIHGMTDGPVAGIEQEAKLFGQAFGTEDIKEGVAAFLEKRK. 251
216 0.000e+00UniRef50_A0A1Q9P4J9 3-hydroxypropionyl-coenzyme A dehydratase n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_2 TaxID=1841597 RepID=A0A1Q9P4J9_9ARCH  ali  22  17..........ENIAKISLNRPEIMNALSLEMLEEINKALDKAENDDIRAVVLTGNGKAFCAGVDLKAINALNEEDR--KRLTTLGQSTFKRIEDFPKVVIAAINGYAFGGGLEISMACDMRVASEEAKFGTSEVKLGLIPAGGLQRLPYLIGMSRAREMVLTGNTYGPAELEKWGLLSKVVPPDELASTALASNVADNAPLALKYAKQSLNATRTSIDEGYKLDTELQDKLNVSEDLQEGITAFLAKRK. 258
217 0.000e+00UniRef50_A0A0D0FK93 3-hydroxybutyryl-CoA dehydratase n=14 Tax=Bacilli TaxID=91061 RepID=A0A0D0FK93_9BACI  ali  22  10.YECIEIKIEKGIFRLIINRPEVRNALDNNMLVEIDTALDEAQNDEVKALIIEGAGKSFAAGADIKQLHARKPLE----ALIPGMQGLYSKIENFPKVTIAVVNGYALGGGCELAMACDIRIASNKAKFGLPELNLGIIPGGGTQRLARLVGKSRALDMILTGRIIDGEEAERIGLANYYVHEEELHVAEIAEKVIKKGPIAVQLAKYAVHGFDIDTDTALWLEKLSQAVALGTEDKQEGTLAFIEKRE. 259
218 0.000e+00UniRef50_A0A1L8I3R8 Uncharacterized protein n=1 Tax=Bacillaceae bacterium G1 TaxID=1836462 RepID=A0A1L8I3R8_9BACI  ali  21  4...TVLLEEDGRIAVLTMNRPAALNALNTEMAQALYEAMERLEEKAVRVIILTGAGKAFCTGGDFKERNNMTE--EEWHRQHRLFQKVARAFRRCPKPVIAAVNGYALGGGCELALSCDFVYASHNAAFGLPEVSRGIIPGGGTQLISRFLPRGMALEMLLTGRHLPAEEARQWGMVNRVVPLAELLVLATAKQIAANSPHAVRMAKRAVLGVDHPLEEGIEIALESYHRAISHPDRIEGTRAFVEKR.. 255
219 0.000e+00UniRef50_A0A0S2I2J2 Putative enoyl-CoA hydratase echA8 n=1 Tax=Salinivirga cyanobacteriivorans TaxID=1307839 RepID=A0A0S2I2J2_9BACT  ali  21  3.YTILNFEQKQTIGILTINRPDAMNALNSKIFDELDHFLDHL--PNIRTLIVTGVGKAFVAGADISEMVEMKTDGA--RQFSQRGQDIFNKIKDLRIPVIAAVNGFALGGGMELAMACDIRIASEKAKFGQPEVNLGLIPGSGTQRLSRYTSLGNALYMLLTGEMITAQKAYTMGLVQNVTKPEELMDEKVAETIASKGPKAIEHVKKVARGRFIPFNEANRLESEVFASLFG-NEGTEGMKAFLEKR.. 248
220 0.000e+00UniRef50_A0A2E8X8H1 Enoyl-CoA hydratase n=2 Tax=Rhodobacterales TaxID=204455 RepID=A0A2E8X8H1_9RHOB  ali  22  2AYETLILEHHETVMLIRLNRPESLNAINNKMLTEICTVLKKSSNDSVRVVXITGSEKFFAAGADIKEMEXKNSNEMYLEDYFTEEHNI---ISSFRXPLIAGVSGYALGGGCELAMMCDIIFASDTAKFGQPEINLGVMAGGGTQRLPKTVGKSKAMDMHLTGRYMDAQEAERAGLVXRXFSEKDFPVKEIAKKISEKSMSSIIAIKESINSYEANLTAGINFERRKFHSLFSTEDQKEGMSAFVEKRKF 255
221 0.000e+00UniRef50_Q9NEZ8 Enoyl-CoA Hydratase n=24 Tax=cellular organisms TaxID=131567 RepID=Q9NEZ8_CAEEL  ali  21  11..........ENVALITLNRPSALNALCRELMLELSENLLKVEDQSYHVIVLTGSEKAFAAGADIKEMAKLEFADVFENDYFTN----WDTLSHITKPVIAAVNGFALGGGTELALMCDIVYAGENAIFGQPEITIGTIPGGGTQRWPRYVSKSVAMEICLSGDRLGAQEAKEDGLVSKVFPVQQLVGEALADRIAKNSPLIVKTVKRSLNAYQTSLNQGLEMEKQLFQSTFATNDRREGMSAFAEKR.. 249
222 0.000e+00UniRef50_A0A2E5ZTZ3 Crotonase n=11 Tax=cellular organisms TaxID=131567 RepID=A0A2E5ZTZ3_9EURY  ali  19  2..KNITVEKKNQIGIVTVNRPKELNSMNSETRKELATAFEKLDDEEVHVSILTGAGKAFIAGADIKEFSKMKIKDRKTMKEDWRVTDV---IANSAKPVIAMINGFCLGGGLEIAMACDLRIASKNSKLGQPEINIGIIPGGGTQRLTKLVGEGRSIELILTGNMISAEKAESWGLVNLVTEELEDLTMKMAKQIADKSPFAVERAKKSVKASNNSMVEGLRIEQELFVECFNSNDGKEGIKAFIEKRK. 251
223 0.000e+00UniRef50_A0A1E7EKM8 Enoyl-CoA hydratase/isomerase n=1 Tax=Fragilariopsis cylindrus CCMP1102 TaxID=635003 RepID=A0A1E7EKM8_9STRA  ali  19  12SYDNIIVDSNGKIAIIKMNRPKALNALNDELFTDLIHATTAINNDNVRCLILTGSSKAFAAGADISEMKDKNFEDVYRNDMFAEWQEISKR--STSTPIIAAISGYCLGGGNELAMMCDIMVCTKNAKFGQPEINLGIIPGGGTQRLTRMIGKSKSMYMSLTGDFMDANEAYTSGLVAKVYDDHDELIKEIANKVASKGSISLRACKEAINAADLSLQEGLRLERRLFHSLFATDDQKEGMAAFLEKR.. 269
224 0.000e+00UniRef50_A0A1X6ZQA5 Putative enoyl-CoA hydratase echA8 n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1X6ZQA5_9RHOB  ali  21  5....ILEERREGTVLLQLNRPDSRNALSTELRKALTDRFAALDDPDARCVVVTGDERAFVAGADIKAMARMGTAEIT----RSNVRRMWQVIAQCPIPFIAAVRGVAFGGGCELAMHADIIIAGENAKFGQPEIKVGIMPGGGTQRLPRAIGKFKAMKMMLTGDPISGREAFDMGLASECVPDADVLDRALADQIAAMPPLAVRRIKEVVAGQDSSLEAGLMLERRTFDTLFDTEDKTEGMTAFIEKRK. 251
225 0.000e+00UniRef50_A0A1W7QNK6 Enoyl-CoA hydratase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1W7QNK6_9DELT  ali  22  2.YQDLLLEKNDGVALLKINRPKAMNSLNDAVLDQLLHAFEVLADREVRVVVITGAGKAFVAGADIAEMKNCD--VQQALAFSRKGQQLMTLIGKIAKPVIAAVNGFALGGGLELMMACDFAYASENTKVGLPEVTLGVMPGGGTQNLARLIGRSRANELIFSGRLITAAEAKSWGLLCGVFPAENLMTEATAGKIAGNSRLGVAHAKDAVAGLDMSVAEGLGYEAIHFASLFATKDQKEGMMAFIEKRK. 253
226 0.000e+00UniRef50_F6CN47 Enoyl-CoA hydratase/isomerase n=3 Tax=Peptococcaceae TaxID=186807 RepID=F6CN47_DESK7  ali  22  2NFTEIIYNCINEVVTITLNRPESLNALSITMAKEIIRAIEQARDDNCKVVVITGSGRAFCAGGDIKAMK-IGMSVAKARNYVLEIGRLILAMQDLEKPIIAAVNGYAMGAGFNVVLAADLIIAAKEAKFGQAFLQVGLIDAGGSYFLPRTVGLVRAKELAFTGRIIDAEEALNMGLINKVVERERLEQESLAAKLAQDPSQALGLTKMLINGLSADLETALAYEALAQSVCMQTEDHKEGLAAFLEKRKF 257
227 0.000e+00UniRef50_A0A0W8E2C2 Enoyl-coa hydratase n=1 Tax=hydrocarbon metagenome TaxID=938273 RepID=A0A0W8E2C2_9ZZZZ  ali  22  3.YKDLLYEKANGVAVITLHRPQVLNALNDRILEELSVLMDQAADNEVKSLVITGGSKVFAAGADIGFMSSISPLEAE--KFVALAHQAINKIADLDKPVIAAIAGLALGGGCELALSCDIRIAAAGSRFGLPEINLGLYPGGGTQRLARLVGPGWAKHLLMTGKPIDSETAFQIGLITKIVPVADLIEEKLAAELAAKSAIAMRLMKKAINYTENDLASGLLFEQKTWAFLMSTEDAHEGLTAFLEKR.. 252
228 0.000e+00UniRef50_A0A2E4HVT2 Crotonase n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E4HVT2_9BACT  ali  17  7AYENLIVDCRDTVATITINRPDVLNALNAETTRELGEAVDLAADDRFHVLIITGAGEAFVAGADISVLATYDPVDA--REAARFGQATFDKIEECGKPVIAAINGYALGGGFELALACHIRFAVEGAQMGLPEINLGVIPGGGTQRLTRLLGKGAAIELICSGAQLNATDAASLGLVNAVHPADSLMEAEFAAKLAGKPRIAMRYALEAINGLNMTLKEGQAIEADLFGLCFATEDQTEGMNAFLEKRK. 259
229 0.000e+00UniRef50_A0A1Q9NVY0 3-hydroxypropionyl-coenzyme A dehydratase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1Q9NVY0_9ARCH  ali  20  12.YTKLEINIEDQIGIITINNPKA-NTLSSIVGEEFQIALNNIDNQEVRVIIVTGKGKFFIAGAEISEF--MNKSATEGRILVRKLQLIIHSIEKCPKPVIAAINGYCLGGGMELALACDIRYASENAKLGQPEINLGIIPGGGTQRLPRLIGKGKAKELIFTGDHISASEALSLQLIQKVSSSQELMVKNLAKKIASKSPLIISYAKEAIDGIEISIEEALILEADKFGLCFGTEDKVEGVSAFLDGRE. 262
230 0.000e+00UniRef50_A0A2V6TAJ8 Crotonase n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6TAJ8_9BACT  ali  20  5...TVIYETRDGIAHVRLNRPHRLNAMIPQLMRDLHEALRAAADPDVRVVILSGQGRAFCAGDDLKEAAKGYDGVADVRQFINEIQQVTVDMKTMRKPIIGAVHGYAVGGGCELALGCDLIVAAEDAKFGFPETGVAFVTGGITHFLPRAVGLAKAKELIMTGEFFDGREAKRLGLVNRVVPKEEVLAEALARTIMEKAPISIELTKLAIEGAQADLTTAMALETTATITCFMTEDAKEGARAFVEKR.. 254
231 0.000e+00UniRef50_A0A2H5ZRM5 Short-chain-enoyl-CoA hydratase n=6 Tax=Bacteria TaxID=2 RepID=A0A2H5ZRM5_9BACT  ali  22  5....VLYQREERIGVLTLNRPEALNALTVEMLDRMNAYLDEVEDSDVRVVLLTAAGRAFCVGADLRARAQEYEAGVVEDPMGRQIRRLLRRLETLDRPVVAAVHGYCLGGGLELALSCDLRVASDKAQFGLPEANVGSMPGGGTQRLTRLVGPGWAKDLIFTGRRIDAQEAYRIGLVNRVAPVDSYLDEALCGEIARKAPLSLRYAKWAVNSQDVDLESGLNFEARCHALLRHSEDRKEGIQAFLEKRE. 255
232 0.000e+00UniRef50_A0A1Z8QS67 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1Z8QS67_9BACT  ali  19  3.YQAIEFSKENSILTIALNRPEVFNAFNEQQSHELQDALKKAKKDEIRAVVITGKGKAFCSGQDLKSIKDNTGNRSLSESLYKRYNPIIKAICHLDKPVIGKINGVAAGAGCSLALACDFLIASDKASFIEVFVNVGLVMDSGSYFLPRLVGTKKAFELATLGTKVDAEKALALGLVNKVVPHDELQTNEVAKKYAKAPTKAIAMMKKLLQSNSSSLEEMLQLEAYYQEIAGQTEDYKEGVAAFIEKRK. 255
233 0.000e+00UniRef50_A0A1F8N127 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_54_8 TaxID=1797630 RepID=A0A1F8N127_9CHLR  ali  21  3.YDHIILEKKDRIAKITINRPDALNALHPDTHRQLQDALLNLDADEVRVIVITGTGRAFSTGADLKHISTLIGKPQQIVAYGQMFHDTTHLIEHMSKVVIAMINGLCLAGGIEVMEACDLAYASEDARIGDQHAAFGLVPGGGSQRLPRLIGMRKAKELLFTGDWLTAKEAEEIGLINKAVPADKLEVMAMAHKLAERSPMASKFIKYSVNGIQVDLYTGIELEKSASAAHFSTEDSTEGIKAFMEKRK. 255
234 0.000e+00UniRef50_A0A2J2H8Y0 3-hydroxyacyl-CoA dehydrogenase (Fragment) n=2 Tax=TACK group TaxID=1783275 RepID=A0A2J2H8Y0_9CREN  ali  19  258.FKEIMLRKEPPLAWIILNRPQRLNALTMTMLEELSRALDMLDDKEVRVVIIRGAGRAFSAGADVSSFAGPLH-TYYFFLYNRRFQEAVSKIERFPKPVIAAIDGYALGGGLEIAMTCDFRIATERSEFGQPEIALGILPGGGTQRLIRLVGMAKAKELIMLGDRIKADEAYRIGLVNKVVPKEEEEVRSFAMRLAQGPPIALTYAKYAINGTQVPTDIGLMLEAAFFSMAVNTKDAQEGVMAFLTKRR. 510
235 0.000e+00UniRef50_C0GEG5 Enoyl-CoA hydratase/isomerase n=2 Tax=Bacteria TaxID=2 RepID=C0GEG5_9FIRM  ali  20  2SFNYLQVTTEEKMAVITINRPKVLNALKYEVLLELQEAFNSLEDNEVKVVIITGSGKAFVAGADIGVMANLGPL--EAQKYIRAGHETFDLIAAFPKPVIAAVNGFALGGGLELALACDYIFAVEEAKFGLPEITLGIIPGGGTQRLPQAVGIGRARELVYTGKVIDAQEAEKIGLVNRLFPADGFLVQAEAKTLVQRSLVALNMAKTAINALDAGGPAGKTVEIQSVCICFASNDQKEGMAAFQEKRK. 254
236 0.000e+00UniRef50_A0A0S7WHL4 Uncharacterized protein n=2 Tax=unclassified Dehalococcoidia TaxID=1318598 RepID=A0A0S7WHL4_9CHLR  ali  26  2SFETILYEKRDRVATITLNRPEVLNAFVSTMGQEMLEAFHQAEDDEVGCVVLTGAGRGFCSGADVREFQAGIE-GRTSGNVPAASESLCQLMFNLKKPIIAAVNGPAVGVGFTMTLPCDIRIASDRARFGPIFVRVGLIPEFGSTFLPRLIGLAKAKELTLLGRMIDAQEALDVGLVSKVVPHEELMTEALATTLAQGPTRTLGLAKEALRGLVSDLAGAEAWEWSTLANCVRSPEFVEGVRAFLEKRQ. 254
237 0.000e+00UniRef50_Q54BX7 Enoyl-CoA hydratase n=3 Tax=Dictyostelids TaxID=33083 RepID=Q54BX7_DICDI  ali  22  40.FETILIEIKDSIALVTLNRPKALNSFNYQMSKELLDCCRLLDDERVKCIVLTGSGRSFACGADIKEMVSHDMVYMMKK---GQLIDNLCDLKEIEKPIIAAVNGYALGGGCEVAMICDIIVAAENAVFGQPETKIGTIPGGGTQRLIRAVGKSKAMEMILTGNPIDAKQALQFGLVSCVVPIDKETALKIAKQISSLSPIVIKLAKETVNAQESNLTEGLHIERRVFHSTFALNDRHQGMDSFANKR.. 290
238 0.000e+00UniRef50_A0A1Q9N450 3-hydroxypropionyl-coenzyme A dehydratase n=2 Tax=Candidatus Heimdallarchaeota TaxID=1936272 RepID=A0A1Q9N450_9ARCH  ali  22  4.YQTLRIEFRQNVVTLTFDRPDALNALNSQVTEDLKLALSELADSEVRALIITGEGKSFVAGADISEMVKLTP--PEARNFLHELQQTLTKLEELSFPVIAKINGYALGGGLEVALACDIRIASDNALIGLPEVSLGLIPGGGTQRLTRLIGEGHSKYLIMTGSRLNAEQALQYGIVSKVVPQEKLEVDNLLNKISNLAPIAIGSAKIAIQAFNETLNSGLEIELDEAVKCFQTKDLREGMNAFLEKRR. 259
239 0.000e+00UniRef50_A0A1W9PDK3 Enoyl-CoA hydratase n=29 Tax=root TaxID=1 RepID=A0A1W9PDK3_9BACT  ali  27  2.YETIKYEINNRVAKVTFNRPEVRNAFNWKMVEELIRVFNALKNNDVRVVILTGEGTSFCAGADLNWMKDVMNKSKENYDESLRLAELFYLIYSLPKPVVGRINGPAIGGGTGFVSVCDIAIASVNAKFSFSEVRIGLVPSDISPFMIRKCGEGRIREYFLTGRRLSAEDALRIGLVNRVVEHEKLAVSEVVEELLKGSPNAIRACKELLEKVPLQFDNVKDFTATILANLRKSKEAQEGMKAFLEKRK. 254
240 0.000e+00UniRef50_A0A0X1U8D6 Putative enoyl-CoA hydratase echA8 n=113 Tax=Bacteria TaxID=2 RepID=A0A0X1U8D6_CLOPR  ali  19  11..KNIIIEIEGEVAILTMNRPKALNALNAETMQEMIKIMECIGDDSINGVIITAEGKGFIAGADITQFVPLDALG--GRDCSELGQMCCSSIERLEKPVIAAVNGYALGGGNEVAMACDIRIASTNAVFGQPEVNLGIMPCGGTQRLTRLVAYGVAKELIFTARQVKADEALSIGLVNKVVAPEELLAKEMMSTILTKAPKAISMCKVAINGKEMDMVNALELERDVTGLLFSTADKVEGVAAFLEKRKF 263
241 0.000e+00UniRef50_A0A0D5BSP8 Putative enoyl-CoA hydratase echA8 n=47 Tax=Bacteria TaxID=2 RepID=A0A0D5BSP8_ELIMR  ali  19  3.FETLIYTQDGYTGILTINRPQALNALNADVLRELNIFTDYIKTKDVRALIITGAGKAFVAGADIKAMQGMTP--EEAERFSVTAQAVFDAIEALPFAVIAAVNGFALGGGCELALACDVILASEKSRFGLPEVTLGLLPCGGTQCLPRAIGLYKAKEMVFSGEFYTAKSCREFGFVNRVIAPEDLLDEALAATIAARGPVAVAKAKQSLNGIEIHLDEGLKQEAYLFGELFNTEDHNEGIGAFIEKR.. 253
242 0.000e+00UniRef50_A0A285CQT4 Enoyl-CoA hydratase n=1 Tax=Bacillus oleivorans TaxID=1448271 RepID=A0A285CQT4_9BACI  ali  19  4.YQYIEVSVEDGIGHVSLNRPKVLNALNRTMIREIVTVFDDFDREDVKVIVLTGKGRAFAAGADIDEMADDDAIRMELLNQFKD----WDRMNMIKKPIIGAVQGFALGGGFELALSCDLLFAAEDAKFGFPEINIGVMPGGGTQRLTRLMGKTKALEWLWSGEMMPGKEALQYGVVNRLIAPELLNEQQFARNVASKPALSVRLIKEAVKAEDYTLAEGMQFERKNFYLLFASEDQKEGMKAFQEKRK. 252
243 0.000e+00UniRef50_A0A1H0IYQ6 Enoyl-CoA hydratase/carnithine racemase n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A1H0IYQ6_9GAMM  ali  20  17..........EGVAVVVINRPKAKNALNADVRRQLAEQFLSLQRDEVRAIVLTGGDQAFVAGADVKEFATASPTDM----YRRHNERFWDPIAHCPKPVIAAVSGFALGGGCELAMHCDIIVAGESARFGQPEVKLGLMPGGGTQRLVRAVGKFQAMRLLMTGCMVNAPEALRMGLVSEVVADDQTLEHALAREIAAMPALAVEQIKEVLSGADLPLESALVLERKAFQMLFDTADQKEGAAAFIEKRK. 256
244 0.000e+00UniRef50_A0A0F9B9Z9 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9B9Z9_9ZZZZ  ali  22  13.YETILYEKKDKVAVITLNRPERMNAINVQMNADLKNSLKEAEDSDVRAIVITGAGKAFCAGADVQEFA-----SGKFREKVAGGRPIIHDFFRLYKPIIAAVNGVAVGFGTNLTLSCDIIYASEKASFGEFFIRMGLIPDMGSFLLPKFLGIHKAKELIFSGKRIFADEAFKIGLVNQVFPHEELMTMEFANNLADQAPIALALSKEAIHAYEKTFDEMLAVEREFNAKCYASEDHGEAATAWVEKRK. 262
245 0.000e+00UniRef50_A0A2A9FA67 Enoyl-CoA hydratase n=1 Tax=Amycolatopsis sulphurea TaxID=76022 RepID=A0A2A9FA67_9PSEU  ali  19  3....LKIEQSGRVVWVRLHRPERLNALDTAMMTELIDTLTPLRDPDVGCFVLTGSERAFAAGADIAEMSAKTATDMQTEDYFAG----WEAFAALRTPKLAAVSGYALGGGCELAMMCDLIIAGDNAKFGQPEITLGVIPGGGTQRLTRLVGKAKAMDLILTGRLIDATEAERIGLVSRVVPTDRLLTEAVAAQIAGYGKLAAMAARDCVRALETGLSDGIRYERRVFHGLFATEDQREGMQAFLHKR.. 247
246 0.000e+00UniRef50_A0A151Z1T1 Uncharacterized protein n=13 Tax=Bacillales TaxID=1385 RepID=A0A151Z1T1_9BACL  ali  22  7.....LVEIRDQVARITINRPP-MNTLSRDALFELGSILDQLEDPSVRSLILTGAGKTFSAGADVSEFGGMGDR-EQAEGFLKQIHDLFNRIENFPKPVIAAINGKALGGGNELQMACHLGIAADHAELGLPEVRLGIMPGGGTQRLPRLIGQRRALEIMLEGKRISAQEALEIGLVNKVVPAEQLAEEAWAKQLAEGPPVAMKGIIQVINGSRKELTEGLKVERENMLAVMRTEDAIEGVAAFFSKRK. 254
247 0.000e+00UniRef50_A0A075H6C2 Enoyl-CoA hydratase/isomerase (Crt) n=51 Tax=Archaea TaxID=2157 RepID=A0A075H6C2_9ARCH  ali  19  4....VTTSTSDGICTVKINRPDKLNAMNTDVAKELIKTFETINDDNVKVIILTGEGKAFSAGADIEYMSKISA--DESVEYAKTGQLVTATVELVKQPTIAAINGFALGGGCELAMSCDIRIAADTARLGQPEVTIGIPPGGGTQRLMRIVGIAKAKELVYTGKMIKADEAKEIGLVNQVVPLASLQEEALAQQIAGCSTMGVQMSKVAINGRNADLDTGLSIELLAWRNCFTHPDRQERMTAFVNKSK. 252
248 0.000e+00UniRef50_A0A1N5XBD5 Enoyl-CoA hydratase/isomerase n=403 Tax=Bacteria TaxID=2 RepID=A0A1N5XBD5_9MYCO  ali  20  19....VLTEVRDGVGLLRLNRPKALNALNAEVMDAVVESAEAWEDPQVRVIVLTGSEKAFAAGADIKEMAGRSYPEMLAADWFSR----WRRFAGVRLPVVAAVNGYALGGGCELAMMCDVLVAGEGARFGQPEITLGVIPGGGSQRLTRAVGKAKAMDMVLTGRMMDAAEAERAGLVSRLVPDDAVLDTALARTIAAQSRPATMIAKEAVAAAEMPLEQGLLFERRAFHALFSTRDQKEGMAAFAEKRK. 264
249 0.000e+00UniRef50_Q6MLZ9 Uncharacterized protein n=5 Tax=Bdellovibrio TaxID=958 RepID=Q6MLZ9_BDEBA  ali  22  4NYKTILLEQKHGVWVLTINRPESLNALNSTVLNEMGEALRQIGESDARALIITGAGKAFVAGADIKEIHDLDE--EKALVFAQRGQSIFHELTLLKIPVIAAVNGFALGGGCELALGCDFIYAAENAKFGLPEVSLGLIPGGGTVRMARAVGSRRARELTYTGGMITAAEALSAGLVNKVVPQAELMVMKTVEAILAKAPIAVGSAKFSINAWDMDVEEAQKNEARIFAELFTSEDVKEGTGAFIEKRK. 259
250 0.000e+00UniRef50_A0A161PVG6 Short-chain-enoyl-CoA hydratase n=6 Tax=root TaxID=1 RepID=A0A161PVG6_9FIRM  ali  22  7.....LFNTQEDIAYITINRPEVRNALNNKLVEQLHELFDRIEEDSLRAVVITGSGKAFMAGADIKELVERDAI--LGRKQTKRRQELFNRIENLDIPVIAAINGVAVGAGLELVLACTFRIASENAKFAASEVKLGIIPGGGTQRLTNVIGRTKALEMILLGEMIDAQEALKLGLLNKVVPLESLMVKEWTEKIKALPKLAIQYAKEAIRGNSLGREMGFAHESYLHALSCTTEDKKEGVTAFLEKRK. 254
251 0.000e+00UniRef50_A0A221R8C9 Enoyl-CoA hydratase n=7 Tax=Bacteria TaxID=2 RepID=A0A221R8C9_9MICC  ali  20  10SYTTLKLDLDEGILTLTVDRPDALNALSQQVVSELWKAFTAIQDSPVRGVIVTGGGKAFVAGADIREMASMDPDSAA--EYARSMQGVTLLIEKLPVPVIAAVDGFALGGGCELALACDFIYASESAQFGQPEVNLGLVPGGGSVRLPQRVGLGPARELIYTARRIDAAEALRLGLANRVLPREELLARDTLQEIAGKAPAAVGLAKQSIAGAGRPTIQGLETEAEAFREAFTTDDMREGTTAFLEKRK. 269
252 0.000e+00UniRef50_A0A1B6A716 Putative enoyl-CoA hydratase n=12 Tax=Bacteria TaxID=2 RepID=A0A1B6A716_9BACI  ali  21  3.FERLNYELEDRVAVITINHPPV-NTLGMKTLQELETALEACVDSRVKAVVLTGQGKAFIAGADIKEIAAISSQ-EEGERLARTGQQLFDQIEKMKKPVIAAVNGVCLGGGMELAMACHIRIAGDQAKFGQPEINLGIIPGGGTQRLTRLTNRSIAIEWILTGNLYSAEEAYHVGVVNHVVPHESVLVEALAHHIATKGGIAIAKSIEAIQGLAGTLEEGLKNEAKLFGEVCTTEDKQEGTQAFLEKR.. 252
253 0.000e+00UniRef50_A0A0F2PAF0 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c8a TaxID=1629715 RepID=A0A0F2PAF0_9FIRM  ali  19  2NFETIIYDNKDGIARITFNRPESLNAINNQLLLDIQAALASARDPSIRVVVFTGAGKSFIAGGDIKAMNTMTA--VEFRDFCLEIQKITKDVREVGKPVIGAINGWALGGGSEFACICDWRIASEKAKFGFPEPRVGLTTSGVCQNLSRIVGLGRAMELLCSGITIDAAEAYRIGLVNKVVPHDELAINEAAAEISKCSPIAVRIAKETTNAVDIDMNSCLYYEVESITSAFTTEDRKEGLTAFIEKRK. 253
254 0.000e+00UniRef50_A7NNS3 Enoyl-CoA hydratase/isomerase n=3 Tax=cellular organisms TaxID=131567 RepID=A7NNS3_ROSCS  ali  22  2TDDNILVAVEGPLTIITINRERVRNALNQATIAEIQTALRAFEADSQRVAIITGAGRAFAAGADITEIR-VLPGADAARRFSEAAHDLGLFMHQMAKPIIAAINGYALGGGLELAMSCDVRIAAETAMFGQPEINLGIIPGGGTQRLPRLIGPSAARLLCMTGDMITAAEALRLGLVERVVPAASLMDEALAMKIASKAPLAIAAIKQAVNGLDMPLAEGCMYEAALFGAIAATDDAKEGTSAFLEKRQ. 255
255 0.000e+00UniRef50_A0A2C9EMT4 Putative enoyl-CoA hydratase PaaG n=2 Tax=Pseudomonas protegens TaxID=380021 RepID=A0A2C9EMT4_PSEPH  ali  22  129NFTTILFSISEGVALLSLNRPEQLNSFNPTMHREVQAALDLVRDPQVRVLLLTGEGRGFCAGQDLGERAPGVAAPDLGASIETFYNPLVRALRDLPLPVICAVNGVAAGAGANLPLACDLVLAARSASFIQAFCKLGLVPDGGTWLLPRLVGMARAKALALLGNRLSAEQAEQWGLIYQCVDDAQLRDQALARHLATQPTYGLGLIKRSLNALHNSFDEQLDLERDLQRLAGCSEDYREGVSAFMEKR.. 383
256 0.000e+00UniRef50_Q39VC0 Enoyl-CoA hydratase/isomerase n=2 Tax=Geobacter TaxID=28231 RepID=Q39VC0_GEOMG  ali  21  4..KQIAVRHDDAIAVVSLARPESRNVLSRDLVLGLLSTFTSLKDDGVKGIVVTGEGKSFCAGADISEMARMSP--AEASSFAELGQRLMFAVERVGKPVVAAVNGHAFGGGLELALACDFIVAAESAVFAAPEVLLGVMPGGGTQRLPRLIGKSRAKEMIFTGERINAAKAHSIGLVNRVVSDERLLAETLVKNICNRGLLSLRVAKEVIDGAGIDLATACLMERDAFALCFSTDDQKEGMRAFMEKRE. 253
257 0.000e+00UniRef50_UPI000DA60634 enoyl-CoA hydratase n=1 Tax=Massilibacillus massiliensis TaxID=1806837 RepID=UPI000DA60634  ali  19  8....VLFDKEGKIATIILNRPEVMNSMNQELIDGITMALAQASDDEIKAVVLTGQGKAFCAGGDLNYLLSLTDQIS-ARDFIKKTGNLISIIMEMDKPVIAMVNGVAAGAGFNLALACDIVICAQSARFAQSFAKVGLVPDGGLYLLPRVVGMHKAKELMFTADILNAETAYGLGIVNKVVSDAELTVYEFANRLSDGPSIALSMIKSMVNRSHLDLESTLEYEADLQAICMQTADHQEGITAFKAKR.. 255
258 0.000e+00UniRef50_A0A2H5UWI6 3-hydroxybutyryl-CoA dehydrogenase n=6 Tax=Archaea TaxID=2157 RepID=A0A2H5UWI6_9ARCH  ali  18  398TYSEILVEREPPLLWITLNRPQRLNALSPKLIGELRDALRRLEDDEVRVVVIRGAGRAFSAGADITSFTEAA-TPLGAYKLLTEFQELTNQIESLSKPVIAAIDGYALGGGCELALACDLRIVSERSELGQPEINLGIIPGGGTQRLTHIVGLGRAMELVMLGERIDAEQALKIGLANRVYPVEGFRVREIALKLAEKPPIALMAAKRALHASRAPAGLGLDMEKSLFSLLISTEDFAEGVSAFMSRRK. 651
259 0.000e+00UniRef50_UPI0006D2A1A2 hypothetical protein n=1 Tax=Desulfosarcina cetonica TaxID=90730 RepID=UPI0006D2A1A2  ali  24  3NFKFINIEIDTSIALVTLNRPPV-NALNHQFEEEIDTIFDDLDKPDVRVVIITGAGKAFMAGADIKEIISFDENNAIQ--MSAGSQKVFNKIESSEKIIIAAINGLALGGGCELSIACDIRVADETALFGFPEVKLGLMPGGGTQRLTRLVGVGNAKKMILTGNPITAQIAYEIGLIEQVCQKGDCEAQKIAKQIVSNGPLAIVNSKKAINGLETIFEDGLRMETKLFSDLFNTEDRKEGINAFLEKRK. 254
260 0.000e+00UniRef50_A0A2V8JXG2 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8JXG2_9BACT  ali  23  198.YQAIIFTIEAPVATIKLNRPEKLNAFGGPMREEILSALDVAADDRIRVLVVTGQGRGFSAGGDIHHLKYLRENKDEDRSILAKGEKITRSMRMLAKPVIAAVNGPCAGAGFSFALACDIRIASDKATFGPSFALVGLHPDGGSWFLPKLVGSAKACELVFTGTMISAEDAQRIGLINRVVPHEQLMVMELAGTIAKNPPGVLRLAKESIRSLSSDLETAFARESQVQLECFYSEDFLEGVTAFVEKRR. 452
261 0.000e+00UniRef50_A0A2K6G425 Enoyl-CoA hydratase, short chain 1 n=74 Tax=Opisthokonta TaxID=33154 RepID=A0A2K6G425_PROCO  ali  22  30.FEYIIAEKRGKVGLIQLNRPKALNALCNGLIEELSQALVAFEDPAVGAIVLTGGDKAFAAGADIKEMLNHTFQDCYSGKFLNSLDE----LTRVKKPVIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPGGGTQRLTRAVGKSLAMELVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIAEKIASNSKIITAIAKESVNAAEMTLAEGNKLEKKLFYSTFATDDRKEGMAAFVEKRK. 281
262 0.000e+00UniRef50_UPI000836DFE5 enoyl-CoA hydratase n=1 Tax=Alicyclobacillus kakegawensis TaxID=392012 RepID=UPI000836DFE5  ali  23  4....VRCEVYDRVALITLNRPP-YNPINSTILRELQQMMIRMEDDTIRTVVLTGEGKAFSAGADIKEMGGLDYSGLE--RFSELARTAFGSIEHSSKPVIAAVNGVAFGGGCELALACDLRICSDTAQFAFPEVGLGIIPAGGTQRLPRLIGYPRAKEMMLLGDRVDASRAMEFGLVNRVVEAHALRALEWGNRLAQKSPMAIRMLKRSLNGMNMRLQDALYIEDACSLLAFLSEDRKEGLAAFREKRE. 251
263 0.000e+00UniRef50_A3MVR3 Short chain enoyl-CoA hydratase n=4 Tax=TACK group TaxID=1783275 RepID=A3MVR3_PYRCJ  ali  22  6....VLCELRDGVAWAVLNRPEKLNAMDLELRKELLQCLQEAEREDVRVVVIRGSGKAFSAGADISHLKMLSEMTLADFDKLKGFGDIGLFIRSMSKPVIAVVHGYCVGGGMELIQYCDLVYATTDAVFFQGEINVGIIPGGGTQLLPRLIGEKRAKEAIFTARRITAQEAKEWGLVNEVCPPEDECVNKVVEEIKQRSPVAIALAKRAINALELPLSKGLEYEALMFQRALVSEDGKEGLRAFLEKRK. 257
264 0.000e+00UniRef50_UPI000407FDA5 2,3-dehydroadipyl-CoA hydratase n=1 Tax=Neptunomonas japonica TaxID=417574 RepID=UPI000407FDA5  ali  22  15...........GVLTIKLNRPEAYNALRTQLLKELAEVLDEANDDAIKAVVITGSDTVFAAGADIKEMASLDAVGVMNDPRPSY----WRRITLFPKPIVAAVNGFALGGGCELVMHCDIVIAGDNALFGQPEINLGIIPGGGTQRLIRTIGKSMAMQLVLSGEFISAEKAQSLGLISEVTIPERERATELARKIATKPPIAVRLAKELLKAYETTLESGLNLERKSFTLLAATQDRNEGIAAFMEKRK. 253
265 0.000e+00UniRef50_F9VMJ3 3-hydroxybutyryl-CoA dehydrogenase/crotonyl-CoA dehydratase n=76 Tax=Thermoprotei TaxID=183924 RepID=F9VMJ3_SULTO  ali  22  399...TLIVRVEPPLAWIILNRPERLNALSMELIGELNKALDELENDSVRVIILSGSGRAFSAGADVTSFLTLKPIDVIR---FRSLRELTNKIQFYTKPVIAAINGYALGGGLEIALACDIRIASENSMLGQPEINLGIIPGGGTQRLPKLVGKGRAKLLIYTGDMIPAKDAYEMGLVDIVVPTGEDEVRRIALKIAEKSPLSLLAAKLAIEGYDANIFSGEYLESSLFGLLFTTKDVQEGVRAFLEKRK. 646
266 0.000e+00UniRef50_A0A239U0A1 Probable enoyl-CoA hydratase echA8 n=2 Tax=Megamonas hypermegale TaxID=158847 RepID=A0A239U0A1_9FIRM  ali  22  2..ENVLVDKKDKVAIMTLNRPKCLNAMNDGLVEDFHAALTQLEDETVRVIILTGAGRAFCAGGDLNYLEGLTDDLARQN-FIRRVGQMTSHLKNCAKPVIAMVNGVTAGAGVNLMLACDIVCSSENAKFIQSFVNVGLIPDGGMYLLKKTVGLQKAKELMFTADVISAQEAEKLQMVMHVYTQEDLETEKLANKIANGAPLAIRYMKKMLNKSYHNLEEFLDEEVLVQAFCLSTHDCKEGIQAFKEKR.. 250
267 0.000e+00UniRef50_A0A1Y3PL00 Uncharacterized protein n=1 Tax=Geobacillus thermoglucosidasius TaxID=1426 RepID=A0A1Y3PL00_GEOTM  ali  25  4..QTIKFEVNRDIAYITLNRPKQLNAINRQMINELNEAIDVVENDEIKVVIITGNDQVFAAGADIVEIRTY-ESSKEFLEIVDKGHDVLYRLEQLHKPSIAVVRGIAYGGGCEISLACDFRIAADNAKFGIPEIKLGLIPGGGASRLQKLLPFPKFKEMLLTGEPISADEALSLGLVNKVVPLHQALDAEFAGKLTNKSPLTLQAAKRLANALNSDLRTGIELEKQTIAVLFGTEDRIEGTTAFVEKR.. 253
268 0.000e+00UniRef50_A0A2N5KLS5 3-hydroxybutyryl-CoA dehydratase n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2N5KLS5_9ACTN  ali  21  88.FEQIRVTSEGGVATVTLDRPERYNALGVGIVGELREAIEETEDSEVRAMILTGAGKAFCSGADLKERAGMDP--GERWAHNRSMVALAEGLARLQVPTIAALNGLAFGGGLEIALACDFRIAAEGARFALPEVGLGIIPGGGTQRLPRLVGPTHAKELILTGRRITAERALEIGLVSEVVPAGSLMARSLAGEIAANSPLALAYAKASVDASETTIEQGLRYETAAIRATLASEDYRIGLAAFAEK... 337
269 0.000e+00UniRef50_A0A257LDH6 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A257LDH6_9BACT  ali  21  2SYETILFEVTNGVATLTLNRPDVFNAFNEQLSTDVIDALKKAKDKSIRVLVISGSGKAFCSGQDLKAIASSENRS-LSESLYKRYNPMIRAIRNLPIPVICKLNGVAAGAGCSLALACDMIIASENASLIEVFVNVGLVLDSGSYFLPRLIGSARAFELATLGSKVSAQQAADWGMINKVVKAEELEVEKLALQYSLAPTKAIGLMKKMLNSFTSDLDSMLEYEAFCQEIAGRSEDYKEGVKAFNEKRK. 254
270 0.000e+00UniRef50_F5SA74 3-hydroxybutyryl-CoA dehydratase n=5 Tax=Terrabacteria group TaxID=1783272 RepID=F5SA74_9BACL  ali  22  2.FETILYETQGGVATVTFNRPKAFNAFNMKMHEEAIQAMDQASDREVRCIVLKGSGKGFSSGADLSVSREFGAEADYGKILQETYNPLLMRMVEADKPIVAALHGPAFGAGLSVALACDFRIAADNASLSMAFVNIGLVPDAGTFFLPRIVGYSRALELAMTGRKLDAEEAYTMGLVNRVVPAEELAVEEYARRLAQAPTGALAGMKRNLKSFENDLPTLLEAEAREQTVCGRSGDHREGVTAFFEKR.. 253
271 0.000e+00UniRef50_L0NLN4 Putative enoyl-CoA hydratase n=106 Tax=cellular organisms TaxID=131567 RepID=L0NLN4_9RHIZ  ali  20  4.FETLLIETRGDVGLITLNRPKALNALNSTVMRELTQALRSFDDPQVGAIVLAGSEKAFAAGADIKEMQPVNFVDAYLDDLLGG----WEAIAATRKPIIAAVSGYALGGGCELAMMCDFIIAAENAKFGQPEITLGVIPGGGSQRLTRAVGKAKAMDLVLTGRMMDAAEAERAGLVARIVSRLLEEALEAAAKIASSSRVAVLMAKDAVNRADLTLAEGLRLERRLFQSLFATADQKEGMAAFMEKRK. 252
272 0.000e+00UniRef50_A0A2N5X553 Enoyl-CoA hydratase n=1 Tax=Halioglobus lutimaris TaxID=1737061 RepID=A0A2N5X553_9GAMM  ali  24  4.FKYMKTERKGSIGVVTFNRPEALNALNEKVAMEVTDALMEFADDSIGCMVLAGGEKAFCAGADLKWIASQDFES----AYLTDLAAYMDKVAELRKPVIAAVSGFAFGGGTEISLMCDIIIADTTARFGLPEVTLGVIPGAGGPRLTRAVGKAKAMYYILTGKPFNAEEAERMGLITKVVEDGKLMVMALATVIANNPRLAVLAGKEAVNQAETPLIPGLKLERRLFHALYSTPDQKEGMAAFAEKR.. 251
273 0.000e+00UniRef50_W4MDB4 Uncharacterized protein n=17 Tax=Bacteria TaxID=2 RepID=W4MDB4_9BACT  ali  22  6....VLYTKTGNVTTLTLNRPDKLNAMNEALMGELERYLIDIEDPEVRAVILTGAGRGFCSGGDTNEGQEKCFDGDLGGDVIERLNRCILRMQNLPKPIIGCINGVAVGAGCNLALATDLRIASDAAKFGEVFSRIGLVPDGGTYFLPRLVGTAKALELIMLGDMIEAEEAHRIGLVNRVVPADQLQAEQLAERLGNGPTLAHGLAKTGVQSMNMSLEDVLNMEARNQAVASRSEDRAEGAAAFREKR.. 259
274 0.000e+00UniRef50_A0A1Y5FGK3 Enoyl-CoA hydratase n=1 Tax=Halobacteriovorax marinus TaxID=97084 RepID=A0A1Y5FGK3_9PROT  ali  20  15...........RVALLKLNRPKVLNALTTELLQEIVNELTRLEEPEVRCIIITGDERAFAAGADIRKMVESNSIDQLNDKRLR----LWKQFALISKPIIAAVNGYALGGGAELAMSCDFIVAGDNAKFGQPEVNIGTIPGGGTQRLARAIGKNKAMMLTLTGEMIDAKTALEWNLIAKVVPYNTLLQEELAKKISDKSPIAAKLIKDCINSQEMSLWDGLEYERRNFYLTFSSLDQKEGMNAFLEKR.. 252
275 0.000e+00UniRef50_A0A1H6UBX9 Enoyl-CoA hydratase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1H6UBX9_9GAMM  ali  24  3.YQTLLLEFQERVALITLNRPQALNALNAQLIDELNQALDRLENPQVGCIVITGSPKAFAAGADIKEMAGMSFPQIYLDDHFAAADRIAAR----RKPIIAAVAGYALGGGCELALMCDFIYAAENARFGLPEITLGVLPGGGSQRLTRAIGRTKAMEMCLTGRMMPAAEAEIAGLVAQVFPADQLLEETLAHAIAGRSLTAAMMIKECINRVDESLSEGVRFERRMFHSVFATADQKEGMVAFIEKR.. 250
276 0.000e+00UniRef50_A0A2H2I3S8 Uncharacterized protein n=2 Tax=Caenorhabditis TaxID=6237 RepID=A0A2H2I3S8_CAEJA  ali  19  31..EMIKVEKVGNVALIKLNRPKALNALCDQLMSELSDALRSLDDTSVGAIVITGSERAFAAGADIKEMTD----NEFASTFSGRFLENWTTVSEVKKPVIAAVNGFALGGGNEIAMMCDIIYAGEKARFGQPEIKIGTIPGGGTQRWVRAAGKSFAMEVCLTGDQVTAQEAKERGIVSKVFPVDQVVGEALGEKIADQSPLIVQMAKEAVNAYELTLQEGLHFERRLFHATFATKDRKEGMTAFAEKRK. 281
277 0.000e+00UniRef50_A0A1V5DIL1 Putative enoyl-CoA hydratase echA8 n=4 Tax=root TaxID=1 RepID=A0A1V5DIL1_9DELT  ali  22  3AYKTIILDKKEGIGYITLNRPEVFNAISQELINEFSDALDKINKDEIHVLILTGAGKGFQAGADIRELSMMTPMS--ILRWNEGVLRNNAKIEKLRQPVIAAINGLAMGGGLELALSCSIRIAVAGAKLALPEVKLGIIPGGGTQRLPRLIGKGKAYELLLTGDTITAEDALNIGLINKVVPKGLAAAEEMARKIMANAPFAVEMCKDAVEGMNLPLEEAVQYSQKNCITCFSTEDMKEGTGAFLEKRK. 254
278 0.000e+00UniRef50_F0HQ19 3-hydroxybutyryl-CoA dehydratase n=5 Tax=Terrabacteria group TaxID=1783272 RepID=F0HQ19_9ACTN  ali  20  10.....LAEKRDGVGIITLNRPEKLNAINQDVMDDLYYLFDAYEDPEVRVIVLTGGGKAFCAGGDIEGEIQMDVVGSYHGGI--EGNRLNTRIEKCRIPVIAAINGFCLGGGFEMALACDIRLASERARIGLTEVNMGVIPGGGTQRLPRLIGPSRAKLLMMTGNHYKGEAALAMGLVDMVFPAEELLEAAMAKEMAAKPPLALEYVKWAVNGMQMDLDRALLFESALFAHLYSTEDQKEAMSAFLEKR.. 256
279 0.000e+00UniRef50_A0A1H2TK41 Short chain enoyl-CoA hydratase n=2 Tax=Marininema mesophilum TaxID=1048340 RepID=A0A1H2TK41_9BACL  ali  22  3.WKNIVVEKGEGWALVTISRPKMMNALNQETLAELSQVLDFLEEEDIRAWILTGEGKAFVAGADIKELRDV-PSSAEAERLANRGQALFSRIENSPKPVIMAVNGFALGGGCELAMSGDILLASEKARFGLPEINLGVLPGGGTQRLARLVGKSTAKYLALTGEMIGAEEALRIGLAQKMIPADQLLDEALASTLATKAHVAMTAIKKSINGLETHLSAGLALEASQFGVVFDTEDRLEGMDAFLEKRK. 255
280 0.000e+00UniRef50_A0A212JUA2 3-hydroxybutyryl-CoA dehydratase n=7 Tax=Bacteria TaxID=2 RepID=A0A212JUA2_9DELT  ali  21  6...TITYEKRGHIGLLTINRPKAMNAFNNEVVTEVYVCLESLVNTDIRCLIVTGSGKAFVAGADIREMQYLNPS--QAAAFSRAGNAVMALLEDFPVPIIAAINGYAMGGGCELALSCDIRIASENAVFSFPEVGLGIIPGGGAQRLARIIGIGKAKELIYTTNRINAADALTVGLVNAVYPQEQLLDKEMAEKIASNAPTAVRVAKGVINSMGMELHQSYGLEVLPFSTCFLTSDRQMAMDAFVDKR.. 253
281 0.000e+00UniRef50_A0A1G1E4Z3 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1G1E4Z3_9BACT  ali  21  4..KDILVEKRDGIAKVTLNRPEVLNAFSIEMREGIGTLFESVNDEAVRVVVLTGAGKAFSAGGDIKGWGDLKDEGRRKL-IMTLAHRAVSAVTMLEKPVIAMVNGDAVGAGCNLALACDLVIAAEAARFGEVFVRLGLGPDGGAYFLPRLIGLAKAKELLFTGKIISAREAEQIGLINQVVPADQLEVMNLAAQLAQSATRAIGMMKTFLHKVQMDLANALQYEAYVQSECIKTEDHQEAVRAFLEKKK. 254
282 0.000e+00UniRef50_Q39TI5 Enoyl-CoA hydratase/isomerase n=1 Tax=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) TaxID=269799 RepID=Q39TI5_GEOM  ali  22  2SYEAIMLERNGAVGVLTFNRPEVLNAYNRTLAADIITGFNELADKSVRAIVLTGAGKAFMAGADINMVNGWTKLGNAAKIKEDLRQLVPNMIEDCPKPTIAAVNGLAFGMGCELAMACDFRIAAEKAQFGQPEVKLGIIPGGGSQRLRELVGPTRALEMISTGDPIDAQEAYRIGLVNQVVPRDELMEAAFAGRLIDKGAVVLDICKKLVYGGDLPLRGGIDYEQDQFCKILLTADAQEGTLAFLEKRK. 256
283 0.000e+00UniRef50_K1KM31 Putative enoyl-CoA hydratase echA8 n=4 Tax=Bacillales TaxID=1385 RepID=K1KM31_9BACL  ali  24  2NFQNIIVAKEQHIGIITINRPEVRNALDSFTYEEIEQAMKKFEDEQVIVVILTGSGKAFASGADIGQLQQRRFADALEP----GLQGLCKTIEESGKIIIAAVNGYALGGGCELALACDIRIASNTAKFGLPELNLGIIPGGGTQRLSRIIGKGRALDMILTGAIINADRAEQIGLVSKVVQSGSLLEETITKSIVSKGPLALKLVKAVVHGFDLNLEAALKLEKLTQAIVFESEDKLEGTTAFLEKRE. 252
284 0.000e+00UniRef50_UPI000A390DC4 enoyl-CoA hydratase n=1 Tax=Allokutzneria sp. NRRL B-24872 TaxID=1137961 RepID=UPI000A390DC4  ali  20  294..ETIIVDRKDRVGLITLNRPKALNALNLQVMQEVVAAAQDFRDPEIGAILITGSVQAFAAGADIKEMQPQSYLDVYLSDWFAG----WDALARVRKPTIAAVAGYALGGGCELAMLCDVLLAADTAKFGQPEIKLGVIPGGGSQRLTRAVGKAKAMELCLTGRMMDAEEAERAGLVSRIVPADRLLDDAVAATIASMSPTAM-MAKEAVNAFESSLAEGIHFERRLFHATFATADQKEGMAAFVEKR.. 540
285 0.000e+00UniRef50_A0A1I6DR19 Enoyl-CoA hydratase/carnithine racemase n=1 Tax=Desulfotomaculum geothermicum TaxID=39060 RepID=A0A1I6DR19_9FIRM  ali  22  3.YETIKLTREGHVAVMAFNRPQALNALSTQMARDILACLDEMEDDEIFAAVLTGEGRAFCVGADLKERKNMTK--DQMRKQRALFVRAFTAMAEFSKPLVAAVNGFALGGGTEFALCCDFIIASEKATFGLPEVGLAVIPGGGTQLLPRAIGRNRAKELIFTGRKISAREAYELGLANYVVPADNLMEMEIMLEITKNGPIALRQAKKAINGVELELHTALALEADCHLVCLATEDRDEGLLAFNEKRK. 254
286 0.000e+00UniRef50_A0A1F5UPQ9 Uncharacterized protein n=1 Tax=Fraserbacteria sp. (strain RBG_16_55_9) TaxID=1817864 RepID=A0A1F5UPQ9_FRAXR  ali  23  401.YKSIQVEIDQKIAWITLNRPHRFNTFNSEMREELPRAFQELANDDVRVIVVRGAGKAFSAGAEITEFSLGKPYQFAE------LGGVFNVPQECPKPVIAAIDGYALGGGLEFALACDFRIASKRSELGQPEINLGLIPGGGTQRLARLIGAARAKELVMLGERISAEQAAQWGLIHKVVENEDEEVRAFAEKLAAKPPVAIRLVKRVIDGSEAPMEAALFLEREAFGLLFSTEDMIEGTTAFLAKKK. 649
287 0.000e+00UniRef50_A0A256WX26 Enoyl-CoA hydratase n=1 Tax=Nitrospira sp. UW-LDO-01 TaxID=2004993 RepID=A0A256WX26_9BACT  ali  19  13........IEEGVALVTLNHPPV-NALTPEMLTELEGTFDSLADEAVKIVVLTGAGRFFVAGADIRVLASIS-SSAEGEAIARHGQTIFHNIEEIEKPVIAAINGACLGGGLELAMCCHIRIAAENARLGLPEINLGIMPGGGTQRLCRLIGQSKAMELILTGEPISAREAMSLGLVSQVVSTDDLLAQGLARKMAGKSQAALRASFRAIRGSKLDLSDGLALESRLFGALCDTDDRKEGVAAFLEKRQ. 256
288 0.000e+00UniRef50_A0A1Q7PC12 Uncharacterized protein n=12 Tax=Bacteria TaxID=2 RepID=A0A1Q7PC12_9BACT  ali  22  2TYEAIRYELTDGVATITLNRPNVHNAMNERMREELTRCFGDLARDEARVAVVTGTGRAFSAGADIREF--VAPQVPVRFREQRRRVDFRAAMDRCGQPIIAAIRGFALGGGLELALACDIRIAGEDAQLGLTEVNLAIIPGGGTQRLPRLVGRGKALEMILTGARIDAREALRIGLVERVVPAAEVLTAALARTIAEKAPVALRYAKEAVKGLALPLEDGLRLENDLATLLRTTEDRVEGAKAFLEKRK. 254
289 0.000e+00UniRef50_K1LXA8 Putative enoyl-CoA hydratase echA8 n=33 Tax=Bacteroidetes TaxID=976 RepID=K1LXA8_9BACT  ali  17  6...NILSEEKDGILYLTVNRESKLNALNLATLEEIRNIFNEVSDKDIKAVIITGSGKAFIAGADINEIAELNELNA--RKFAENGQEIFDLIENCHKPVIAVINGFALGGGCELAMACHMRIATANAKFGQPEVNLGIIPGGGTQRLTYLVGRGKANELMMTGDMIAAEEAKTLGLVNYIMPTKQEAAEEIVRKIMSKAPLAIGMIVDCVNAVYTSEENGFQTEANSFARCVKSGDYKEGTSAFLEKRK. 255
290 0.000e+00UniRef50_A0A1M5ZUW4 Enoyl-CoA hydratase n=3 Tax=Bacteria TaxID=2 RepID=A0A1M5ZUW4_9FIRM  ali  19  3....VTLTIDQHIARVVIDRPEALNAMNESVLVQMKQAVDSIQNENVRVAIFMGGGKSFVAGADINYMSSMTPL--EGEKWGKFGQSVFMAISELRCPTIAVIQGYALGGGTELAISCDLRIASEKACFAQPEVKLGIIPGGGTQRLTRLIGPGYAKQMIFTGDQFSALQALAMGLVNEVVSHDKLRVDALAQSIISGSPNGIRLAKEAIHGLQGSLNKGLQLEAALFGLCFASPEQREGMTAFVEKRK. 251
291 0.000e+00UniRef50_A8MB93 3-hydroxyacyl-CoA dehydrogenase NAD-binding n=2 Tax=Caldivirga maquilingensis TaxID=76887 RepID=A8MB93_CALMQ  ali  26  401.YETIKLTIEPPIAWITLNRPEKLNAINRKMISELMEVINRLEADRVRVIVIRGAGKAFSAGADLTMFSE--EEPTEAYLTSRMLQELTNKLETLNRPVIAMIHGYALGGGLELALACDLRIASEDAVLGLPEVTLGLIPGGGAKRLVRLIGLGKAKELILTGARLNAREAEELGIVNRVVPISELETKAIALKLAEEPPITLMVAKGILNTGEGSLEGVLTAESMGFGLLFSTKDSREGIKAFLEKRQ. 653
292 0.000e+00UniRef50_A0A0P7Z4A4 Enoyl-CoA hydratase n=74 Tax=root TaxID=1 RepID=A0A0P7Z4A4_9GAMM  ali  22  12..........DGVVRLTINRPSALNALNSDVLTALEAHLVELEAPRLRAVLITGAGKSFVAGADITEMRDKTP--EEARAFASQALRTIKRLETLPVPVVALVNGFCLGGGCELALACDWAVASENAIFGQPEVLLGVIPGGGTQRLPRRVGPAMAIDLVTTGRKIDAQEALRIGLVNRVMPQAELEVEELTKQLKGNGPQAVRGAKQAVHGMDQDLDSALALETSLFAFCFAGDEQKEGMAAFVEKRK. 254
293 0.000e+00UniRef50_A0A1F9KB38 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 TaxID=1797894 RepID=A0A1F9KB38_9DELT  ali  22  2.FKNLIVSKEGGIATVQLNRPQKKNSLNTEVRRELEAAFREIEDSGVRAVIVTGGDEIFCAGADIGEIQE-AKSAKASYQHAREFQTLFDQVEALPQPVVGAVSGYALGGGCELALACDFRIASETAKFGLPEIKIGAFPGGGTQRLPRLIGAARAKEMIFFGDPIGANEALACGLVSKVVAKEKLLAEAFATKLAAQPRLALETAKKLINGPEMDIGAALELEACGLGTLAGTHDLHEGTLAFLEKRK. 253
294 0.000e+00UniRef50_A0A1W2CBW6 Enoyl-CoA hydratase n=1 Tax=Papillibacter cinnamivorans DSM 12816 TaxID=1122930 RepID=A0A1W2CBW6_9FIRM  ali  21  3..QFVKYERENGICVVSVNRPEVFNALNMEVYGQLEGTFDRLEDPGVRVIILRGEGKAFAAGTDINMMMGCTPEEFLERTWT--VKRVLDKIESFSQPVIAAVNGMALGGGCELAMACDIRIAADSGKFGQPEINLGLIPGGGTQRLPRLVGISRAKQLVYTGDVIGAQRALEIGLVDQVVPLKDLMAEALALKIAAKSKVIMALAKNALNGFKEDLVEGLESEVRCFNACFSTYDRAEGMQAFVQRRK. 254
295 0.000e+00UniRef50_A0A182FUZ6 Uncharacterized protein n=1 Tax=Anopheles albimanus TaxID=7167 RepID=A0A182FUZ6_ANOAL  ali  21  37AYEFIKAELTGNVALITLNRPKALNALCNGLVAEISDALDRYEDDSIGAIVITGSEKAFAAGADIKEMQPNTYAKCINTDFLAN----WTRVAKAQKPIIAAVNGYALGGGCELAMMCDIIYAGDKARFGQPEIALGTIPGGGTQRTTRSMGKSKAMEMCLTGNMITAEEAERAGLVSKVVPADKLVAEALGEKISTFSPLIVRLCKEAVNAYETSLNEGLKFERRHFHATFSTKDRLEGMTAFVEK... 287
296 0.000e+00UniRef50_A0A1F9IKZ6 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9IKZ6_9DELT  ali  20  3.YQYVLYEEVDHVAWVTVNREKALNAINADVLKELQEVFGAIQNQEIRVAVITGAGKAFIAGADIAAMAQMTP--DQAAAFCLLGHKTMSQIQDCRVPVIASVNGFCLGGGLELALSCDFIYASNKAKLGLPEVNLSLFPGGGTQRLTQLVGPGRAKEIIFSARLLSAEEAREWGIVNKITAPEALEVAKTAQEIASKGPVAVSLAKRVINGLAQTLDNGLKIERDHFTDCFRAEDLKEGLTAFLEKRR. 254
297 0.000e+00UniRef50_A0A265UZJ4 Enoyl-CoA hydratase n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A265UZJ4_9FLAO  ali  18  2AFNNILTADSNGITTITINRPSKLNALNRETIQELHEALDEAQNEKTKVIIVIGSGKAFVAGADISEFADF--NVEEGSKLAAQGQALFDFIENLSTPVIAAVNGFALGGGLELAMACHFRVASTNAKMGLPETSLGVIPGGGTQRLPQLVGKGRAMEMVMTAGMIDAAQALSYGLVNHVVEQEELLAHKIADKIMRNSSVAISEAIKAINASYKDGINGYDVEIEAFGNCFGTEDFTEGTTAFLEKRK. 254
298 0.000e+00UniRef50_A0A220PSR4 Enoyl-CoA hydratase n=5 Tax=Bacteria TaxID=2 RepID=A0A220PSR4_9GAMM  ali  24  3TYKYVTTEQIGNVGVVTFNRPEALNALNEQVEMDVTDALKAFADDAIGCMVLAGGDKAFCAGADLKWIASQDFDS----AYRGNLAAYMDQVAKLRKPVVAAVRGFAFGGGTEIALMCDIIIADSTAKFALPEVTLGVIPGGGGPRLTRAVGKAKAMYYILTGKPFSAEEAERIGLITKVVEDGQLLDEALASAIASNPRLAVLAGKEAVNQAEVPLAPGLNLERRLFHGLFGTEDQREGMTAFAEKRK. 252
299 0.000e+00UniRef50_A0A101WKX7 Enoyl-CoA hydratase n=3 Tax=Bacteria TaxID=2 RepID=A0A101WKX7_9FIRM  ali  22  3.YNNLLWEQDGSVVTVSFNRPKAMNALNQETLEELEQVIKRVANDSISVLVLTGSGKAFIGGADIGELRAL-EGSMDGVALCRRAQVIAFSLEEISKPVIAAINGFALGGGLELALACDIRLAADTARLGLPETTLGIIPGGGTQRLARLVGKGMAKYLIFTGSHLTAQEALDLGIVEKVYPAGELLAKELAAKLAKGAPIALAMAKRAINGLDTDLTTGCDMEAHLFGIVVGTEDAKEGTGAFLDKRQ. 255
300 0.000e+00UniRef50_A0A2U1CF50 Short chain enoyl-CoA hydratase n=2 Tax=Clostridiales TaxID=186802 RepID=A0A2U1CF50_9FIRM  ali  21  2SYKNIKIEITGGIAVLTLNRPEVRNALDFETWEEIRSGMRELRREGVQVIIFTGAGKAFASGTDIRAIHDRTVAEQMNSEVSDTLYE----ISTHKRPVIAAIDGYALGGGCELAMACDIRIATKKSRFGQPEVGLGIIPGGGTQRLQRLVGIGKAKELIFTGDIISAEEAERIGLVEKVVEDGTVMAMEMAKKIRAKGPVAITLAKKAIQGADTDLYSGLCFERYAQALAYSTDDKAEGTQAFLEKR.. 251
301 0.000e+00UniRef50_A0A1V5CNZ7 Putative enoyl-CoA hydratase echA8 n=17 Tax=root TaxID=1 RepID=A0A1V5CNZ7_9DELT  ali  21  5...HILFEKADGVATITLNRPDKLNAFAGNMREELGAVMAGGRDKDVRVLVITGAGKAFCAGGDVNELAAGTNAKPAGATNERYMSKIVLEINSMEKPVIASVNGAAVGGGCNLALACDIRIASELAKFGEAFTKRGVHPDGGIYLLPRLVGYAKAAELIFSGDLVDAREALRIGLVNRVVPHDTLRAQELALRIARNAPLPVALAKRGLQRFEMDLAQAVDYEAFALSICASSEDMKEGFKAFLEKRE. 256
302 0.000e+00UniRef50_A0A2K2U1A4 Crotonase n=1 Tax=Clostridium sp. chh4-2 TaxID=2067550 RepID=A0A2K2U1A4_9CLOT  ali  24  2NYQYLIVTVEDGVGVITFHRPEALNALNSAVLNDLDHAVDELNDESVRVIVFTGEGKSFISGADIDELAD--SRGLQVINYSKKGCEIFRKIELLPKPTIAAVNGYAFGGGFEFLLCCDIRIANEKASFAMPEVTLGIVPGFGTQRLPRAIGVCQAKELLFTGRRIKADEALALGAINRVVPLDTFEVMAEAQTIANNSSTAIYLVKSAVNGIDAAFDVAKEVEVGYMAACFGTEDQIEGLSSFREKRK. 253
303 0.000e+00UniRef50_O07137 Probable enoyl-CoA hydratase echA8 n=49 Tax=Bacteria TaxID=2 RepID=ECHA8_MYCLE  ali  23  3.YDTILVDGYQRVGIITLNRPQALNALNSQMMNEITNAAKELDDPDVGAILITGSPKVFAAGADIKEMASLTFTDAFDADFFSA----WGKLAAVRTPMIAAVAGYALGGGCELAMMCDLLIAADTAKFGQPEIKLGVLPGGGSQRLTRAIGKAKAMDLILTGRTIDAAEAERSGLVSRVVLADDLLAKAVATTISQMSRSATRMAKEAVNSFESTLAEGLLHERRLFHSTFVTDDQSEGMAAFIEKR.. 250
304 0.000e+00UniRef50_R4KEG6 Enoyl-CoA hydratase/carnithine racemase n=3 Tax=Bacteria TaxID=2 RepID=R4KEG6_9FIRM  ali  18  3.FKTIQLEIVDSVGVIYLNQPESRNALSLEMREELRVAMEGWAREAVKVIIITGKGAAFCAGGDIRTMGNFKPT--QGRERMKNVHRFVMTLRNLEKPIIAAVNGPAFGAGWSLALLCDLIVASEKARFSLAFVKVGLVPDWGSYLLPRMIGLLKAKELMMTGRAIDAAEAYNLGLVNKVVPPEQLSAMELARELAQGPPLALGMLKNLVNRSEVGFLTLLEEEALVQDICLQTEDHREGVRAFFEKRK. 253
305 0.000e+00UniRef50_UPI0008256F08 hypothetical protein n=1 Tax=Bacillus krulwichiae TaxID=199441 RepID=UPI0008256F08  ali  20  4..KYIHCEIEEGIAKVIINRPETLNAIDKDVLNELEDTFTSIERDSVRVVILTGGGKAFVAGGDIAAMKEM--NLIEGEKFVYRGQRVLSQIENSSKVVIAAINGYTLGGGMELSLACDIRIVSEKAVLGLPEVCIGLYPGGGTQRLVRLIGKGLTKELIFTGRRIYPGEAKELGIANKVVAHEDLMQESMANMIVKNSPIAVMQAKKAINGYETSLDQALALEAEAWLVNFTTEDRVEGLSSFLEKR.. 253
306 0.000e+00UniRef50_A0A0A2T801 Enoyl-CoA hydratase n=8 Tax=Bacteria TaxID=2 RepID=A0A0A2T801_9BACI  ali  20  5....VTLEMSGHIAIITLNRPEAANSFSHQLMDDLEAVIHEVQNDAIRCVIITGSGKAFCAGADLKERSTMTQQ--QVVQTVHRIGEVVNKVESLPCPVIAGINGAAFGGGLELALSCDIRYASETSKMGLTEVSLGIIPGGGTQRLPRLIGLGKAKELIFSAKRIDANEALSLGLVEQVVPQQTLIEHAIAERIAANAPIALKQAKQAIQGYQVDLQSGLSFEWMCYQTTIPTNDRLEGLKAFKEKR.. 253
307 0.000e+00UniRef50_A0A239B6R4 Enoyl-CoA hydratase n=19 Tax=Bacteria TaxID=2 RepID=A0A239B6R4_9BACT  ali  20  3SFENLLYELNAGILTITINRPSKLNALNGATIEEIRGAMQQADDSAVHGIILTGSGKAFVAGADISELAALDEI--ASRRAAERGQEAFCMIEESSKPVIAAVNGFALGGGCELAMACHLRVASDNARFGQPEVNLGLIPGGGTQRLVQLIGKSKALELLLTADQVKAEEALRLGLVNQVVSQAELLPEQLLTRILTKAPLALGMVIDCVNAYFDKDRHGYQTEANAFARCFASEDFREGTSAFLEKR.. 255
308 0.000e+00UniRef50_A0A1I2TGA3 Enoyl-CoA hydratase/carnithine racemase n=48 Tax=Bacteria TaxID=2 RepID=A0A1I2TGA3_9FIRM  ali  20  42.FENIKLTRDGHIAVMAFNRPEAMNAISTQTAREILAALEELEDDEVFAAVFTAEGRAFCVGADLKERKTMTR--EEMKKQRALFVKAFTAVAEFSKPIIAAVNGFALGGGCEFALCCDFIIASEQAAFGLPEVGLAIIPGGGTQLMPRVIGRNKAKELIYTGRRISARDAYEIGLVNHVVPADKQMEMEIMREITKNGPVALRQAKRSINGVELDLHTALALEAECYNVCLTTEDRDEGLLAFNEKRK. 293
309 0.000e+00UniRef50_A0A1C5KV28 Probable enoyl-CoA hydratase echA8 n=1 Tax=uncultured Eubacterium sp. TaxID=165185 RepID=A0A1C5KV28_9FIRM  ali  20  3...SIIYEKNGHTALITLNRQETLNALCEKFIAEINETLDRAEDPDIYTIIITGSGKSFIAGADISEMYEKDEMS--IMPWAALACDLCMRIENMDKPVIAAINGYALGGGLELAMACDIRLASENAKMGLPETGLGVICGGGTQRLPRLIGTGAAKEMIYTAKIIDAQTAKELRLVNRVTSQGSLTDEALAHDIEKNGQLAVRAAKRSINASDMSIQSGCLFERENFSALFATEDQKTGMGAFLEKKK. 251
310 0.000e+00UniRef50_F0P1K9 Enoyl-CoA hydratase n=96 Tax=root TaxID=1 RepID=F0P1K9_WEEVC  ali  21  3.YNNLLVEVTDGIALVTLNRPQALNALNKALLDELSHFITVAEDKAIRVIILTGAGKSFVAGADIKEFASFNGEQGERLAAEGQVN-VFNKVENSCKPVIAAVNGFALGGGLELSMASHFRIASTNAKMGLPEVTLGLIPGGGTQRLPKLIGKGRAMQAIMTAEMFSAERALEIGLVNEVVDLENLLPREIAEKITKNSSVAIAKAIKAVN--DSDKEYGFETEIKSFGYLFDQEDFKEGTTAFIEKRK. 252
311 0.000e+00UniRef50_UPI0009E864DC enoyl-CoA hydratase/isomerase family protein n=4 Tax=Bacillus TaxID=55087 RepID=UPI0009E864DC  ali  22  10TYETIVFENNNGIAKITLNRPEQLNALNYAMLLDLDKAVSRIEDDTIRVLIITGAGRAFSAGGDVKGFENAT--IRHMNHQMEIGNRVVTNIANLKIPVISAINGHAVGLGFNFALAGDIIIASDKAKFSQIFIKIGVIPDGGTFFLPRLIGLAKAKELMFTGRMLDAKEACDMGIVSRVVNSEDFEIEKLAHQFSQAPTKAIGIMKQLLNSYDHDLQTALSYEQLGQNLVLDSDDYHEGVQAFIDKRKF 264
312 0.000e+00UniRef50_B9L259 3-hydroxybutyryl-CoA dehydratase n=8 Tax=Terrabacteria group TaxID=1783272 RepID=B9L259_THERP  ali  20  2...SVRVEREGAITLVTVERPERLNALDTATLRALLAAVQELAEEAIAVVVLTGAGRAFIAGADISEMVEKSP--AEALAFAELGHAVCRAIEEAPQPYIAAVNGYALGGGCEIALACDIRLASERAVFAQPEVTLGIPPGGGSQRLPRVVPPGIARELLYTGRRVDAQEALRIGLVNAVYPADQLLARELANRIAANGPLAVRLTKAAVRGLEQGLEAGLTYERQVFAYAFTTEDQREGMRAFLEKRR. 251
313 0.000e+00UniRef50_C7GZN1 3-hydroxybutyryl-CoA dehydratase n=1 Tax=Eubacterium saphenum ATCC 49989 TaxID=592031 RepID=C7GZN1_9FIRM  ali  20  2.YKNLIYDVDGKVAKITINRPKAMNALNEEVLSEMYEALLQFEGGSEKVAMITGAGKAFVAGADIQAMVSMDNL--KAHELACLGHRLMNKIESCEKPVIAAINGFALGGGLELAMSCDFRLASTAAKFGQPEIALGIIPGSGTQRLTKLVGTGMASYMIMTGEMIDAKRAFDIGIVEKIIDEDQFEDEKIAEKMASKSIYALKAGKQTINGVNMDILRGSRLEIESFAQLFSTEDQKEGMSAFLEKRK. 251
314 0.000e+00UniRef50_A0A1F9AS18 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_49_15 TaxID=1797827 RepID=A0A1F9AS18_9DELT  ali  20  3.FENILLEMEGALAVLTINRPDKMNAVNNATVEELDQALSAIENPDLRVLILTGAGKAFVAGADIHELN--LRDSVRGRIETRRRQEVYTRIEQLEIPSIAAINGWALGTGLELAMACTIRLASTNSKLGQPEVKLGIMPGGGTQRLPRLIGMGRAMEMILTGEPVDAQRAFEMGLINKITPSEALMAEALAMMLASRPKLAIQYGKEAVRYPEGSFAQGLAHESYLHALSCGTQDKKEGISAFLEKRK. 254
315 0.000e+00UniRef50_A0A1L8ZJ06 Enoyl-CoA hydratase n=6 Tax=Bacillus TaxID=55087 RepID=A0A1L8ZJ06_9BACI  ali  20  3NYEYIQVDQEESIGIIRLNRPKVLNALNRKMVSEIVQSMREMRNDSVRVIVLYGNGKSFAAGADITEMAQ---DDSIHLELLNQFAE-WDDLAHIKKPIIGAVHGFALGGGFELALVCDLLFASEDAKFGFPEINLAVMPGGGTQRLTKLMGKTKALEWLWSGEMMTAETAEAWGIINRRYPQEILVEETLARNLANKPALSVRFIKEAVYAVDYSLYEGMQYERKNFSLLFSSDDQKEGMKAFVEKRK. 252
316 0.000e+00UniRef50_A0A2D6LRC5 Enoyl-CoA hydratase n=10 Tax=Bacteroidetes TaxID=976 RepID=A0A2D6LRC5_9FLAO  ali  22  8......IEVQDSIGWIKINREKKLNALNRELINELHDRMINFQNSSVKVIVLTGNGKAFVAGADISEFS--SFKPQQAAAFARHGNQLFDLITQLEKPVIAAINGYALGGGLELAMSCHLRIAVQHAKLGLPEVSLGVIPGGGTQRLPALIGKGNAMEMILTGDMICADKALELGLVNQVVPAEKLLDATLAKRLMKNSPNSIKNAIKAINASDVNLK-GFNEENLQFSLCFGTTDFEEGVAAFLEKRK. 253
317 0.000e+00UniRef50_A0A085L9L3 Uncharacterized protein n=3 Tax=unclassified Peptococcaceae TaxID=208050 RepID=A0A085L9L3_9FIRM  ali  22  2.YETILLEQKEAVGIITLNRPKKLNALNRKVVAEMGTAIKEFHDSEIKTVIITGGEKVFGAGADIDEISQLS--VFESYLYSKDIHNLFLEIENLPKPVIAAIGGIALGGCLELVLSCDVRLASEKAKLGVPEINLGLLPGGGTQRLPRLVNSSWAKWMLFSGQPINANEAYQIGLVQKVVPEGEVLNEALAVEFAGKPAVALATIKDLVNGMGLELPSALKYESRGFGMLFSTEDMHEGTKAFMEKRK. 252
318 0.000e+00UniRef50_H5SR96 3-hydroxyacyl-CoA dehydrogenase 2/enoyl-CoA hydratase I 2 n=1 Tax=Acetothermus autotrophicum TaxID=1446466 RepID=H5SR96_ACEAU  ali  24  398.YKTIKVEIDKHVAWVTLNRPQRLNAINAEMREELPKVFAELRDDDVRVIVLRGEGKAFSAGADITEFTQGKPYQFVE------LGEFFRTPELCPKPVIAAIDGFALGGGLELALACDFRLASKRSEVGQPEIHLGLIPGGGTQRLLRLVGPARAKELCMLGERISAEQAAQWGLIDHVYENEEQEVKAFAEKLASRAPIAVRFTKQIINGADCSLEAALLLEREAFGVLFTTEDMAEGVTAFLSKKK. 647
319 0.000e+00UniRef50_A0A173MNM1 Enoyl-CoA hydratase n=11 Tax=Bacteria TaxID=2 RepID=A0A173MNM1_9BACT  ali  20  3....VVTALENGIYTITINRPDKLNALNRDVINGLSEALNEVNNPDIKSAILTGAGKAFVAGADISEFTELDAAGGE--ELARRGQQLFDKIENSPKPIVAAVNGYALGGGCELALACHFIIASDNARFGQPEVNLGLIPGGGTQRLTQAVGKGRAMQLIMTGETFAAQQAMEYGVVNEVVAPDALLVKNILLVIHSKAPLAIAKVIESINHFDHT-HKGYDFEIKKFGECFGTEDKKEGAAAFLEKRK. 250
320 0.000e+00UniRef50_A0A0L0BYU8 Uncharacterized protein n=1 Tax=Lucilia cuprina TaxID=7375 RepID=A0A0L0BYU8_LUCCU  ali  21  295..KTQLVGEKKNVALITLNRPKALNALCNGLMCELNSALDNYEDENIAALIITGSEKAFAAGADIKEM----EYNTYDKLIMNVSASDWTRIAKCQKPLIAAVNGYALGGGCELAMMCDIIYAGHKAKFGQPEIALGTIPGGGTQRLTRVIGKSKAMEMCLTGNMISAEEAERRGLVSKVVPADKLLDEAIGEKIASYSQLTVQLCKDALNAYESNLHEGLKFEKRIHHATFATQDIREGMAAFVEKRKF 545
321 0.000e+00UniRef50_S6GS31 Enoyl-CoA hydratase/isomerase n=5 Tax=Bacteria TaxID=2 RepID=S6GS31_9GAMM  ali  18  4.FENVLLEKDGNVYCLTINRPKVLNALNQQTLLDMSAALQVVADDSARVLLVTGSGKAFVAGADISQMQNLTPL--QAKKFSETALAVFRRFETLDIPAIALVNGFALGGGCELALSCDFILASENAKLGQPEVCLGVTPGGGSQRLPRIVGRAMAMEMLVSGRMVDANEALQRGLVNHVYPQADLLQQKLAAKICSNGPVAVKLSKELVRGQDLDLENACAMESDLFGLSFASDEQSEGMQAFLEKRQ. 256
322 0.000e+00UniRef50_A0A1I2TG30 Enoyl-CoA hydratase n=3 Tax=Bacteria TaxID=2 RepID=A0A1I2TG30_9FIRM  ali  21  5.YETLLYEVKDRVGIITINRPKQLNALNSQVYRDLYCILKQIEDDQVSAVIITGSGKAFIAGADITEMKNMTAN--EARSFAILGKKVGIAIKEMPQPVIAAVNGFALGGGLELALSCDLILAVEKAKFGLPEINLGIIPGGGTQRVTRLTNIIIAKELILFGGRINAQRACELGLINKVVTSEEAEAMEWAGKLVQKSVIALSLAKSAINGIDASLETALSYELQCFAQCFASRDQEEGMTAFLERR.. 256
323 0.000e+00UniRef50_A0A1V6H9Q7 Putative enoyl-CoA hydratase echA8 n=7 Tax=cellular organisms TaxID=131567 RepID=A0A1V6H9Q7_9BACT  ali  20  2.....LTTREGRVAILTVNRPEKLNALNDQVRDEMLAALAALEDDGIGAVVITGSGKAFIAGADIGEFAGRTPFDQ---RHAMRTPRIFDVGAEFPKPVIAMINGFCLGGGCELAMGCDLRVAADTARFGQPEIKLGLIPGGGTQRLPRLVGLGQALRLILTGEMIGAAEAREIGLVDLVYPAAELRARELAARIAAFSPLTLKVAKEAVRASQLPIAEGLRYERDLFCLCFATADKEEGVAAFLAKR.. 247
324 0.000e+00UniRef50_F5L6I8 Enoyl-CoA hydratase/isomerase n=4 Tax=Bacillales TaxID=1385 RepID=F5L6I8_9BACI  ali  22  2..ETIRFEVQDKIATITFNRPRVLNAFNLELHEEFYHALSTAEDEAVRCIVLRGEGRAFSAGADLKAMQERDETVDVGDYLRQTYNRTIKLMTEIEKPVVATVHGPAHGAGLGVALAADFRIASESANFCLAFIKIGLMPDAGTYFLPRLIGLGRALELAASGETIDAKQAYAMGLVNRVVSDDRLEEEQLATQLASMPTKAFGYMKKMLSSFESDLSTVLEAEAQGQSILANTEDHREGVAAFYEKRK. 253
325 0.000e+00UniRef50_A0A2H5YHT8 Short-chain-enoyl-CoA hydratase n=23 Tax=Bacteria TaxID=2 RepID=A0A2H5YHT8_9BACT  ali  20  4.FKNIIYEKKGRLAYVTINRPERRNAIDPETSKELYDAFHDFDDPEVWVAIVTGAGDAFSAGADLVAMAE-AFAGGGRPAYNVPFAGITRGFE-CWKPIIAAINGYCLAGGLELALCCDIRIAAEHATFGLPEPKRAIIPAGGTQRLPRAIPLAYAMELLLSGERFDAQWALRAGLVSRVVPKEQLMAEEVAEKILECGPLAVRAIKQALRGLEMPLDEGLALEARLAGEVFSSEDAREGPLAFAQKRK. 255
326 0.000e+00UniRef50_A0A1I8D4H4 Uncharacterized protein n=1 Tax=Rhabditophanes sp. KR3021 TaxID=114890 RepID=A0A1I8D4H4_9BILA  ali  19  280..EMIKIEVNKDVALITLNRPKALNALCNQLMTELTTNLQALDDDSVKCFVITGSEKAFAAGADIKEMVDQEFKNVISGNFLAHWADV----AKINKPVIAAVNGYALGGGCELAMMCDIIYAGEKARFGQPEINLGTIAGGGTQRLTRAVGKSLSMEMNLTGNMITAEEAKEAGLVSKIHPPAKLVEEALGDRIALQSPIVVKLAKEAVNAFETTLAEGLSLERRYFHSTFALKDRKEGMTAFSEKRK. 530
327 0.000e+00UniRef50_A0A1B9EID3 Putative enoyl-CoA hydratase echA8 n=163 Tax=root TaxID=1 RepID=A0A1B9EID3_9ACTN  ali  20  14.YSTILVERRGRTALLTLNRPKALNALSLDVMRETVEATEALRDPDVGCIVVTGSGKAFAAGADIKEMQPQSYMDMYLSDWFTA----WDRLGQLRTPTIAAVRGYALGGGCELAMLCDLVIASESAVFGQPEIRLGVIPGGGSQRLTRAVGKAKAMDLCLTGRNMDAEEAERAGLVSRIVPDAELLTEALAETVAGMSAPVAMMAKEAVNAFETTLAEGVRFERRLFHAVFATADQKEGMKAFTEKR.. 262
328 0.000e+00UniRef50_K0IJ40 3-hydroxybutyryl-CoA dehydratase n=15 Tax=Thaumarchaeota TaxID=651137 RepID=K0IJ40_NITGG  ali  20  2..KYIQLEPQGDIAIVRINRPEALNAMNVDVIAELSKTIDILADESVKVVIITGAGRSFCAGADISYMVNIEPMQAE--RYATSAQAVINKIERLEKPVIAAVNGFALGGGCELAMACDIRIASSNAKIGQPEVTIGIPPGGGTQRLMRLVGPAKAKEMIFTGKMITADEAHQIGLVNKVVPDDKLMDEALAKEITKNSFVAVKVSKMLINGMDSDLETGLRLEIYGWALCFAHEDRQKMMSAFLNKGK. 281
329 0.000e+00UniRef50_A0A1B3E983 Enoyl-CoA hydratase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A1B3E983_9PSED  ali  22  2SYSTILVEQHESVGLITLNRPQVLNALSEQLMTELGQALRAFEDRTIRAMVITGSDKAFAAGADIAELRDKAFADVYLEDFVTAS---WEEVTRCRKPVIAAVRGLALGGGCELAMMCDLVIAAEDARFGQPEVKVGTLPGGGTQRLTRAIGKAKAMDLCLTGRLMDALEAERCGLLSRVVPAERVLDEALAAQIAGLSEVAVKLNKEAVRAFETTLAEGVHFERRLLHASFGSEDRKEGMSAFLEKRR. 252
330 0.000e+00UniRef50_X6NCY6 Enoyl-CoA hydratase/isomerase n=1 Tax=Reticulomyxa filosa TaxID=46433 RepID=X6NCY6_RETFI  ali  22  43SFEYLLLEKRPGVAIIQLNRPKALNALCLGLLEELVNLLQTLDDSSVRSIVLTGAGKAFSAGADIKEMEPKNYMDVYKEDMFTIADKIA---YNVRKPIIAAVNGFALGGGCELAMTCDIIIASDKAKFGQPEINLGTIPGGGTQRLTRAIGKSRAMELCLTGDLITAQQASEWGLVSRVVPHEKVLQEAIAEKIAKKSPIAI-ICKEAVNSFESSLKEGVLFERRLFHSTFSTKDQKEGMSAFSQK... 326
331 0.000e+00UniRef50_A0A0M9GVL1 Enoyl-CoA hydratase n=140 Tax=Bacillales TaxID=1385 RepID=A0A0M9GVL1_9BACI  ali  22  4TYEYIEVSIESSIGIIKLNRPKVLNAINRPMVTEIVTVLEEFRNDEVKAMVLAGNGRAFAAGADIDEMAEATAIELELLNQFTE----WDRLAWVKKPIIGAVQGFALGGGFELALCCDILFAAQDAEFGFPEISLGVMPGGGTQRLTKLMGKSKAMEWLLTGDRMSAKEALHYGVINRVIPKELLLEETMAQKIAKQPPLSLRLIKESVHAVDYSVYEGMQYERKNFYLLFASNDQKEGMRAFKEKRK. 253
332 0.000e+00UniRef50_N9ZPU0 Uncharacterized protein n=1 Tax=[Clostridium] bolteae 90B8 TaxID=997897 RepID=N9ZPU0_9FIRM  ali  19  3.FSTILFEKRESIAIITMNRPQIYNALSRTVLIELDAAMDEIEDDDIHAFIITGAGKAFVSGADINELNGLG--SVDGVKWMFYGQKVFTRIERCLKPSIAAVNGYALGGGCELSMVCDIRIASENAKFGQPEINLGNMPGWGTQRLQRLVGISRAKQMIFTGEFLNARKACEWGLCSDVLTDRRDEAERLAKLISSKGSIALACCKQAIQGSDAPIDTGMALEAYGVGICLSTEDQTEGVNAFLEKRK. 255
333 0.000e+00UniRef50_E1V567 Short-chain-enoyl-CoA hydratase n=15 Tax=Bacteria TaxID=2 RepID=E1V567_HALED  ali  22  5.....LIEVRDGIVRLTINRPKALNALNSEVIAELERLLIDLERDDLRAVLLTGAGKSFVAGADITEMRSKTPQ--QARDFAGQALRTIKRLETLPVPVVALVNGFCLGGGCELALACDWAVASDNAVFGQPEVQLGVIPGGGTQRLPRRVGPAMALDLVTTGRKIDAAEALRIGLVNRVMAQDELEADELTRQLGGNGPQAVRSAKQAVHGLDQDLDTALALENSLFALCFAGEEQAEGMSAFVEKRK. 254
334 0.000e+00UniRef50_A0A150LE06 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase n=97 Tax=Firmicutes TaxID=1239 RepID=A0A150LE06_9BACI  ali  22  2.YETILYEVKNQVAWITLNRPDKLNAFNEQMKVEVRNALDAAKDHDIRSIVITGAGRAFCSGQDLQSVKEDTDYGELLRKY---YNPMIREMASIEKPIIAAINGTAAGAGLSLALACDFRLATANASFIEAFIHVGLVPDSGMYYLPRIVGHAKALELAILGEKISAEEAKNIGLITKVVPLEEWETTHFAEKLAKMPTKAIGLIKRYMNSWDSNLQEVLDKEAYAQRIVGQSSDHKEGINAFLNKRK. 251
335 0.000e+00UniRef50_X5KP57 3-hydroxypropionyl-coenzyme A dehydratase n=56 Tax=Bacteroidetes TaxID=976 RepID=X5KP57_9FLAO  ali  19  2...NINTRQENNIFTIEINRPESLNALNGQTLQEINEAVSHAENPEIRVIIITGSGKSFVAGADIKEFSDYNADQAEEMSRKGHLN-VFDKIENLKKPVIAAINGFALGGGLELAMACHIRYASETARLGLPEVTLGLIPGGGTQRLPKLVGKGLANEIIFSAKMIPAQRAKEIGLVNDVFPLTELMDKELASTIAKNSPLAITEAIAAVNASYS--ENGFEKEIKSFGKLFELEDKKEGVAAFIEKRK. 249
336 0.000e+00UniRef50_A0A1H4AAD3 Enoyl-CoA hydratase n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1H4AAD3_9BACI  ali  22  4.FHTLLLQKSEQLAYIIINSPEQRNALTKETLSEIKLALEQLRNDSIKCVIFTGQGKSFAAGADINQLNKKAPIDVFQ---VGNMQELYTFIESYEKPTIAMVNGYALGGGCELAMACDIRIASKNAKFGLPELNLGIIPAGGTQRMSRLIGKGRALHLILTGKLITAEEAERIGLISECVSQDKLEVEKNAAQIVSKGPLAVKLAKMAINGYDADMQTGLLVEQLAQGILFSTEDKNEGTSAFLEKR.. 253
337 0.000e+00UniRef50_UPI0006D1B666 hypothetical protein n=1 Tax=Syntrophomonas palmitatica TaxID=402877 RepID=UPI0006D1B666  ali  21  4..KTVLYWKDDGIATVQINRPEVLNAINEDVLIDLSLVLDDVADPQVKVLVVQGDGNAFAAGADIKNFVSYGPQDA--HNYIYQVQVTMNKIMALGKPTLASIAGYALGGGCEMALACDIRIAADNAFFGLPEINLGIVPGGGTQRLTRMVGEGKAKELIFLGEVFNAQQAFQLGLVNFLVSAEELKEQKIAKKLSKKPPLAIRTAKELIHSYDVDIYTGLMMEKEKFAFLFSSDDQKEGMTAFLEGRK. 253
338 0.000e+00UniRef50_A0A2U3CEQ2 Uncharacterized protein n=1 Tax=Candidatus Heimdallarchaeota archaeon B3-JM-08 TaxID=2012493 RepID=A0A2U3CEQ2_9ARCH  ali  20  2TYSNIIVTTENRITTIKINREKALNALNEKTIVELHDCIDQLQSEDTKVVVITGVGKSFIAGADITMFEGKSPTS--IRKLILKLQETLNKLEDLPFPVIASINGYCLGGGIELAMACDLRIASSTAIIGQPEIKLGLIPGGGTQRLSRIVGTGRAKEIIFLGDNVDAESAKSFGLVNWVVPPENLEEKTLASRLAKGPSFALNMAKEVINGPESSLLDAIRMEAELFALCFAHEDVKEGVNAFLNKRK. 254
339 0.000e+00UniRef50_E4TL21 Enoyl-CoA hydratase/isomerase n=145 Tax=Bacteria TaxID=2 RepID=E4TL21_MARTH  ali  19  4.FENLQLANENGVLTITINRAEKLNALNIATIEELREAFQDIDNNEVKSVILTGAGKAFVAGADISEISELNEMN--GRKFSENGQEVFEMIEKCHKPVLAAVNGFALGGGCELAMACHMRIATPNAKFGQPEVNLGIIPGGGTQRLTQLIGKGKALELMMTADFIGAEEAKSLGLVNHIAEQEELMANAILSKINSKAPLAIGMVIDSVNAYYTGEENGYQTEANSFAACCKSEDFKEGTKAFLEKR.. 254
340 0.000e+00UniRef50_E4TK04 Short chain enoyl-CoA hydratase n=85 Tax=cellular organisms TaxID=131567 RepID=E4TK04_CALNY  ali  20  3.YSYLRFEKTDGVFKLVIDRPNALNALNSDVIAELQSFFEKIVNDSIKAIVLTGGGKSFVAGADIKEMVNLTAQDSMN--FARKGQQLLLTMYNCPKPIIAAVNGYALGGGFEMSLCCDMIFASENAKFGFPEVTLGIIPGGGTQILRRLVGEKAAKYLILSGEIISAAEAYRMNVVNRLFKPEEVVAVEFAAKIAKNSPSSVAYAKKAVNSFDLSMERGLEYESSLFGTLFNTEDQKEGMKAFIEKRK. 257
341 0.000e+00UniRef50_A0A1Z5HWN4 Enoyl-CoA hydratase/carnithine racemase n=2 Tax=Clostridia TaxID=186801 RepID=A0A1Z5HWN4_9THEO  ali  22  3.WETIEVAREDHVAIVSFNRPEALNALSTQMAKDLINVLGYLEEKDVWAAVLTGGSRAFCVGADLKERKNMD--TEQMKRQRALFVKAFKTVMNFPKPLIAAVHGYALGGGFEFALGCDFIIADETAVFGLPEVTLAIIPGGGTQNLPRIIGKHRAKELIFTGRRISAPEAAAWGIVNRVVPEGELEKRELMKEITQNGPIALQQAKRAINGVEVELDTGMAFEAECYNVCLTTEDRNEGLRAFNEKRK. 254
342 0.000e+00UniRef50_F8I2X6 Enoyl-CoA hydratase/isomerase n=5 Tax=Firmicutes TaxID=1239 RepID=F8I2X6_SULAT  ali  22  4AYRWLEFTMADGVATVRLNRPETLNALTDELLLELQDAVKTVERSEARVLVLTGQGRGFCSGQDLKSFGDNPTQRDIGEHLDRYYHPLIERLSGLSKPSIAMINGVAAGAGMSLALACDFRIAAEEARFSQAFVKIGLVPDSGSYFLPRLIGISRALEMAMTGKMIDAQTAYAWGLVNRVVPLAQLADETWARSLAAGPPIALSLIKRAMRGSELRLSDALAFEKDSQIRAARTEDHQNAVKAFFEKR.. 256
343 0.000e+00UniRef50_A0A2G5WHS6 Enoyl-CoA hydratase n=4 Tax=Bacteria TaxID=2 RepID=A0A2G5WHS6_9BACL  ali  21  3TYKSILVEKNDQLAYIIINLPEQRNPLSKDTLKEMKDALEELKDEETKCIIFTGQGKSFAAGADISQLKDRVPLDVL---LPGSMQETYDYIEAYDKPTIAMINGFALGGGCELAMACDIRIASDNAKFGLPELNLGIIPGGGTQRMARLIGKGKAIELILTGKIISAIEAEKIGLVSEVVPLEQLAVEKTAGQILSKGPLAVKLAKMVIHGFDTDIKTGQIVEKLAQAILFSTEDKNEGTSAFLEKR.. 253
344 0.000e+00UniRef50_A0A235BRU1 Crotonase n=1 Tax=candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 TaxID=1973747 RepID=A0A235BRU1_9BACT  ali  20  3.FRNLKVSEADGIGWLRFGRPPV-NALNTETLFEVERAFDWFEQDDVLVVVLTGEGKAFVAGADIAEMKDFSP--MQAREFSRHGHQAMGKVASIGKPVIAAINGFALGGGXEIALACDIRVMADSARIGQPEAKLGLVPGGGTQRLPRLVGPGIAKELIYTGEAIDASLALRIGLVNRVVPKEKLLVTELAKKIARNGPNALRLAKATIDGLDADLTTGNSYEAAAFGKCFSSGESAEGIAAFLEKRK. 252
345 0.000e+00UniRef50_A0A1N7P0N6 Short chain enoyl-CoA hydratase n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A1N7P0N6_9GAMM  ali  24  3NYQDILVEVQSGVLTIRLNRPEAHNALRTQLLKELADVLDKATNDNIKTVVITGSDTVFAAGADIKEMASLDAVGVMNDPRPTY----WRRIALFPKPIIAAVNGFALGGGCELVMHCDIVIAGDNALFGQPEINLGIIPGGGTQRLIRTIGKSMAMQLVLSGEFISASQAQSLGLISEVTIPERERATELARKIATKPPIAVRLAKELLKAYETTLESGLNLERKSFTLLAATQDRNEGIAAFMEKRK. 253
346 0.000e+00UniRef50_A0A133XZW6 3-hydroxybutyryl-CoA dehydratase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A133XZW6_9BACT  ali  21  5.FKNIQLKAMDKVAYIYLSRPTALNALNSETLCELNDALDEVQKNSFHALVITGEGKAFAAGADIAEMQHFS--SEDAVHFSEKGASLYRRIEHFPLPVIAAVNGFCLGGGCELALACDIRYASEKAKFGQPEVGLGLMPGSGTQRLPRLVGAAMAKELIFSARIIGAEEAFRIGLVNRVVAPEELLVDGLVQEIAQQSPNAVTLSKEAINGLASSLDSGIAIESDLFGRSFASPERDEGIRAFLAKEK. 256
347 0.000e+00UniRef50_A0A1V9YJB4 Enoyl-CoA hydratase, mitochondrial (Fragment) n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YJB4_9STRA  ali  20  269..EYIKTNVVGKVAIIELHRPKALNALCDGLMQEVNAAAKAFDDDSVSAIILTGSDKAFAAGADIKEMATREFIDVYNQSQFASWGD----ITKVHKPVIAAVNGFALGGGCELAMMCDFIIAGDKAKFGQPEIKLGTIPGGGTQRLVRAIGKSKAMHLVLTGDMIDAHQAERDGLVAKVVPADKLMEEAIANKIAGYSQPITRMAKEAVNAFEMSLQEGLKYEGRLFYSTFATHDQKEGMDAFVNKR.. 515
348 0.000e+00UniRef50_F2LY45 Enoyl-CoA hydratase n=1 Tax=Hippea maritima (strain ATCC 700847 / DSM 10411 / MH2) TaxID=760142 RepID=F2LY45_HIPMA  ali  17  4....IILEVKEGIAYITINRPEKMNALDDEAQRELNQSIDEVNNKDIRCVLIAGSGKSFVAGGDIGLLKKLSPK--QAVDFARTSQEIFSKMEQSEKPFIACVNGYALGGGFELALACDFIYATENAIFGLPETSLAIIPGGGTQNLSRLVGKNIAKELIFTARRITAKEAKELGIVSRVFKTKEEMAEETARQIMKNGPIAVGLAKRAIDGFDQTRDEGLKYEASLFGLAFATEDAKEGLTAFLEKRK. 253
349 0.000e+00UniRef50_R4KJF1 Enoyl-CoA hydratase/carnithine racemase n=3 Tax=Peptococcaceae TaxID=186807 RepID=R4KJF1_9FIRM  ali  23  3.FQNLLIEKDGHIAIVTLNRPEVRNALDPRTWAEIRGAARQCRDKDVRVVIITGAGKAFASGADIRSLREXXXXXXXXXXXXXXXXXXXXX----DKPVIAAIDGFALGGGCELALACDIRIATSRSKLGQPEVNLGLIPAGGTQRLQRVVGIGKAKELIFTGDIISAQEAKEIGLVNKVVEPEDLLAKEMAQKIIAKGPMAISLAKVAINGTNTDINSGLLFEKFAQTIAFSTEDRIEGTTAFLEKRK. 253
350 0.000e+00UniRef50_A0A1F8ZJS9 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_51_10 TaxID=1797828 RepID=A0A1F8ZJS9_9DELT  ali  22  2AFQNIIFEKDKGIARIIINRPEKRNALNRETRKEMGEALEQIRDESIRVLIFRGTGESFIAGADVNDLKTFSPLGMFQY-MNTLGQKLYNDIENFPIPTIALINGFCFGGGVELALSCDMRIASENAKFGQTEILLGFIPGGGTQKLPRLIGAGLAKELMFTGKVIDAREAERIGLVNRTVPLKDLDQEAIAEKICSLSPVAIRVCKEAINAAQSSLNAGLAYEVMAETLCFSSEDRSEGIQAFLDKR.. 254
351 0.000e+00UniRef50_A0A0T1W3B7 Enoyl-CoA hydratase n=17 Tax=cellular organisms TaxID=131567 RepID=A0A0T1W3B7_9MYCO  ali  21  2SYETILVTREGRVGTITLNRPKALNALNSQVMVELTTAAAEFDADAIGAIIVTGNAKAFAAGADIKEMSELSFADV----FAGDFFATWSKFAATRTPTIAAVAGYALGGGCELAMMCDILIAADTAKFGQPEIKLGVLPGGGSQRLTRAIGKAKAMDLILTGRTIDAAEADRSGLVSRVVPADTLLEEATAAVIAGMSLSASRMAKEAVNAFESSLTEGLLYERRLFHSAFATDDQTEGMAAFTEKR.. 250
352 0.000e+00UniRef50_A1WIW1 Short chain enoyl-CoA hydratase n=46 Tax=Proteobacteria TaxID=1224 RepID=A1WIW1_VEREI  ali  19  10...SVLYERRENVAIVTLNRPGRMNTLGGSMKPDLARAFFEYADERVRAVLITGSGRAFCAGADIKERADQQTTGSDYFVAQKATHELLRNIEEFEKPVVAAINGVALGGGLEVALCCDIRLACDSARFGLPEVKLGVIPAGGTQRLPRLIGQARAKELILTADLIDADTALRYGIVSRVLPQAELMAIAFAQRIAEHPPLAVRFAKRAINGLQTDLDSGLEYERYAAAMVIDSADRKEGMRAFVEKRK. 262
353 0.000e+00UniRef50_A0A0U1LTN9 Enoyl-CoA hydratase n=1 Tax=Talaromyces islandicus TaxID=28573 RepID=A0A0U1LTN9_TALIS  ali  21  36SYEHILTEVKPGVGLITLNRPKALNALSSPLFAELNDALSKYEDKDIGAIIITGSEKAFAAGADIKEMAPLTFSSAYSNNFIAPWSHLANTIRT---PVIAAVSGYALGGGCELALMCDIIYCTDKATFGQPEIRLGTIPGGGSQRLTRAIGKSKAMELILTGKNFSGKEAGEWGVAARVIEKDELLAETLAETIASYSRVAVIAAKEVVNSQELSLREGVEYERRLFHGLFGSKDQKIGMTAFAEKKK. 289
354 0.000e+00UniRef50_A0A1B1Z2U3 Enoyl-CoA hydratase n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A1B1Z2U3_9BACI  ali  20  2NFEYLLLNVEDHIGTITVNRPEKRNAMNSESWIELRDAVSYFNRQEVRVIVITGAGDSFVSGADIEWLRDRQPLDIYGSA----VQDVLLSVYQSKKPVIAAINGYALGGGCELATVCDFRIASEHAKFGQPEITLGILPGGGTQQLTRLIGLPRAKELILTGKIINAQQAFEYGLINEITSKENFKDREFAKSLASKPPVALMLAKIALNSVTTDLNAGLALEKSLQAILFSTQDKIEGTTAFLEKRE. 252
355 0.000e+00UniRef50_A0A1V5DZ97 Putative enoyl-CoA hydratase echA8 n=8 Tax=Bacteria TaxID=2 RepID=A0A1V5DZ97_9DELT  ali  20  2TEQVVLYEKKENIAIITFNRPGALNALNTEVNLKLIELLLTAENDEVKVVILTGSGKAFVAGADIKEM--MTMNSMQARAHALKAKRVTDTIWNLGKPVIAAINGFCLGGGMEYALACDLRTASENAKFGLPEVNLGILPGAGTQRLPRLIGLARAKEYCFTGGMFDAKQACELGIVNHVYPAESLMTMMLAQKIASKSPHSLKLIKAAMNGTETDLETAALFEIDCFSLCFSTQEQKDGMKKFAEKSK. 254
356 0.000e+00UniRef50_A0A2M7SNC9 Uncharacterized protein n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2M7SNC9_9DELT  ali  16  3.YEDIIFRKENRVATIVLNRPDSLNALGGSMREDIINAIQDVRDKNIGALVITGAGRAFCAGGNIKEMEKMSVEVPERRAFVRSVHRIITEIRNLEKPVIASINGHAIGAGCNIALACDMRIASDNAKLGVSFINMGLVSDGGLYFLPKLVGTANALELYFTGDVIDAKEAERIGMVNKAVPPEELATYDLAGKIAKKAPIALGMIKEILYGLNMDLASELDLEANAQSICLKTEDHREGVRAFLEKRE. 258
357 0.000e+00UniRef50_H1ZCA0 Short chain enoyl-CoA hydratase n=4 Tax=Bacteria TaxID=2 RepID=H1ZCA0_MYROD  ali  21  2NFETLQYQQDGYVGTLTINRPDALNALNNTVLAELKSFAEQAKSSDLRVLIITGSGKAFVAGADIKAMQSMTA--AEATEFSYTAQAAFNAIEALPFAVIAAVNGFALGGGCELALSCDIILASEKAKFGLPESTLGLLPCGGTQRLPRAIGLYKAKEMVFTGDFYSAAACEAMGFVNRVIAPEELLASAMAQTIASRGPIAVAKAKESMHGFDLSLADGLKQEGALFGELFHTADQKEGIGAFVEKRK. 254
358 0.000e+00UniRef50_F5SJL1 3-hydroxybutyryl-CoA dehydratase n=79 Tax=Bacteria TaxID=2 RepID=F5SJL1_9BACL  ali  20  7...TITWQLEEGVGVITLNRPEVYNAFNREMDRALTTALKEAADADVRALVITGAGKAFCSGQDLNDRSDPNGSLSLGESVRERYNPLIRTIAEMEKPVIASVNGVAAGAGCSLALACDMRIVSDRAKFVEAFVRIGLVPDSGSWFLPRLIGFGRAMELLVTGRDVDAQEAVQIGLANRLVPHDRLAGEAFARKLAQAPTRAIGWTKRALHAMDSGLEEALEMEARLQELAGKTEDFREGVQAFAEKR.. 257
359 0.000e+00UniRef50_A0A1I2YFP6 3-hydroxypropionyl-CoA dehydratase n=2 Tax=Desulfotomaculum arcticum TaxID=341036 RepID=A0A1I2YFP6_9FIRM  ali  23  7.YKYIQTKEDNGLAWIILNRPEIYNAFNDEMMEEIAQVLKTLEEPGVKVIVFKGEGKAFASGADIESLKKMTPYD----ALFPKMQELYQQIYNFPKPTIAAINGYALGGGLELAISCDIRICAPNARFGLPECKLGVIPGGGTQRLVRILGEAKVKELVFLGEFINAEQALNLGLVSAVVEKSELQVEQYAGQIMQRGPLALRLAKMAINSEDISLNTGLFIENLAQSFIFGTEDKKEGVNAFLEKR.. 254
360 0.000e+00UniRef50_D6CR47 Enoyl-CoA hydratase-isomerase n=1758 Tax=root TaxID=1 RepID=D6CR47_THIA3  ali  19  9....VLTETRGHVGLITLNRPKQLNALNDALMDALGAALKAFADPAIGCMVVTGSDKAFAAGADISAMAKKTFPASYTEDF---ITRNWEAMMQIRKPVIAAVRGFALGGGCELAMMCDLIVAADNAQFGQPEIKLGIIPGGGTQRLTRAVGKAKAMDLILTGRMMDALEAERSGLVARVVPLQQTLDEAMAETMAGFSQPSVLMAKESVNAFESSLSEGLRFERRLFQSLFATADQKEGMAAFLEKRK. 255
361 0.000e+00UniRef50_S5ZCA6 Crotonase n=21 Tax=Bacteria TaxID=2 RepID=S5ZCA6_BACPJ  ali  16  2NYEFLQYEIDHRTAVVYIDRPP-LNPLNTKVFRELAALIDELANSQVGAIIITGTGKAFVAGADIHEMMNLDLAGMMEMNKISR--ATFSKIESASKPVIAAVNGLALGGGCELALACDLRICSENAKFAFPEVNLGIIPGGGTQRLPRIVGQGVAKELLYFGEMIDAKRALAIHLVNKVVPADELLAKEWAEKLAQKPAIAMRMLKEAVNGANVDLQSGLIVETACFGNAFATEDRKEGMRAFAEKRK. 253
362 0.000e+00UniRef50_A0A1C6JE22 Probable enoyl-CoA hydratase echA8 n=14 Tax=Bacteria TaxID=2 RepID=A0A1C6JE22_9CLOT  ali  21  2AYQNIKIEINDGIAVLTLNRPEVRNALDYVTWDEIRAGMRELRNDDAHVIILTGAGKAFASGADIKALNARTVSEQMNSE----VNDILYEITMHKKPVIAAVDGYALGGGCELAMACDIRIATKKSKFGQPEVNLGIIPGGGTQRLQRLVGIGKAKELIFTGDIISAEEAERIGLIEKVVEDGAVLEAAMAKKIKAKGPVAITLAKQAINGANTDLYSGLCFERYSQAIAFSTADKAEGTLAFIEKR.. 251
363 0.000e+00UniRef50_A0A221K7L3 Short-chain-enoyl-CoA hydratase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A221K7L3_9RHOB  ali  22  4.YETLIYDRDNGVATITLNRPDRMNTLGGAMKPELYDVFQNLNDRGIRCVILTGAGRAFCAGADIKERAGNRPPRAEYYAKQKFTHDLTCLIETFERPVIAAINGVALGGGLEIALCADIRFAADHAKLGLPEVNLGVLPAGGTQRLPRLIGAPLAKELMFTGRHIKAEEAMALGIVSRVVPLADLMARNLADEIAAKPPLSVAFIKQAVNGLQVGMLEGLEYERFGAAMIMDSADRTEGMNAFLEKRK. 259
364 0.000e+00UniRef50_UPI000773985E enoyl-CoA hydratase n=2 Tax=Syntrophomonas wolfei TaxID=863 RepID=UPI000773985E  ali  22  4..KTILYEKDAGVGIITLNRPKALNALNDELINELTILMDDISDNEVQAVIITGGERAFAAGGDIAFMANADSLQAE--KFVEAIRVAFDKIDRLDKPVIAAISGLALGGGSELALACDIRIAAEGSSIGQPEINLGIIPGGGTQRLTRTVGPGWAKYMVMTGLPISADTALKIGFITKVVPKEQLMDEAIANIMAVKSPLAMKAAKRCVNGLSVDLSSALSYEIKTWAALFSTEDQKEGMKAFLEKR.. 252
365 0.000e+00UniRef50_A0A1J5HXK1 Uncharacterized protein n=3 Tax=Syntrophobacterales TaxID=213462 RepID=A0A1J5HXK1_9DELT  ali  19  4..ESILLRKEGNIATITLNRPERLNALDWPAQGLFGQKLDEVADDDVRVLIITGEGKAFCAGGDVSAQRDRIGKPAERRAGMKRLLKNPLKIRKMSIPVIAMVNGVAVGAGCNMALACDIIIASEKARFSQAFVKVGLVQDGGSYLLSRQVGTKKACELVFTGDLIDAQEALRIGMVNKVVPEGELATMEMARKIASRAPLAVSIAKRCIDGFDNDLETALEYEIYTQGFCSDTDDHKEGTTAFLEKRE. 257
366 0.000e+00UniRef50_A0A1W1HBY6 Enoyl-CoA hydratase-isomerase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1W1HBY6_9DELT  ali  21  2..ENLIFDIDNGIAILTFNRPKALNALNQALLEEFDSVLDQVENPDIRVLILTGSGKAFVAGADISELAKMNPL--LAKRFATKGQKLFSRLEALPIPVIAAVNGFALGGGTEVSLACDFIYASEKAVFGLPEITLGLIPGGGTQRLTRLVGTNLARELIFTGKTFSAADALSYGIVNKVCEDGTLMVMKTAKAIAKKGSASLRAAKEAIAGKDVDLETGCRFEADAFALCVASSDAAEGTSAFLEKRK. 252
367 0.000e+00UniRef50_W4LRY6 Uncharacterized protein n=18 Tax=Bacteria TaxID=2 RepID=W4LRY6_9BACT  ali  20  3.YKCLIYEVEEHIATLTMNRPERLNALGDTLRTDLHDAMTKASDPDVRAIILTGAGRGFCSGGDVKAMNEAKQRN-EHAPIMDKIAPTVLAMRDAPKPVIAAVNGPAAGAGMNIALACDIRIASSAARFGETFVRRGLHVDGGTYFLPRIVGMAKACELIFTGDVIDAEEALALGIVSQVVEPEALMVRALARKMAAGPPIAIRLAKRALHNQECDLRAALEYETYAQNICRETEDAREGIRAFVEKR.. 257
368 0.000e+00UniRef50_A0A0J1FCV3 Putative enoyl-CoA hydratase echA8 n=139 Tax=Bacteria TaxID=2 RepID=A0A0J1FCV3_9FIRM  ali  20  2SYEFIQVSQDEGVATLTLNRPP-MNPLHSGILRELGAILREVDDPGTKVVIITGAGKAFAAGADIAEMVQLTP--MEAYAFCHITREAYEQIEKLGKPVIAAVNGLALGGGTELALACDFRLAAETAKFGQPEINLGIIPGGGTQRLTRLIGLAKAKELVFLGEIIEAGVAEKIGLVHKVVPAAELMSEALARRLAAKPAVALRMAKEAINGINLDLHSALTLEIQNFVTTFTSDDRREGLAAFLEKRK. 253
369 0.000e+00UniRef50_Q582Q0 Enoyl-CoA hydratase, mitochondrial, putative n=40 Tax=cellular organisms TaxID=131567 RepID=Q582Q0_TRYB2  ali  19  16....VKCSQRGAVLTLTLNRPAQLNALNKDLLCALAESVSKYADPSVSVIIITGEGKAFCAGADVKAMSSKSFVDFYKDDMLRG----IDTVANAKKPVIAAVNGFALGGGCELVMSCDIVVASEKATFGQPEVKIGTIPAGGTQRLARLIGKSKAMEWVLTGQQYTAEEAERAGLVSRVVKHEELATMSVAEKITLNSCLITSLAKDCVNGFEATLSEGLNYERRIFQATFATADQKEGMRAFLEKRK. 261
370 0.000e+00UniRef50_A0A1G9MIS8 Enoyl-CoA hydratase n=3 Tax=Bacteria TaxID=2 RepID=A0A1G9MIS8_9FIRM  ali  17  2.FKNLICEKHDNIYVIKISREKYLNSLSEEVLKELEMAVDILNDDEVYVGVIIGQGKAFVAGADIDAMKDMNF--EQARRFSKLGTELFRKIENCDKPIIAGINGFCLGGGLELAMSCDLRIASTKAKFGQVETNLGILPGGGTQRLPRIVGIGKAKELIYTADIIKADEALNIKLVNKVVEPDNLLQEDLGKKISSKGQLAIRYAKCAVNGYEIDLDNAINLESYLFGLCFASYDQKEGMSAFLEKRKF 255
371 0.000e+00UniRef50_A0A2V3J8G2 Crotonase n=1 Tax=ANME-1 cluster archaeon TaxID=2056316 RepID=A0A2V3J8G2_9EURY  ali  20  7.YENLLYAKHGGVATVTLNRPKSLNALNTALLTELQEALRDAEADEVRAVVVTGAGKAFCAGADVGELLEKSP--AEAREWSSWVQGIISGVEKMKKPVVAKINGFCLGGGLELAMACDFRVASERASFGQPEVNLAIIPGGGTQRLPRLVGKTKALEMLTTGEQIGAEQALRLGLVSRVVPGLDAAVSELVKKLLSKSPAALGIIKRAVNGLEMDLERALEFEAECFGQALSSEEARRGLKAFLNKR.. 277
372 0.000e+00UniRef50_A0A2H5UZ47 Short-chain-enoyl-CoA hydratase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2H5UZ47_9ARCH  ali  22  2....LKYEVSDGVAWITLNRPEKRNALNKELRAGLLQALREAENDSVKVVVLRGAGGNFCSGADLEEMARMTGLEIRAYHKDYGTQRITAYIQEMSKIVVAEVDGYCLGGGCELMLGCDIVVASRRAVFGQPEIRVGLTPGGGTQRLPRLVGFRRAKEIMLTGRLVSAEEAEMIGLVNYVVEPEKLEEKELVAELKTKSLPILSLIKKAVNALETTLSAGLEMEKEIHYFTWHTEDRREGVTAFLEKRK. 251
373 0.000e+00UniRef50_A0A2N5GDD7 Crotonase n=3 Tax=Bacteria TaxID=2 RepID=A0A2N5GDD7_9BACI  ali  21  10...FISLDVADKIAILTINRPEALNAIDELVLDELETTFNQIENENIHVVVITGAGKAFVAGGDIAAMKQMTML--EGERFVYRGQRVLSQIENSNKVVIAALNGYTLGGGMELCMACDIRIASEKAQLGLPEVCIGLYPGGGTQRLVRLVGKGIAKELVFTGNRITADRAKELGIVNRVVKHEELLIEKLAENILNNSPVAVMQAKKAINGSEISLDNALALEAEAWLVNFTTEDRVEGLSSFLEKRK. 259
374 0.000e+00UniRef50_A0A1V4S711 Crotonase n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V4S711_9DELT  ali  22  3.FKNLLFDIEDGVATVTFNRPKALNALNTETFHEVGQVIDHIENDEISAVLFTGAGKAFVAGADLAEISRKESITD-VMEFIELGHDTFRAIELMRKPVIAAVNGLALGGGTELAVSCDMRFASENAMFGTPEINLGLIPGGGTQRVARLVGVGLAKEIVMSGEPVTAKRAYEIGLINRLVAPEDLLAKEYAKKLAAKPGFAMKMAKYAINGYDLPLDNARMLEIQCASQCFSTEDLKEGVSAFLEKRK. 255
375 0.000e+00UniRef50_A0A284VQD9 Enoyl-CoA hydratase-isomerase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A284VQD9_9EURY  ali  21  5..ERIKVERNEEISIIILNRPHIMNALDAKMFQELRDALTGLKDNRTKVIIITG-GINFCAGADINELKEMSPVEAEV--FSRLGHDVFDLLENTGKPVIAAINGYALGGGCELALACDIRIAGDGAKFGQPEVNLGLIPGFGTQRLTRLVGIGWAKELILSGRTIDVIEAESIGLVNSVVDDDKVMDKATAKVLAQKSPLSIKMAKTLINK-NPDIKKGLEVETISFSECFASDDHVEGINAFLEKRKF 254
376 0.000e+00UniRef50_B1L7P7 3-hydroxyacyl-CoA dehydrogenase NAD-binding n=1 Tax=Korarchaeum cryptofilum (strain OPF8) TaxID=374847 RepID=B1L7P7_KORCO  ali  20  399....VIYKESPPIAWIKLNRPEKLNALDDDMVRGILSALEEARKEEIRVVVITGEGKAFCAGADIRGFKGIGPIDAFN--LSKRLNSAFREIYEFPKPVIAMINGFALGGGLELAMACDLRVASERAQFGQPEITLGIIGAGGSFRLPELVGIPKAKELMFTGDMITADEALRIGLVNRVVKHDNLEEETLAMKIAERPPIAISIYKALLNGQKYD------AEALAFGLVFSTEDSGEGINAFLEKRK. 638
377 0.000e+00UniRef50_G7WGS6 Enoyl-CoA hydratase/carnithine racemase n=1 Tax=Desulfosporosinus orientis (strain ATCC 19365 / DSM 765 / NCIMB 8382 / VKM B-1628) Ta  ali  21  4.YQSLIYEVKEGIAVVTLNRPDVMNALNEELSAELRSILMVVEQDEVRALILTGGAKCFCSGADIKESLSMKDAPPMKQQRVERSRPLFDGIANLSKPTIAAISGAAMGAGCEMALACDFRIASENLKIALSEIKIGIVPGGGTQRLPRLVGIAKAKEMILLGKTLNAQEALQIGLVNIVVPVEELMAQAFASQFINLAPLTLSLAKKLINGMEMSLKDAIDYETQCATLLGTTEDRLEGMKAFSEKRK. 257
378 0.000e+00UniRef50_E6XCN0 Enoyl-CoA hydratase n=525 Tax=root TaxID=1 RepID=E6XCN0_CELAD  ali  20  3.FDNILVNHQEDIATVTINRPNKLNALNRDTIQELHDAFKALKDKNVKVIIVTGSGKAFVAGADIAEFSDFSEK--EGAKLSAKGQKLFDYVENLATPVIAAVNGFALGGGLELAMACHFRVASDNAKMGLPEVSLGVIPGGGTQRLPQLVGKGRANEMIMTAGMIDAQKALAYGLVNYVVTPEELLPLKLAGKITNNSSVAIAYAIKAVNAGFSTDTDGFEKEIKAFGECFGTDDFKEGTTAFLEKRK. 254
379 0.000e+00UniRef50_A0A1N7PJP4 Short chain enoyl-CoA hydratase n=11 Tax=cellular organisms TaxID=131567 RepID=A0A1N7PJP4_9GAMM  ali  22  14NFDTILVEIKEGVGTITLNRPKVMNALNQMLTREVGEAVDALEAEEVGCIIITGGDKVFAAGADINEMKDLDFYQLHMANFPYIQRDCWRAIDEARKPIIAAVAGFALGGGCEMVMACDFIIAADSAKFGQPEISIGTMPGGGTQRLTKAVGKAKAMDMCLSGRMMDAAEAEHCGLVTRIVPTEDLADTAFARKIASNSRPVVYMIKESVNAVDASLRDGLAFERRNFASTFAFEDCKEGMNAFAEKRK. 267
380 0.000e+00UniRef50_A0A1Q8BCF9 Uncharacterized protein n=11 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q8BCF9_9BACT  ali  24  2.YQTIIFSTADSIATIKLNRPEKLNAFGGPMREEILDALEKARDDDIRAVIVTGEGRAFSAGGDIQHLKQLRDNKDESRNILSYGQKITGAMRSLGKPVIAAVNGPCAGAGLSFALGCDIRIASDKATFGPSFALIGLHPDGGSWFLPKLVGTAKACELVFTGTMISAQEAEKIGLVNAVVPHHELLVDSQAEKMAKNPPGVLRLAKESIYGLNSDLEAAFARETEAQLKCFYSEDFLEGVTAFLEKRQ. 256
381 0.000e+00UniRef50_A0A1V4XIE2 2,3-dehydroadipyl-CoA hydratase n=11 Tax=Bacteria TaxID=2 RepID=A0A1V4XIE2_9DELT  ali  20  3.YKDIIVKKDGAVATIAINRPEVLNAIRYETMLEIQDALDGIADDAIRVVVLTGAGKAFVAGGDISVMAKGAGYLDVLHTLPE-GQQITWNIEHFRKPVIARINGIALGGGTELALCCDIRVAADTAVMGVPEINLGIIPGGGTQRLPRVVGVGMAKKLVLSGEHIKAEEAYRIGLVDMLVPKAELAVAKLAKRIASKSPIALAMGKEAINGVQADLRTGLSIEARCFSLCFGSQDRVEGMNAFLEKRK. 255
382 0.000e+00UniRef50_A0A1X6YMJ4 Putative enoyl-CoA hydratase echA8 n=1013 Tax=root TaxID=1 RepID=A0A1X6YMJ4_9RHOB  ali  24  2AYTTILVETEDDIATITLNRPQAMNAINSVLLRELVGALEEADRSDVRCIVLTGSDKAFAAGADVAEMADLSFVEMYRRAL---YAGDMARLARIRKPIIAAVAGYALGGGCELAMACDIIIAADTAKFGQPEVNLGIMAGGGSQRLTRAVGKPKAMDMHLTGRFMSAEEAERAGLVSRVVPARQLEARAAATKIAEKSQVSVLAIKDAVNSQELPLTEGLAYERRLFEALFSTEDQAEGMAAFREKRE. 252
383 0.000e+00UniRef50_A0A0C2X471 Uncharacterized protein n=2 Tax=Serendipita TaxID=358905 RepID=A0A0C2X471_9HOMO  ali  20  7AFEHILVSRRPSVALVTLNRPKALNALSSPLFKELNHALELADNDDISSLVLTGSEKAFAAGADIKEMQSKTFSEVYSTDFLAN----WAAIKSLRKPVIAAVSGYALGGGAELALMCDIILASPTAKFGFPEITLGVIPGGGTQRLTNIVGKSKAMELVLTGRVFGAEEAERWGVVSKVVPGDEHLALEMASKIASFGQLATQAGKEAVNALDLPLSEGLRLERRLFHSLFATNDQKEGMAAFAEKRK. 265
384 0.000e+00UniRef50_Q7JR58 CG6543, isoform A n=41 Tax=Bilateria TaxID=33213 RepID=Q7JR58_DROME  ali  22  37NWEYIKTEVAGNVGVITLNRPKALNALCNGLMKELSTALQQFKDKTISAIVLTGSEKAFAAGADIKEMVGNTYSQCIQGNFLND----WTEVARTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEALGEKIGTHSNLIVQLCKEAVNAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEKRKF 292
385 0.000e+00UniRef50_Q52995 Probable enoyl-CoA hydratase n=2346 Tax=root TaxID=1 RepID=ECHH_RHIME  ali  23  2SYETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFADRAVGAIVLAGSEKAFAAGADIKEMQGLDFVDGYLADFLGG----WEHVANARKPMIAAVSGFALGGGCELAMMCDFIIASETAKFGQPEITLGVIPGGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVVAPDRLLEEALAEKIASFSLPAAMMAKEAVNSLELTLAEGLRFERRLFQSLFATEDQKEGMAAFVAKRK. 251
386 0.000e+00UniRef50_A0A2V7KVA7 Enoyl-CoA hydratase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7KVA7_9BACT  ali  20  2NYQTLLFEPRDGIAFVTINRPDKLNALNDHVMLELADAAERIAQSDIKGAILTGAGKSFVAGADIADLSRQGPFDGKARA--QRGQGVLRRLETCGKPVIAAINGFALGGGCELAMACHIRIASENAKFGQPEVKLGIAPGGGTQRLPRLVGKGVAMQLILTGETIDAQEAYRIGLVNKVVPAADLLAEKMLRGILAMGPLAVRLAMEAVQGLEMSLDEGLLLEANHFGLLAATQ............... 240
387 0.000e+00UniRef50_E2XRW5 Enoyl-CoA hydratase/isomerase FadB1x n=388 Tax=cellular organisms TaxID=131567 RepID=E2XRW5_PSEFL  ali  21  2SYETILLEVQGRVGLITLNRPQALNALNAQLVSELNQALDGLEDPQIGCIVLTGSKKAFAAGADIKEMAELTYPQIYLDDLFSDSDRVANR----RKPIIAAVNGFALGGGCELALMCDFILAGDGAKFGQPEINLGVLPGGGTQRLTRAVGKAKAMEMCLTGRFIDAVEAERCGIVARIVPADELLDEALATLIAGKSPISM-MVKESVNAFEVSLSEGVRFERRVFHAAFATQDQKEGMAAFVAKR.. 250
388 0.000e+00UniRef50_A0A0Q6MF64 Enoyl-CoA hydratase n=26 Tax=cellular organisms TaxID=131567 RepID=A0A0Q6MF64_9BURK  ali  20  2SYECIVTDVQGRIGVVTLSRPKQLNALNDTLMNELGTALKAFDADEIGCMVVTGSEKAFAAGADIGAMAGWNFMDVYKSDY---ITRNWETIRSVRKPVIAAVSGFALGGGCELAMMCDFIIAADSAKFGQPEIKLGIIPGGGTQRLPRAIGKAKAMDMVLTGRMMDAAEAERAGLVSRVVPAAELLTLAAAQAICEFGGPSVMMAKEAVNAYEGPLSEGIQFERRMFHALFATEDQKEGMDAFVNKRK. 256
389 0.000e+00UniRef50_A0A1M6IMR8 Enoyl-CoA hydratase n=4 Tax=Bacteria TaxID=2 RepID=A0A1M6IMR8_9FIRM  ali  18  3.FKNLILEKEEGIAVATVNRPEVRNALNRETWQEINSLIDQVEDEEIQVLIFTGAGKAFVAGADVASLKERT----MLETFVNENQATLNRLANMEKVTIAAINGYALGGGCELALACDLRVAAENARLGQPELNLGILPGGGTQRLARLVGIGNAKELILTGEIIDAAEAYRIGLVNKVVPAGEAAAKEMAQKIMAKGPLAVRFAKAVINGSNVSLESGLIMERLAQTILFGTEDRLEGLTAFLEKRR. 252
390 0.000e+00UniRef50_W4TAQ9 3-hydroxybutyryl-CoA dehydratase n=7 Tax=Chryseobacterium TaxID=59732 RepID=W4TAQ9_9FLAO  ali  20  3.FETLIYQQNNHVGVVTINRPQALNALNEKVLQELALLAGHIKDKNIRVLIITGSGKAFVAGADIKAMQKMTPQQAE--EFSITAQTAFNAIESLPFAVIAAVNGFALGGGCELALSCDIILASEKAKFGLPEVSLGLLPCGGTQRLPRAVGLYKAREMVFSGEFYSALQCREFGFVNQVIAPEDLLAQKLAETIASRGPVAVAKAKQSLNGFELHINDGLKQEAALFGELFSTEDHHEGISAFIEKRE. 254
391 0.000e+00UniRef50_A0A1Y4W6U3 Enoyl-CoA hydratase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1Y4W6U3_9FIRM  ali  20  3.FENILYEVKDGILYLTLNRPDVRNALSPEMWRDIQTAVQQAKDDDVRVIIVSGNGKALASGADIREIHDRDYLKMLEATASVSL----KALEDLYKPVICAVNGYALGGGCELAMACDIRIATKRSKFGQPEVGLGIMPGGGTQRLARLVGPGKAKELIFTGRIISAEEAASIGLVNQVTEDDALMAEDMARQIMSKGPMAVNLAKISINGLETDINTGLMIERLAQTIAFSTQDRKEGTAAFLEKR.. 253
392 0.000e+00UniRef50_D5WUF6 Enoyl-CoA hydratase/isomerase n=6 Tax=Bacteria TaxID=2 RepID=D5WUF6_KYRT2  ali  22  7....VQWTKEEGYAVITVDNPP-LNVMSEQVGRELGECVDEAEDPDVVAVIVTGAGRAFMAGADIKEFPQRMKPGAAG-EMSRQLHDVLNRLDDLPKPTIAAIRGYALGGGLELALACDMRIAGESAQLGVPEVKLGLFPGGGTQRLPRLVGEAKAKEMMFTGDPVSAAEARQIGLVNQVVPDDQVMEAALAKTITQRSLMSLGRIKRLVQGLEQSLKEGLQLEAQLFDEIFQTEDVREGVQAFLEKR.. 254
393 0.000e+00UniRef50_V7I245 Crotonase n=3 Tax=Firmicutes TaxID=1239 RepID=V7I245_9CLOT  ali  24  17.....LIEKRESIGIITFDRPEALNALNTGVLKELEEAIDRFENDDIRAVIFTGNGKAFISGADLDEMKDL--RDKEARAFIDRGTSLFRRIETLGLPTIAAVNGFCFGGGLEFALCADIRLASEKASFSFPEATLGIIPGSGTQRLPRTVGKSNAKEMLFTGKRVKAQEALEMGLVNHVYPLDELMAMELAEVMVGNSPNAIAKIKMLVKGVDMDLEEGITLESDHSAPNFESRDQLEGIQAFFEKRK. 263
394 0.000e+00UniRef50_A0A1H4AFU8 Enoyl-CoA hydratase n=6 Tax=Bacteria TaxID=2 RepID=A0A1H4AFU8_9FIRM  ali  22  3...FVKYEADGAIAVITINREKALNALNSEVLTDLDAVIDAVDLDTVRCLVLTGAGKSFVAGADIGEMSN--DTVAQGQALAEKGNAVFRKLETLPIPVIAAVNGFALGGGCELCMSCDIRLASENALFGQPETGLGITPGGGTQRLMRRIPVGKAKEMIYACTNIKADEALQWGLVNGVYAAEELMALKLAGKIAKNAPIAVRNAKKAMNGIEVDIEKGIEIECDLFGKCFETADQKEGMAAFLEKRK. 251
395 0.000e+00UniRef50_A0A0E9NM40 1-acyl-sn-glycerol-3-phosphate acyltransferase n=2 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NM40_9ASCO  ali  22  35SYEHIIVTHAPRVALVTLNRPKALNALCNALIAELNTAFKALRDDNVGAIVLTGNEKAFAAGADIKEMKDKTFAEVYKHDFIRSWSEMTQ----VTKPIIAAVRGYALGGGCELAMMADIIYAADTATFGQPEIKLGIIPGGGTQRLPRLIGRSRAMELILTGRNFSAQEAYSWGMVARLFPSTRVVEEAVAEQIGKVGGLAVKAAKEAINGEEMGLGEGVKFERRLFHGLFSTADQKEGMAAFAEKRK. 285
396 0.000e+00UniRef50_L7WAD6 Enoylase-CoA hydratase/isomerase family n=74 Tax=cellular organisms TaxID=131567 RepID=L7WAD6_NONDD  ali  20  3...NILVTTENKITTITINRPNKLNALNKETIEELSQAISSAEEDDTRVIILTGSGKAFVAGADISEFADFSP--EEGKRLAGKGQELFDAVENCSTPVIAAVNGYALGGGLELAMAAHFRVASDNARLGLPEVSLGVIPGGGTQRLPQLVGKGRAMEMIMTAGMIDAATAQSYGLVNHVVTPEELIAEKLASKIMRNSPMAISAAIDAVNSGFVDGTDGYQVEIDNFGSCFGTDEFVEGTNAFLEKRK. 252
397 0.000e+00UniRef50_D7CKN5 Enoyl-CoA hydratase/isomerase n=6 Tax=root TaxID=1 RepID=D7CKN5_SYNLT  ali  20  4..KTMLYEKESGIGIITFNRPKVLNAISPDTLDELIYLMSEIEDDEVKCVIITGGSRAFAAGADIAYMAKVDPVECE--RVMAKFHQAFDSVANLSKPVIAAIAGLAFGGGCELALACDIRIAAEGTKLGFPEVNLGIFPAGGTQRLTRLVGIGWAKDMIMTGDPIDAETAFKIGLVTRVVKPEDLMDEALAMKLAAKAPITTRVAKQCLNSISTDIASGLAFEQKAVAFLFSTEDAKEGLNAFIEKRK. 253
398 0.000e+00UniRef50_K0NMS8 Crt2: 3-hydroxybutyryl-CoA dehydrogenase (Crotonase) n=37 Tax=root TaxID=1 RepID=K0NMS8_DESTT  ali  23  2SFENIILEVADPVATIFFNRPKALNALNNALFDELDIALDQIENKDIRVLVLTGAGKSFVAGADIAELSQMSPL--QGKFFSRRGQKIFSKIEDLPIPVIAAVNGFALGGGSEAALACDFIYASEKALFGLPEITLGLIPGGGTQRLARVVGINRAKELIFIGKPIKAQEAMEYGMVNKICEPDKLMEEKTANLIAARGKVALRSAKEVIQGLNTDLETGCKIENDVFGLNMASEDAKEGTSAFLEKRK. 254
399 0.000e+00UniRef50_A0A1Y3U9Q1 Enoyl-CoA hydratase n=4 Tax=Bacteria TaxID=2 RepID=A0A1Y3U9Q1_9FIRM  ali  20  11..ENVKVELDDHVLVVTMNRPKALNALNNQTLDELNLVADQIADQDIYGAIITGEGRGFVAGADIVQMKP--YKSEEGRSYAEYAQNTFNKIEALEKPVIAAVNGFALGGGCELALSCDIRIASEKAVFGQPEVTLGIIPCGGTQRLPRLIGAGLAKEMIYTGRQVKAEEAKAMGLVNKVVPENELAAKAMMADILKVSPMGIKYAKIAINGADMDLKNGLELEKNLVGLCFATEDKEKGMNAFLAKEK. 260
400 0.000e+00UniRef50_A0A2J6XMK7 Uncharacterized protein n=1 Tax=Nitrososphaera sp. TaxID=1971748 RepID=A0A2J6XMK7_9ARCH  ali  22  2NYSNIIYDVRDGVAWITINRPDVRNALDVSTKEEMMSALDAAEDPAVFAVVITGAGKSFCAGADLKMFLTMREDDA--RSYLVLTKGLVDRIENLSKPVIAAVNGHAFGGGLELVLASDIAVAVEDALLGQTETNVGLIPGGGTQRLPRHVGVKRAKEMIFSGRPVTAKDAEALGIVNRAVPRGNLMVRRYLEDMRSKSPLILSFAKRAVNAFQRPFEDGMLTESDLFAKCFSTEDQKEGVRAFLEKRK. 254
401 0.000e+00UniRef50_A0A2H5XL25 Short-chain-enoyl-CoA hydratase n=1 Tax=bacterium HR18 TaxID=2035413 RepID=A0A2H5XL25_9BACT  ali  21  11..QTVRYEVDEGIALITIHRPEKHNALNRQVLAELDRYFWQARDEDVKGIILTGAGKSLCAGADVQQFTELDAYS--GHRFALYGQAVFNRVEEMPKPVVAAVNGYALGGGFELAMACHLRVAADHAVFGLPEVSLGLIPGGGTQRLPRLIGRGLATELILTAERISARRAFEIGLVNRVVPIEHLLARELVHAIVSKAPVAVALALEALRQSDLPLRQGLRLEAALFGQACATADFREGVSAFLERRK. 261
402 0.000e+00UniRef50_A0A1F8XKG6 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A1F8XKG6_9DELT  ali  25  2.FQNLLYQKEGAVSIIQLHRPQKKNALNTELRRELEAVLKEIADKTQRVVILTGGEEIFCAGADIGEITE-TSTAEAAYHHSREFQLLCDQIEALPQPVIAAVSGYALGGGCELALACDFRIASETARFGLPEIKIGAFPGGGTQRLPRLIGASKAKEIIFTGDPITAEEALSLGLVVKTVPKEKLLEETFAAKLAALPRLALQASKMLINGLEMDLNSGLELEARCFGTLAMTHDLQEGTAAFLEKRK. 253
403 0.000e+00UniRef50_A0A1R4GY30 Putative enoyl-CoA hydratase echA8 n=41 Tax=cellular organisms TaxID=131567 RepID=A0A1R4GY30_9GAMM  ali  24  6....VLYEHDNGVCLITLNRPHVRNALNTELRKELAQVIMQLANPNVRAIVITGGESVFAAGADINDFLTAKTIDV----YLRHSENYWQAITNCSKPIIAAVNGYALGGGCELAMHADIIICGKSAKFGQPEIKIGLMPGGGTQRLLRAVGKYKAMRMVLTGDMIGADEAERIGLVSEVVEDRDTTATQLAQQLASYSPIAISQIKEIVNGIDMSLEGGLALERKAFQILFDTEDQKEGAKAFLEKR.. 251
404 0.000e+00UniRef50_UPI000A1BCDC3 enoyl-CoA hydratase, mitochondrial n=1 Tax=Odocoileus virginianus texanus TaxID=9880 RepID=UPI000A1BCDC3  ali  23  197AFEYIITAKKGNVGLIQLNRPKALNALCNGLIAELNQALQTFEDPAVGAIVLTGGEKAFAAGADIKEMQSHTFQDCYSGGFLSH----WDRLTRVKKPIIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETVVEEAIAEKIASNSKIVTAMAKESVNAAEMTLAEGVKLEKKLFYSTFATEDRKEGMAAFVEKRK. 449
405 0.000e+00UniRef50_D1JFP4 Probable 3-hydroxybutyryl-CoA dehydratase (Crotonase) n=11 Tax=cellular organisms TaxID=131567 RepID=D1JFP4_9ARCH  ali  20  6..KYVMYEEKQKVAILTLNRPRSLNALNTDLLTELRDSLQDAENSEVRAIVITGTGKAFCAGADIEELLEKSPL--EASEWSQWVHGIITQMERMKKPVIAKINGFCLGGGLELAMACDFRIASEKAIFGQPEINLAIIPGGGTQRLPRLIGKTKAMEMLMTGEHIDAEEAFRLSLVNKVVPADKLAVDEFIKKLLTKSTAMLRIIKDALNGIDMDLEHALQYEAECFGSALATEDARKGLKTFLEKQK. 256
406 0.000e+00UniRef50_A0A2H5VR46 Short-chain-enoyl-CoA hydratase n=135 Tax=Bacteria TaxID=2 RepID=A0A2H5VR46_9BACT  ali  19  5....VLVEDRGRVRWLTINRPEKLNALNREVLAALERAFAEAAESSVGAVVITGAEKAFVAGADIAEFQGLSP--AQAQALARRGQALFSTIEESPKPVIAAVNGFALGGGMELAMACHLRVAAENAKFGQPEVKLGLIPGGGTQRLPRLVGKGRALELLLTGAMIDAATALSWGLVNRVVPQAELSAQKLAEDILAVAPTAVTRCLEAVNGLEGPLAEGLQMEAALFGLCAATEDFKEGVSAFLEKR.. 252
407 0.000e+00UniRef50_W1SPD6 3-hydroxybutyryl-CoA dehydratase n=7 Tax=Bacteria TaxID=2 RepID=W1SPD6_9BACI  ali  21  5..KYVRTQIGSGIATITIDRPDVLNAIDDEVLEELETTFNVIEDEKIRVVIITGGGKAFVAGGDIDAMKRMS--VIEGERFVYKGQCVLSKIENSNKVVIAAINGYALGGGTELALACDIRIASDKAKLGLPEVCIGLYPGGGTQRLVRLVGKGVAKELVFTGRRISVHEAKELGIVNRIVPHDELMSSELAESILANSPMAVIQSKKAINGSEISLDNALSLEAEAWLVNFSTEDRVEGLSAFLEKRK. 255
408 0.000e+00UniRef50_G7YGA2 Enoyl-CoA hydratase n=1 Tax=Clonorchis sinensis TaxID=79923 RepID=G7YGA2_CLOSI  ali  23  205TYEHILVDKKGAVGFIQLNRPKALNALCNGLIRELSEALDNFEDNQVKTVVLTGSNKAFAAGADIKEMCGLTYPHVYGNDLLVD----WDRVALTRKPIIAAVCGYALGGGCELAMMCDIIYASDTAKFGQPEIKLGTIPGGGTQRLVRAVGKSRAMELILSGDMIDAKEAVAAGLVSRVFPADEVVAIELAEKIGRYSGLATKAAKEAINAANMTLSEGLRFEKRLFHASFSTNDCKEGMTAFAEKRKF 460
409 0.000e+00UniRef50_A0A062UX18 Enoyl-CoA hydratase/carnithine racemase n=1 Tax=Candidatus Methanoperedens nitroreducens TaxID=1392998 RepID=A0A062UX18_9EURY  ali  19  7.HEHIVTERKKEIGTIILNRPEVMNILDAKTLKELGDSLTDLEDKQIRAIIITG-GKTFSAGVDIRVLKDKDPNGAE--ALSRLGHRIFNQIENMEKPTIAAVSGYVLGGGCEMALACDIRISGENARIGQPEVKIGIIPGGGTQRLTRLVGIGKTKEMILTGRTVGAKEALSIGLVNMVVKDEELMAEKMAQVLAQKSPITIKMAKDLINK-NQDIGRGLEMEINYFSECFASQDHIEGMNAFIEKR.. 253
410 0.000e+00UniRef50_A0A1N6P7M9 Enoyl-CoA hydratase n=3 Tax=Bacteria TaxID=2 RepID=A0A1N6P7M9_9GAMM  ali  20  6....LLIETRDGIRTITVNRPDKLNALNSATLDALHQAFDEAADANVRVVVLTGAGKAFVAGADISEMNGLTP--VEGRDFSLRGQRMMRRVEKMPKPVIAAVNGFALGGGLELAMCCHLRIAGDNAKVGQPEINLGLIPGGGSQRLLRLAGRAATLELCLVGAPINAERARELGIINRVVPAAELETMKLATQLANAAPLALRAMLDCVNGGECGIEEGLEYESAQFGLVFSTEDMREGTSAFLEKRK. 254
411 0.000e+00UniRef50_Q1K2C7 Enoyl-CoA hydratase/isomerase n=2 Tax=Bacteria TaxID=2 RepID=Q1K2C7_DESA6  ali  22  5...NLLVECRDQVAHITINRPDAMNALNPATADELKRTIKELEKSEAKAVVITGQGKAFCAGGDVALMRTLGPI--EARKVALGVAELFHTIESSPLVVIAAVNGYALGGGCELAMACDLRLAAEKAQLGQPEINLGILPGGGTQRLPRLIGVSRAKKLIFTGERITAQQAMEFGLVDEVLPGDELLAHALAVTIAGKPQSAIRMIKQSIHGMQMDLDRAIRYEAELFGMCFATKDKQEGMDAFFEKR.. 253
412 0.000e+00UniRef50_A0A2N6EUV9 Crotonase n=2 Tax=Desulfuromonas TaxID=890 RepID=A0A2N6EUV9_9DELT  ali  21  5...NLKVECRDQIAHITINRPEAMNALNPATAVELTRTIKSLETPDAKVIIITGQGKAFCAGGDVALMRTLGPT--EARNVAMTVDELFRTIETSPRVVIAAVNGYALGGGCELAMACDLRLAAEKAQLGQPEINLGIIPGGGTQRLPRLVGVSRAKKLMFTGERITAAQAMEIGLVDQIYPSEELAAHALAVTIASKPQAAIRMIKQSVHGMQMDMDKAIQCEAELFGMCFATRDKQEGMDAFFEKR.. 253
413 0.000e+00UniRef50_P30084 Enoyl-CoA hydratase, mitochondrial n=27 Tax=Opisthokonta TaxID=33154 RepID=ECHM_HUMAN  ali  23  32NFEYIIAEKRGKVGLIQLNRPKALNALCDGLIDELNQALKTFEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKH----WDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIAEKIASNSKIVVAMAKESVNAAEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRK. 284
414 0.000e+00UniRef50_UPI0008D914F5 enoyl-CoA hydratase n=2 Tax=Peptoniphilaceae TaxID=1570339 RepID=UPI0008D914F5  ali  23  3.YKFLKIEKENGVIVLTISREKTLNSLNTEVLKELSDFFEKIDDEATSVIVLTGAGKSFVAGADIGEMATLSAT--EGYDFGKLGMDTLMKIEKGRKPVIAAVNGYALGGGCEIALACDIRLASKNAKFGQPEVGLGIIPGGGTQRLIRAIGPGYAKEMIFTAKMIDAERAERWGLVNHVYEPEELLDKAMANTIAQRAPKAIQYSKSAIEGSQTDIETAMEIERTSFGLLFSTEDQREGMNAFLNKKKF 257
415 0.000e+00UniRef50_A0A086YS32 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium SCADC1_2_3 TaxID=1487582 RepID=A0A086YS32_9FIRM  ali  20  2..EKVKLEKNNRVATITINRSDVLNALDLQTFEELAQASREVADETIKAVIITGAGRAFCSGIDLTFIHQITSAPLAFRQKLQELQAVFSSFEEMDKPVIAAVNGFALGAGCDLALACDIRIASEKALFSEQYIKVGLVPDGGTQRLPRIVGLGKAKELIFTGEMVNAQEALQINLVNKVVKTEELAAQELAQKLAQGPSIAIGLAKQAINGLDTDIKAGLSYEVYSQSICLKSEDFKEGVNAFKEKR.. 253
416 0.000e+00UniRef50_A0A0F7DBM8 Short chain enoyl-CoA hydratase n=5 Tax=Archaeoglobaceae TaxID=2232 RepID=A0A0F7DBM8_9EURY  ali  23  3....VEFEERDGVVWVRFNRPEALNAINEQFVQEFRKAVEHARSSTARVMVVTGEGKAFCAGADIKMFSE--TDVFKARRIIEDLGALLEDLEELDIPVIAAINGYALGGGCEVAMACDIIIASEKARFGQPEINIGIIPGGGTQRFARLIGWKRAMELSLTGDHISADEAYRLGLVNRVVPHEKLMDAELVEKIKSKSPYAVMLVKHAVNGFKMSLRDGIMYERDLFTIAFASPDSKEGFSAFVEKRQ. 250
417 0.000e+00UniRef50_A0A2H6A5E7 Short-chain-enoyl-CoA hydratase n=31 Tax=Bacteria TaxID=2 RepID=A0A2H6A5E7_9BACT  ali  22  4.FENVIVELDGAIGKITLNRPEKLNAFAGRMRQEIAQAVARLADDEVRVLVITGAGRAFCAGADIGYMRTLLETEDWENALVEAGRAVVTAIRRAPKPVIASVNGPAAGGGANLALACDIRIASDRASIGQTFNRIGLHPDGGTYFLPRLVGPSKALELIFTAEMIGAEEACRLGLFNRVVPHDRLEEEKLAELLAAKPPIALALAKEAVRSGHASLDEMLDLELQNQLRCFQSADAKEGLLAFLEKR.. 257
418 0.000e+00UniRef50_A0A1C6IMY2 Probable enoyl-CoA hydratase echA8 n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C6IMY2_9FIRM  ali  21  3...FVAFEQRGPIGVLTMNRPEALNALNEQVLRDLNAALDAVENDEVLVVILTGAGRSFVAGADIGQMKDLTP--VQAKKFGSYGNQVFLKLENFPKPVIAAVNGFALGGGCELSMACDIRLASEKAKFGQPEVGLGITPGGGTQRLARIVGVSNAMELILTAKTINAARAQELGLVSHVYPPEELMAMELAQAIAANAQVAVRQSKAAIRGLQTDMYTGAAYEAEAFGLCFATEDQKDAMTAFVNKEK. 251
419 0.000e+00UniRef50_P14604 Enoyl-CoA hydratase, mitochondrial n=750 Tax=cellular organisms TaxID=131567 RepID=ECHM_RAT  ali  23  32NFQYIITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDCYSGKFLSH----WDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIAEKIANNSKIIVAMAKESVNAAEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRK. 284
420 0.000e+00UniRef50_UPI00073845B5 chromodomain Y-like protein 2 isoform X1 n=1 Tax=Diachasma alloeum TaxID=454923 RepID=UPI00073845B5  ali  22  365.YEFIKVEKSGNVAVITLNRPKALNALCNKLMTELNTAIEKFSNDAVGAIVLTGSEKAFAAGADIKEMMNNT----FANNITQGFLENWDSVAKCRKPIIAAVNGYALGGGCEVAMMCDIIYAGDKAKFGQPEINLGTIPGGGTQRLTRAIGKSKAMEMILTGNPITAEEAEKSGLVSKIFPADKLVSEAIGEKIAAQSQIAVALAKEAVKAYETTLNEGLHYEKRIFQATFATVDQKEGMAAFIEKRKF 619
421 0.000e+00UniRef50_A0A0X3PT87 Enoyl-CoA hydratase n=6 Tax=Eucestoda TaxID=6200 RepID=A0A0X3PT87_SCHSO  ali  24  25.YENILINRTGAVGLITLNRPETLNSLSSNLLRELASALETLKEESIKCLVITGNERVFAAGADIGEFSDLSYADIYSRDFFAY----WERLTACKKPVIAAVNGIALGGGCELAMMCDIIYAGEKAKFGQPEIKLGLIPGGGTQRLIRAVGKSRAMEMILSGEMITAQEAAAVGLVSRVYPVNEVVDRALADRISRFSSLALRAAKESVNAANTTLSQGLEFERQSFFGCFATNDSKEGIQAFIEKRKF 279
422 0.000e+00UniRef50_F6QV70 Enoyl-CoA hydratase, short chain 1 n=12 Tax=Boreoeutheria TaxID=1437010 RepID=F6QV70_HORSE  ali  22  7NFEYIIAEKKGKVGLIRLNRPKALNALCNGLIVELNQALEAFEDPAVGAIVLTGGEKAFAAGADIKEMQNHTFQDCYSSKFLSH----WDQLTRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPGGGTQRLTRAVGKSLAMEMILTGDRISAQDAKQAGLVSKIFPVETLVEEAIAEKIASNSKIVAAMAKESVNAAEMTLTEGNKLEKKLFYSTFATEDRKEGMAAFVEKRK. 259
423 0.000e+00UniRef50_C6WZV7 Enoyl-CoA hydratase n=17 Tax=Bacteria TaxID=2 RepID=C6WZV7_FLAB3  ali  21  3.YDNIIVETEERIAIITINRPESLNALNSKTIAELSDSFENLKNPEIRVIILTGSGKSFVAGADIKEFSDFGAADAEN--LSRNGQQLFDKIENLSKPVIAAVNGFALGGGLELAMACHIRYASENAKLGLPEVTLGLIPGGGTQRLPKLVGKGLANEIIFSAKMIPAARAKEIGLVNDVVSSDELLSQDLARTIARNSPMAIEKAISAVNLSDST--SGFETEMKSFGELFEMNDKKEGVSAFLEKRK. 252
424 0.000e+00UniRef50_UPI0006269FB8 uncharacterized protein LOC105686767 isoform X1 n=1 Tax=Athalia rosae TaxID=37344 RepID=UPI0006269FB8  ali  22  426NYEYIKTEKAGNVGVITLNRPKALNALCDDLILEVKDAVEKFDDSSIGAMIITGSEKAFAAGADIKAMQNQTFSQTVNGRMLEG----WSSISDASKPLIAAVNGYALGGGCELAMMCDIIYAGETARFGQPEIIIGTIPGGGTQRLTRVIGKSKAMEMVLTGNQISAVEAEKSGLVSKVFPPDQLLAEALGERIATHSQIIVSLAKDSVNAYETTLQEGLRYEKKIFYGTFATADRKEGMSAFIEKRKF 681
425 0.000e+00UniRef50_M7TA72 Enoyl-CoA hydratase/carnithine racemase n=5 Tax=cellular organisms TaxID=131567 RepID=M7TA72_9EURY  ali  22  3.YKNIVVKKKDGIGYIKINRPDVLNALNQETIKEITNAVEDLEQDNIKVAILTGEGKAFIAGADIAAMSNMTPL--EAKEFAELGHDMLNTIEKSRLPVIAAVNGYALGGGCETLMACDICIAAKSAVLGQPEINLGISPGGGTQRLPRHVGRMKAKELLLTGRNVNAEEACNIGLVNMVVDEDKLMAEKIAGKIASKSTVQTNFIKALVNGADIGLNTANSLEISYFSSSFSTHDQKEGMSAFLEKRK. 253
426 0.000e+00UniRef50_Q8RMI7 Crotonase n=596 Tax=root TaxID=1 RepID=Q8RMI7_CLOBE  ali  19  4..KNVILEKEGHLAIVTINRPKALNALNSETLKDLNVVLDDLEADNVYAVIVTGAGKSFVAGADISEMKDLNE--EQGKEFGILGNNVFRRLEKLDKPVIAAISGFALGGGCELAMSCDIRIASVKAKFGQPEAGLGITPGGGTQRLARIVGPGKAKELIYTCDLINAEEAYRIGLVNKVVELEKLMEEAMANKIAANAPKAVAYCKDAIRGMQVDIDAAILIEAEDFGKCFATEDQTEGMTAFLERR.. 253
427 0.000e+00UniRef50_A0A220SG17 Crotonase n=1 Tax=Chryseobacterium sp. T16E-39 TaxID=2015076 RepID=A0A220SG17_9FLAO  ali  20  2NFETLLYQQNGPIGTLTVNRPQALNALNKDVLRELKQFADEIKNKDIRVLIITGSGKAFVAGADIKAMQGMSPKEAE--SFSIFAQTAFNSIEELPFAVIAAVNGFALGGGCELALSCDIILASEKAKFGLPEVTLGLLPCGGTQRLPRAIGLYKAREMVFSGEFYSATECKEFGFVNRVVAPQELEAQKLASTIASRGPVAVSKAKQSLNGFELHMREGLQQEAHLFGELFTSEDQNEGISAFIEKR.. 253
428 0.000e+00UniRef50_A0A1Y3U9N9 Uncharacterized protein n=1 Tax=Anaerotignum lactatifermentans TaxID=160404 RepID=A0A1Y3U9N9_9FIRM  ali  21  3.YQYVLLNIKNRLATVTVNRPEALNSLNREVIADIYSCMQEIDRKHLACVILTGAGRSFIAGADISTMVEM--EGHEGREWTKAGMDLMDLIENMRVPVIAAINGFALGGGCEIAMACDIRIASVKAKFSQPETGLGLIPGGGTQRLPRLVGKGMAKYMILTNEMINAEEAYRIGLVQKLTQPEELMDTAYAQKILSKAPLATRMAKRAINAANTDLATGINYELETYDIAFRSNDRKEGMQAFLEKRK. 253
429 0.000e+00UniRef50_Q0AVM1 Crotonyl-CoA hydratase n=595 Tax=root TaxID=1 RepID=CRCH_SYNWW  ali  18  2AYENIILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVDDPAVELLIITGSGKSFVAGADIAFMQNLSA--MEAREFGALGQKVFRLIEAMEKPVIAAVNGFALGGGCELAMCCDFRIAASNAKFGQPEVGLGITPGGGTQRLPRLVGPGMAKQLLYTADVINADEAFRIGLVNKVVQPEELLVKKIAGRILSKGQLAVRLSKAAANGMQTDIDRAMSIEADAFGLCFATQDQKEGMTAFLEKRK. 254
430 0.000e+00UniRef50_A0A239XET7 Probable enoyl-CoA hydratase echA8 n=12 Tax=Bacteria TaxID=2 RepID=A0A239XET7_9FLAO  ali  22  3NFENIIVEHEGKVATVTINRPQSLNALNAQTISELSTALDELNTDNCRVVILTGSGKSFVAGADIKEFSDFNSEKAEELARNGQ-NSLFNKIENMSKPVIAAVNGFALGGGLELAMSCHIRYASENAKLGLPEVTLGLIPGGGTQRLPKLVGKGLANELIFSAKMISAGRAKEIGLVNEVFTLEELLTMELAVQISKNSPLGISRAIKAVNLSGSS--EGFETEIKAFGELFELEDKKEGVAAFLEKRK. 253
431 0.000e+00UniRef50_A0A2H5V264 Short-chain-enoyl-CoA hydratase n=2 Tax=Archaea TaxID=2157 RepID=A0A2H5V264_9ARCH  ali  21  5SYETIKLEREDRVAWIVLNRPHRLNAFNEDMILELLDALNTVEDDGVRCVVITGEGRAFSAGADITAFPKTTPTLAE--ELSRKGQKVFSTIEEMSKPVIAAINGYALGGGLELAISCDFRIASEHAELGSPEINLGIIPGGGTQKLVRLVGLRNAKRLVFLGERIKAEEALRIGLVDKVVPFENLETMSLAKKLSEGPPIALRYAKYALNGSQVPLEVGLRLESALMALLFSTNDVKRGIEAFM..... 253
432 0.000e+00UniRef50_H2C971 Enoyl-CoA hydratase/carnithine racemase n=22 Tax=cellular organisms TaxID=131567 RepID=H2C971_9CREN  ali  21  3.FETLELKKEGHLAWIILNRPERLNSINGKLLEELQRALTELEADRVKVLLITGKGKAFCAGADITQFTELNPT--EAWKFAKMGREVMTRIENLMKPVIAVINGYALGGGLELALACDIRIASEEAQLGLPEINLGIFPGGGTQRLTKLVGKGRAVEIMMTGDRIGAKDAEKMGLVNRVVPALQEEATKLAEKIAKKSAVALALIKEVVNGVDAPLQSGLAMESIGWGVAFSTEDKQEGVKAFLEKRE. 253
433 0.000e+00UniRef50_A0A1D1ZJ58 Putative enoyl-CoA hydratase, mitochondrial (Fragment) n=42 Tax=Eukaryota TaxID=2759 RepID=A0A1D1ZJ58_9ARAE  ali  24  58.YKDILTESHGKVGLITLNRPKALNALSSDLFHEINNALEKYDDPNVSAIVITGNERAFAAGADIKEMANKTFAQAYKTSFLDH----WGKINDIRKPIIAAVNGFALGGGCELAMSCDIIYAGEKAIFGQPEIKLGLIPGGGTQRLVRAIGKSKAMEIILTGRNFNAQEAERWGLVSKVLPADKVLDEALGQEIANLSQISIQAAKDSVNAFELSLKDGSRYERKLFYSLFSLKDKEEGIGAFVEKRE. 306
434 0.000e+00UniRef50_A7S886 Predicted protein (Fragment) n=7 Tax=Eumetazoa TaxID=6072 RepID=A7S886_NEMVE  ali  22  1.YEHILTETKGNVGFIQLNRPKALNALCNDLMYELSDALDAFEADNVGCIVLTGCGRAFAAGADIKEMQPLTYQKCLSGDFLGH----WTRVSKCTKPVIAAVNGFALGGGCELAMMCDIIYASDKAKFGQPEILIGTIPAGGTQRLTRAVGKSLAMEMVLTGDPINADHALKAGLVSKVFPADDLVPNAIAEKIAGLSKLSVGIAKECLNAYEMTLEEGLKVEKRMFHTTFALDDRKEGMTAFIEKRK. 252
435 0.000e+00UniRef50_A0A1D1V5H7 Uncharacterized protein n=86 Tax=Opisthokonta TaxID=33154 RepID=A0A1D1V5H7_RAMVA  ali  22  155AFEFLIVDVKGNVGCIQLNRPKALNALSSPLMSELNTALEQFEDDNINAIVITGSEKAFAAGADIKEMQNRQFPDVYRINFLNN----WNKLTEIRKPVIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEINIGTIPGGGTQRLIRAIGKSKAMEMILTGNRMGAAEAEKAGLVSKVFPPDQLLSEKLADKISAQSRVAIMMCKEAVNAAETSLAEGLKFEKRLFHATFAMNDRKEGMTAFLEKR.. 406
436 0.000e+00UniRef50_M1IE41 3-hydroxybutyryl-CoA dehydratase n=7 Tax=TACK group TaxID=1783275 RepID=M1IE41_9CREN  ali  22  9..ETIIVKNEPPFLRITLNRPDRLNAINKKMIEEIRTVLEEVKDEKVRVIIFTGNGRAFSAGADISQFKELEGLTA--WQFAMKGRELMDYIENYPKPTIAMINGYALGGGLELALACDIRIASDEAQLGLPEITLGIYPGGGTQRLLKLVGKSRTLEMIMLGERISAKDAERIGLVNRVVPSNDLEKETLASKLAERPPLAIQLSKLIVNGMNSPITVGLNMESLGWGVIFTTKDSKEGVNAFLEKRK. 258
437 0.000e+00UniRef50_A0A0F2Q1Y9 Crotonase n=2 Tax=Bacteria TaxID=2 RepID=A0A0F2Q1Y9_9CLOT  ali  22  3...NLLYKVDGKIAEVTINRPQVLNTLSYQVLEELLGLLQDVANSEIKVLIITGSGKAFIAGADIGEMQSYSIL--EAKKFSKLGQQVFLTLENLNQVTIAAVNGYALGGGCELSLSCDIRFASENAKFALPEVKLGIIPGGGTQRLPRLIGSGIAKELIFSGEIIDVQEAYRIGLVNKIFNQEDLLAKEYAEKVCSNGTYAVSLAKSVINGLNKDLENACNYEAQVFSECFITKDHKEGINAFLEKR.. 251
438 0.000e+00UniRef50_T2MGB5 Enoyl-CoA hydratase,mitochondrial n=2 Tax=Hydra vulgaris TaxID=6087 RepID=T2MGB5_HYDVU  ali  23  341SYDNILVEIKNNVGVIRLNRPKSLNALCNALFNDLSQALKSFEADSIGAIVLTGSDKAFAAGADIKEMQNKEYADVLGGSFLSH----WDCITQCTKPIIAAVNGFALGGGCEVAMMCDIIYAGDKAKFGQPEILLGTIPGGGTQRLARAVGKSKAMEMCLTGVPINAQEALQFGLVSKVVPADQLVDEKTASLIAANSKLITALCKEAINGFELPLKEGCHLEKRLFHATFGTLDRKEGMDAFVEKRK. 593
439 0.000e+00UniRef50_A0A1V5DXA7 Putative enoyl-CoA hydratase echA8 n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5DXA7_9DELT  ali  20  3.YKTINYTKKDGIATVTLNRPASMNALNTQVFGELQHIFSRTEDDDVKVVVITGSEKFFAAGADIMELANIA-TPLDVQRYARLSREVFRQIEAAEKPLIAAVSGFALGGGCELTLVCDLRIVSESAVFGLPEIKIGVLPGGGTQRLPRLVGTTKAKELLYTGDNIDAQEALRIGLVNKVVPVEKLPEEALAKKIAARPAAAVKMIKLAVDGINLDIKSAIAYEARCFEILFSTYDQQEGMKAFREKRK. 254
440 0.000e+00UniRef50_A0A212LVF0 Enoyl-CoA hydratase-isomerase n=114 Tax=root TaxID=1 RepID=A0A212LVF0_9FIRM  ali  23  3AYNNLIVERDGAVVVITINRPRELNALNRATILELDSVFNELEDPAVGAVILTGGGKAFVAGADIAEMVNIGAVAA--RDWSRLGQQVFSRIENFPRVVIAAINGFALGGGCELSLACDIRIASEKAKFGQPEVNLGITPGAGTQRLPRLVGKSQAKLLILTGDVIDAQAAQAIGLVDKVVAHEELLAKALAGKIIAKAPVAVSQAKIAINGVEMDSEQAYAYEAELFGMCFTTDDQTEGMSAFLEKRK. 255
441 0.000e+00UniRef50_A0A254R9N6 Crotonase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A254R9N6_9RHOB  ali  22  4.YETLIYDKDNGVVTITLNRPDRMNTLGGTMKPDLYDAFQNLNDRDVRCVILTGSGRAFCAGADIKERAANRPPAAEYYAKQKFTHDLTRLIEEFERPVIVAINGVCLGGGMEIALCGDIRIAADHAKLGLPEVKLGVLPAGGTQRMPRLIGGPKAKELMFTGRHITAQEALDYGIVNRVVPMADLMARELADEIAAQPPLSVAFIKQAINGMQVGIEEGLEYERLAASMIVDSEDRKEGMAAFLEKRK. 259
442 0.000e+00UniRef50_F4BPR1 3-hydroxybutyryl-CoA dehydratase n=59 Tax=Bacteria TaxID=2 RepID=F4BPR1_CARS1  ali  21  4.YNTLTLEKAEGIATLKINRPKMLNALSQEVLEEVSVALDEVEKDAIRVLIVTGSGKAFVAGADIKEMKEK--NAVEGTIFSSLGNAVFSKLEQLRQPTIAAVNGFALGGGCELALACDIRIGAENAKFGQPEVGLGIIPGGGTQRLPRLVGTGKAKELIYTGANVAAEEAYRIGLLNKVVAVEDLLEEAMAEKIIKNSPLGVEGSKKTINGMQMSIQQGLALESEVFGALFATEDQKEGMTAYVEKR.. 254
443 0.000e+00UniRef50_A0A2H6AT73 Putative enoyl-CoA hydratase echA8 n=517 Tax=root TaxID=1 RepID=A0A2H6AT73_9BACT  ali  22  2AYETILVERRGPVGLITLNRPRQLNALNSQLIRELNQALDELEDDSIAAIVITGSEKAFAAGADIKEMMELDFMGAFRSDFIAPWQKVAER----KKPLIAAVAGYALGGGCELAMMCDIIVAAENARFGQPEINLGTIPGGGTQRLVRAVGKSKAMEMVLTGRMMDAQEAERANLVSRVVPTDRVVEEAIAEEIAAKSQPVVQMAKEAVNAFETTLAEGLRFERRLFYATFATEDRAEGMRAFAEKRK. 251
444 0.000e+00UniRef50_A0A136JWD3 Short chain enoyl-CoA hydratase n=35 Tax=cellular organisms TaxID=131567 RepID=A0A136JWD3_9BACT  ali  20  3...SITIERRGRVAILTINRPDKLNALNSTVHREAVAALDELRNDEVRVLVITGAGKAFIAGADISEFEGHTPVTQ---RDAFYGRSLFNSLDQFPKPVIAMIDGFCLGGGNELAMACDIRMASDKSRFSQPEINLGIIPGGGTQRLTNLVGEGRSMEMILTGDMIDAATAERYGLVNHVYPSAELEAEKLAEKIAEKAPIALQLCKEAVKASRSNLDEGLRREIDLFAIVFSTEDKQEGVSAFLEKRK. 251
445 0.000e+00UniRef50_A0A2W1AHR0 Enoyl-CoA hydratase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W1AHR0_9CHLR  ali  19  4..EFVKYEKDGEVGLVTLNRPDRLNALGQDVRRELNEVLDEIEVDATRVVIFAGEGRAFCAGADINDLSAGEDLRSPVPDPSET-PEVIKRIGDLNKVVIAAVHGAAVGGGCEVALACDMRIASENARFGLPEIKLGIMPGGGTQRMPRLVGEGRAKWLMMTGEFIDAQTSLQWGLVNQVVPNEELMAEALAQTLVAQPPLALAFIKSAVRGLESSLPAGIEYEARCSYILQQTEDKAEGTKAFLEKRK. 253
446 0.000e+00UniRef50_UPI0003C1ADBB uncharacterized protein LOC102324064 n=1 Tax=Pantholops hodgsonii TaxID=59538 RepID=UPI0003C1ADBB  ali  22  277.YETILVEKRDEVGVITLNRPKALNALNSVLLKELRHILSSFADDSIGAVIITGSEKAFAAGADIKEMQGLDFVDAYVGDFLGG----WDEVAATRKPVIAAVSGFALGGGCELAMMCDFIIASDTAKFGQPEITLGVIPGGGSQRLTRAVGKAKAMDLVLTGRMMDAAEAERAGLVSRIVPGEKLMEEAVATRIASLSRASVLMAKESVNSFEVPLAEGLRYERRSFQSLFATADQKEGMAAFVEKRK. 525
447 0.000e+00UniRef50_M8DR89 Enoyl-CoA hydratase/carnithine racemase n=26 Tax=root TaxID=1 RepID=M8DR89_THETY  ali  21  3.FKNIKLELNEGVSLIAIDRPKSLNALNLETLKEIDQALEEVKENEEVKVIITGAGKAFVAGADISEMKDMNPL--KAKEFAEFGQKVFRKIELMKKPVIAAVNGYALGGGCELAMACDIRIASHNAKFGQPEVGLGIIPGGGTQRLPRIVGVSKAKELIYTGDMIDAEEALRIGLVSKVVEQEKLLEEAIAKKIMSKGMIAVRLAKEAINGINADIETGMSYEAKAFAVCFATEDQKEGMAAFLEKRKF 257
448 0.000e+00UniRef50_A0A1H6JCV1 Enoyl-CoA hydratase n=1 Tax=Chryseobacterium hominis TaxID=420404 RepID=A0A1H6JCV1_9FLAO  ali  18  2NYESITLTIDNKIAVLTINRPESLNALNAQVFTDLDSAFDFLKDESVNCIIITGSGKAFVAGADIKEFSKYGN--EQAKELSKRGHTIFQKIENMNKPVIAAINGFALGGGLELAMACHIRYASENAKLGLPEVTLGLIPGGGTQRLPKLVGKGIANEIIFSAKMITAEKAKSIGLVNEVFSSEELITQELAKNIVKNSPQGIAKAIHAVNMSDT--EKGMEYEIESFGELFSQEDFKEGVTAFLEKRK. 251
449 0.000e+00UniRef50_A0A0S8FSP5 Uncharacterized protein n=1 Tax=candidate division WOR_3 bacterium SM23_42 TaxID=1703779 RepID=A0A0S8FSP5_9BACT  ali  20  3.YEYILVDKADKIGFVKINRPDVYNAVSVEAMLELEKAVQDFNNDEVSVVVITGEGKSFVSGSDISRLVEMDSLTA--REYSQIGQRVLAFIENMEKPVIAAVNGFALGSGCELAMACDIRVASEKAKFGQPEVKLGLIPGAGTQRLARIVGIAKAKELIFTGEMIDAQEALRLGLVNKVVAPDVLLEESIARKIIEVGPTAVRIAKTVINGIDANLTTANSYETEAFSILFSTEEAKEGMTAFLEKRK. 253
450 0.000e+00UniRef50_UPI00076FBE83 uncharacterized protein LOC107225458 isoform X2 n=1 Tax=Neodiprion lecontei TaxID=441921 RepID=UPI00076FBE83  ali  23  423SYEFIKTEKVGNVAVITLNRPKALNALCDKLVDELGDAVTKFDDDSIGAVVITGSEKAFAAGADIKEMKDRSYAQTVKSKMLAG----WEDISKASKPIIAAVNGYALGGGCELAMLCDIIYAGEKARFGQPEIVIGTIPGGGTQRLIRVIGKSKAMEMVLTGNQISAQEAEKAGLVSKIFPPEQLLPEALGEKISTHSPLIVSMAKESVNAAETTLRQGLQLEKKLFYGTFATADQKEGMTAFVEKRKF 678
451 0.000e+00UniRef50_D4N101 Enoyl-CoA hydratase/carnithine racemase n=308 Tax=Bacteria TaxID=2 RepID=D4N101_ANAHA  ali  21  3...NLLMEVENEIAVVTINRPKSLNALNSETLAELDACFSEIERKDIKVVILTGSGKAFVAGADISEMVNATP--AEGRKMGMLAKEAFLKLETMPQVTIAAVNGFALGGGCEISMACDIRIASDNAKFGQPETGLGILPGGGTQRLARLVGKGRAKELIFTCDMIDANEAYRIGLANKVVPQAELLDKAMAEKIMSKGSYAISLAKEAINGTETDLSSGLTLEADLFGLAFSTDDKKEGMTAFLEKRK. 252
452 0.000e+00UniRef50_A0A1V4WEI3 Putative enoyl-CoA hydratase echA8 n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V4WEI3_9DELT  ali  19  3.YKNLLLEIKDGIAVVKINRPKALNALNSETLDELRHAGDAIANKDVWVVIITGEGKAFIAGADILEMKDMNPY--QGMIFSQRGHEAFAAFENMNKPVIAAVNGFALGGGFEVALMCDIIYASDKAKVGFPETTLGIFPGGGTQRTAKLCGLAKAKELIFTGKMISAKEAYEIGLINKVVPHEELEVMALAEKIRSNGPISMGLAKALINSLFLDMESALMLEAKDFGLCFGTKDQKEGMTAFVEKRK. 254
453 0.000e+00UniRef50_A0A2H5YDT0 Short-chain-enoyl-CoA hydratase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5YDT0_9BACT  ali  22  3.YETILYEQEGALGILTLNRPHRLNALSRQLVQELDAFLGEIERREVRVLILRGEGRAFCAGADIKEMAEEEP----GVALPRATTRIATRLENLPLITIAAVHGYAVGGGCELAMACDLRVASEDAQFGQPEVKLGILPGGGTQRLPRLIGIGRAKELMYIGDFIDARTALAWGLVNRVVPRERLMEEALAQVLLQRPPLALALIKSCVQGMQTDLHSALEYEARCSTILHASEDRREGMRAFVEKR.. 250
454 0.000e+00UniRef50_A0A069ADE8 3-hydroxybutyryl-CoA dehydratase (Crotonase) n=626 Tax=root TaxID=1 RepID=A0A069ADE8_CLODI  ali  21  9.YENVAVEVDGNICTVKMNRPKALNAINSKTLEELYEVFVDINNDEIDVVILTGEGKAFVAGADIAYMKDLDAVAA--KDFSILGAKAFGEIENSKKVVIAAVNGFALGGGCELAMACDIRIASAKAKFGQPEVTLGITPGGGTQRLTRLVGMAKAKELIFTGQVIKADEAEKIGLVNRVVEPDILEVEKLAKIIAKNAQLAVRYSKEAIQGAQTDINTGIDIESNLFGLCFSTKDQKEGMSAFVEKRE. 259
455 0.000e+00UniRef50_A0A151EZQ6 Crotonase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A151EZQ6_9EURY  ali  21  2AFKNIKIEKKEGIATIKINRPQVLNALNKETISEITSAVEELDDTSVKVVIFTGEGKAFIAGADIKQMSEMTPL--EGKKFAELGHNMLMKIENSRIPFIAAINGYALGGGCEVLMACDICIAAKSAKLGQPEINLGVHPGGGTQRLPRLVGRMKAKELMFTGKNIDAEEACKIGLVNMVVDDDKLMAQKLAGQIASKSTVQTAFIKSLVNGADIDINTACSLEISYFGSSFSTNDQKEGMKAFLEKRK. 254
456 0.000e+00UniRef50_F9VNG3 3-hydroxypropionyl-CoA dehydratase n=38 Tax=Archaea TaxID=2157 RepID=F9VNG3_SULTO  ali  25  2..ETIVIKKETPIGWIYLNRPDRLNAINQQMIKELRQGIDEVYDSDIKVIIITGNGKAFSAGADISRFKELNGYTA--WQFAKSGRELMDYIENISKPTIAMVNGYALGGGLELAMACDIRIAAEEAQLGLPEINLGIYPGGGTQRLVRLIGKGKALELMLTGDRISAKEAEKIGLVNKVVPLSNLETRNFALKLAEKPPISIALIKLLVNGIDLPILAGLNMESLGWGVVFSTEDEKEGVSAFLEKRK. 251
457 0.000e+00UniRef50_Q1ZXF1 Probable enoyl-CoA hydratase, mitochondrial n=69 Tax=cellular organisms TaxID=131567 RepID=ECHM_DICDI  ali  21  27.....TTEKKGRVGLVTLNRPKSLNALSDGLISEINSAVKLFEDKDVGSIIITGSEKAFAAGADIKEMEKVTLPDAYNNDLLAQWHD----LTKIRKPIIAAVNGYALGGGCELAMMCDIIIAGEKAVFGQPEIKLGTIPGGGTQRLIRAIGKSKAMELVLTGNNLTAVEAEKAGLVSKVVPVEELLTEAMAEKIASYSQLTVAMAKEAVNAYELTLQEGIRFERRMFHSTFGTHDQKEGMNAFVEKR.. 270
458 0.000e+00UniRef50_P52046 Short-chain-enoyl-CoA hydratase n=131 Tax=Bacteria TaxID=2 RepID=CRT_CLOAB  ali  21  5...NVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDEVLAVILTGAGKSFVAGADISEMKEM--NTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARFGQPEVGLGITPGGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMAKEIANKIVSNAPVAVKLSKQAINGMQCDIDTALAFESEAFGECFSTEDQKDAMTAFIEKRK. 254
459 0.000e+00UniRef50_W7KXP6 3-hydroxybutyryl-CoA dehydratase n=4 Tax=TACK group TaxID=1783275 RepID=W7KXP6_9CREN  ali  23  2..ETVDVKKDNGIGWVFLNRPDKLNAINMKMIQELLTAIKNYEDNEVKVIVITGRGKAFSAGADISQFKELTPAGA--WELARKGRELMDYIERVPKPTIAMINGYALGGGLELAMACDFRIASEDAMFGLPEINLGIYPGGGTQRLLRLVGKTKALEMMMTGDRITAQEAERIGLLNKVVPKEKLEEEKFAQKLMEKSPLILSILKSVVYGNDAPLLDGLNMESLGWGFVFSTNDQKEGVNAFLEKRK. 251
460 0.000e+00UniRef50_A0A1B0GMB5 Uncharacterized protein n=1 Tax=Phlebotomus papatasi TaxID=29031 RepID=A0A1B0GMB5_PHLPP  ali  22  32AYEFIKVERSGNVGVITLNRPKALNALCNGLMTEVSKALDDFEDKSVGAIVITGSEKAFAAGADIKEMQNNTYSQCILGNFLQD----WTRVARTQKPVIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIAIGTIPGGGSQRLTRVVGKSKAMEMCLTGDMITAQQAEQMNLVSKVVPADKLLEEALGEKICKHSPLIVALCKEAVNAYETTLAEGLKFERRHFHATFSTKDRREGMTAFVEKR.. 283
461 0.000e+00UniRef50_A0A2U3KGY5 Enoyl-CoA hydratase-isomerase n=16 Tax=Bacteria TaxID=2 RepID=A0A2U3KGY5_9DELT  ali  21  2SYENILFEIHDGVGVLTFNRPKVLNALNPQTLDEVADVIRAAREDAIRVLVLTGAGKAFVAGADINEFLKFNTLSA--RYFAEKGQGIFFEIEQLPKPVIACVNGFALGGGCELAMACDFIYASEKARFGQPEINLGIIPGGGTQRILRLIGRARAKELCMSGEMIDARQAKEIGLVAKVFPADQLFDETMARMLASKSPAGLRSIKKVIDGSDIDLRSGCALEAEAFGVLFGTEDMREGVSAFLEKRK. 254
462 0.000e+00UniRef50_A0A1Q3SEG0 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1Q3SEG0_9CHLR  ali  25  3.YKTILTEREDSTFIITFNRPEKLNALSPELTAEVVDALNGVRDSSVRAIIITGGPKVFAAGADLSKMQTASSIEMYNRNLS---GDMWTTVAEMPQPTIAAVSGYALGGGCELAMACDLRLASETARFGQPEINVGIYPGGGTQRLSRLVGLGRAKELVFLGEHIGAEEAYRIGLVNKVVPNETLLDEAWAKKLASKPPFTLRVVKQVMQGYDLDLQSAIKLERLGFVGLFGTQDQREGVTAFLEKRK. 252
463 0.000e+00UniRef50_D3BN52 Enoyl-CoA hydratase n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3BN52_POLPP  ali  23  369.FQNILVEKKGKVGVVTLNRPKALNALSDGLINEINSAVKQFEDKEVGSIIITGSEKAFAAGADIKEMEKKTLAEAYNTDMLAQWHDLTY----IRKPIIAAVNGYALGGGCELAMMCDIIIAGDKAVFGQPEIKLGTIPGGGTQRLIRAIGKSKAMELVLTGNNMNAVEAEKAGLVSRVVPAEELLAEAMAEKIASYSQLTVSMAKEAVNSYELTLKEGIHFERRIFHATFGTHDQKEGMSAFVEKR.. 616
464 0.000e+00UniRef50_A0A1I7GQT8 Enoyl-CoA hydratase n=2 Tax=Eubacterium pyruvativorans TaxID=155865 RepID=A0A1I7GQT8_9FIRM  ali  24  2.YENILYEVKDHVGYLTINRPKALNALCTAVLEEIDDCLDTAPDNDVHVVVVTGAGRAFVAGADISEMQ--TKPVLEGHDYTELGHKVMDKIDNSPKVFIAAVNGFALGGGCELSMACDIRIASEKALFGQPEVGLGITPGGGTQRLPRLVGKGMAKYMILAAKNVKADEALRIGLVQQVVPAEELMVEKLAKSIAAKAPIAVQQSKMAINGMNTDLRTGCRLEIEGFQQCFASEDRVEGMSAFVEKR.. 252
465 0.000e+00UniRef50_A4YI89 3-hydroxypropionyl-coenzyme A dehydratase n=12 Tax=TACK group TaxID=1783275 RepID=HPCD_METS5  ali  24  3.FETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAEDPEIRVIIITGKGKAFCAGADITQFNQLTP--AEAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLPEINLGIYPGGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLETRKLAEKIAKKSPISLALIKEVVNGLDSPLLSGLALESVGWGVVFSTEDKKEGVSAFLEKRE. 253
466 0.000e+00UniRef50_A0A1U7MEQ3 Putative enoyl-CoA hydratase echA8 n=23 Tax=Bacteria TaxID=2 RepID=A0A1U7MEQ3_9FIRM  ali  22  3TYNNVLYQTDNGIGMITLNRPKALNALNSELLTELNGLLDEIADDSVKVVIITGSGKAFVAGADIAEMQNISPL--EGRAFGKFGQAIFNKLENIPQPVIAAVNGFALGGGCELAMACDIRIASDKAKFGQPEVGLGIVPGGGTQRLPRLIGKGRAKELLYTADMINAEEAYRIGLVNRIVAAEELLAKELAEKIMARAQAAVQLCKAAVNGMDTDLESGIAYEAEVFGLCFASADQKEGMSAFIGKRK. 255
467 0.000e+00UniRef50_A0A151FCC2 Enoyl-CoA hydratase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A151FCC2_9EURY  ali  20  3SYETLDVESRNGVATVSLNRPDVYNAFNELQVAELTECFSHVEDDTVYAVVLTGNGRYFCAGADLKWMQKVASFTKEENEGARKMAHMYHTINDCTKPVVGCINGSAFGGGVGLVAVCDVAVCNSDAVFAFSEVNLGIVPAVISRYVLPKIGVSHARSLFTTGERFSAQKALHIGLVHEVCPELDKKIDEKVSVLRSSGPRAVSAAKKLIQTWSVLEDNQFEYTVELIADLRASKEGKEGIMAFLEKRK. 256
468 0.000e+00UniRef50_P40805 Probable polyketide biosynthesis enoyl-CoA hydratase PksH n=67 Tax=Bacteria TaxID=2 RepID=PKSH_BACSU  ali  100  5TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQF 254
469 2.000e-98UniRef50_A0A291GJC7 Enoyl-CoA hydratase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A291GJC7_9MICO  ali  23  12....LRTEVRDRIGTITLHRPEQRNALNQALLAELSTVLDAWEADAVQGIIITGSGPAFAAGADISEVAAWGVTEG----LAATMQRLYDRLQDFPKPTLAALNGVAMGGGLELSMSCDIRIAAEEARMGLPEVGLGVLPAGGTQRLSRLVGTGRALEMILTGRALTAEQAERYGLVTTVVPAADLLAAEIMTRILAKGPLAIRLAKMVIGGHDTDQRTGLLLEQLAQTLLFTTADKAEGTAAFLEKR.. 257
470 2.000e-98UniRef50_A0A2A5BKI3 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A2A5BKI3_9PROT  ali  23  2SYQTIQYDNDGQIAVLTFHRPETRNAINEVMIHELDDILKNAADKKLRVLILTGAGKSFVAGGDISMIDKGLDHPYEFFLLHDILTTIGKRLERLTIPVIAAINGAAFGGGLELALACDFRIMADTAQLGLPEAGLGVIPAGGTARLARIIGREQAFLMEMTADPVNAQEAFRIGLVSEITPQEKEAAHQLARRICARAPAAVSTIKRAIMAENMPLEGAIDYCQQAAMLLGTTEDAREGMRAFLEKR.. 254
471 2.000e-98UniRef50_A0A1H4C6I0 Enoyl-CoA hydratase n=1 Tax=Desulfuromusa kysingii TaxID=37625 RepID=A0A1H4C6I0_9DELT  ali  20  5.YETIKCEVNNKIALVTLNLP-KYNILNGQMLRDIRDVMNELKQEDLRCAIFTGEGRAFCAGADVGEFTDPTIDDLEEVDVWARG--ILTKLANFPIPTIAAINGYALGGGLELALACDIRVASETAKMGLVETSLGMIAGGGSQRMVRTIGAGQAKKMMFTADKISAEKALQIGLVQEVYKAEELRTMEMAQKIAANSPVANRLTKQGVNYLNQGINDGLDLERMLDRAAYESEDSKEGMKAFEEKR.. 254
472 2.000e-98UniRef50_A0A2E5GXL2 Enoyl-CoA hydratase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E5GXL2_9BACT  ali  21  6...YLSIAIDGKIAVVTINRQDKLNALNLAVIKEIEQVFIGLEDDDVRGIILTGEGKAFVAGADIGELADLNRQT--GRVQSKRGQRVFSLIENFSKPVVAAINGYALGGGLELALSCHLRVASRTARFGFPEVSLGIMPGGGTVRLSRVIGLGRAIEMTLTGDMIGADKAENFGLVSAVFGSDDFLSKDFLGRIIRHSPGAIQKALRSLYAQDTRTVEALVMENDLFGQLSGSEDMREGISAFLEKRK. 255
473 2.000e-98UniRef50_A0A2D9VDI2 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D9VDI2_9BACT  ali  22  3..KYIKLKIKDKTLIIYLNRVEKLNALNSTMIKELDEVLNQLNNESVRCVIIAGAGKSFVAGADIKEMEAFSPL--EAADYSNKGLNLFNKIEAYTKPIIASINGYALGGGCELAMACHIRYVSPKSLLGLPEVTLGLIPGGGTQRLRNLVGLGKASELIFSGKYIKSEEALKIGLINKICEDPMEESIKLANKISQNSPLAIKYAIQMVSGLNNNYLDSFDIENNLFSNLFDASDSKEGISAFLNKR.. 250
474 2.000e-98UniRef50_A0A1P8F8V9 Enoyl-CoA hydratase n=3 Tax=Dehalogenimonas TaxID=670486 RepID=A0A1P8F8V9_9CHLR  ali  23  2...TIDFTTDGAFAVITLNRPEAYNALDLASLRALSDAVARFESDNLRVVIVTGTGKAFSAGADIDE-----TLPFMKEHGTKSLPPTIMRGQTVTKPIIAAVNGLALGGGFELALACDLRIAAVSARFGFPEIGLGLIPGGGTQRLPRLVGAGRAAEMILTGRAISADEAVRIGLVNKVVNDNELLALEMARAIAEKSAAAVGLAKEAIHGLDLPLNQALDFEAGLEDAVLHTPGFEEGMRAYREKRR. 247
475 2.000e-98UniRef50_T0CBF7 Putative 3-hydroxybutyryl-CoA dehydratase n=11 Tax=Bacteria TaxID=2 RepID=T0CBF7_9PROT  ali  21  4NFETIAFEKMGDFGVLKVNREKKYNALNSQVLHELKDFLSSLEGHDLKGMIFTGAGKAFIAGADIAEMSDMS--VDEGHDFSTLGQDVTLLLEGLNIPVIACVNGFALGGGCEMAMACDFIYATKTAVFGQPEVKLGLVPGGGTQRLAKLIGRNRAKEIIYTGRNVDINEAKEIGLVVRSFETQQEMAMNTLESIAKNSPNAIAISKQIMNGNDLTIEQGLDIEARHFGDIFSSYDMKEGTAAFVEKRK. 257
476 2.000e-98UniRef50_A0A0H4W7J4 Carnitinyl-CoA dehydratase n=127 Tax=Bacteria TaxID=2 RepID=A0A0H4W7J4_9BORD  ali  24  11.YETVTARPHGHVLVVTLNRPQAGNAINTQMGRDLLDLWNRLTEDAVRCVVLTGAGRIFCAGGDLKERNGMSRET--WQRQHELFERMYWTLVDLPLPVIAAVNGHAYAGGLEMALSCDFLYASREARFALTEVTLGIMPGGGTQNLPRAVGERRAKEILMTGRPFDAAQALDWGLANALHAPADVLPAALATAIAGNAPLSVRQIKKSVRGGQMELRTAFRFEIEAYNHLVDTDDRREGVLAFNEKRK. 264
477 2.000e-98UniRef50_A0A1V4VQF1 2,3-dehydroadipyl-CoA hydratase n=5 Tax=Clostridia TaxID=186801 RepID=A0A1V4VQF1_9FIRM  ali  20  2AYETIETVLKEGILLITLNRPSKMNSLNRVALDEIHKVLDEAEREEIKCVIVSGSEKVFCVGADISEVNKV-NSSFAGYANSRRFQECFGRFEKLSKPVVAAVRGYALGGGCELMIACDFRIVAEDAKMGFSEVNIGAIPGGGTAKLPLLINPLKAKEILCLGNLISGKDAAELGLVNKAVPAEQVLEEALAEQLAQKSPLVLKTIKQITNLATNDMESLLQHEAQGFGLIAASEDFKEGTAAFLEKRK. 253
478 2.000e-98UniRef50_A3VLN4 Enoyl-CoA hydratase n=49 Tax=cellular organisms TaxID=131567 RepID=A3VLN4_9RHOB  ali  25  4....VLTDRRDPVGCITLNRPEVLNALSYDLRQELVDALAVAADPDIRAVILTGGPKVFAAGADLNQIDRMGPVEMMEAAP----QQYWNAIADFPKPLIAAVNGRAFGGGFEMVLHCDIIVAGDSATFALPEPKVGLMPAGGTQRLPRAIGKHLAMRYLLTGDTMTAETARDLGLVSDLVADAEVMALALAQRISRRAPIALAQIKQAVTGADLSLDAGLMIERKALQLLLATQDKAEGIAAFKEKR.. 249
479 2.000e-98UniRef50_A0A0X9L688 3-hydroxybutyryl-CoA dehydratase n=436 Tax=cellular organisms TaxID=131567 RepID=A0A0X9L688_STREE  ali  20  14....IIVERQGRVGHIRLNRPKALNALNEATMRAVVAAVQELDDPEIGAILLSGSPKAFAAGADIKEMATKEFSEMYAADWFAG----WDGLTRARTPIVACVTGYALGGGCELAMMADVLVAGEGAKFGQPEINLGVIPGGGSQRLTRAVGKAKAMDMILTGRMIGAEEAERIGLVSRVVADEKALEEALAATIASKSKPASWMAKEAVNAAETTLAQGIAFERRVFHAAFATADQKEGMDAFTAKRE. 259
480 2.000e-98UniRef50_D4YK28 Enoyl-CoA hydratase/isomerase family protein n=14 Tax=Actinobacteria TaxID=201174 RepID=D4YK28_9MICO  ali  25  9....VRTEDRGPVRIITLDRPKALNALSGDLIDDLAVALSDAESDSVRAIVLTGSDKAFCAGADIGEIARMQDSKPLDPLMID---RLFGALDAVLKPTIAAVRGLAFGGGCELTLACDIAIAGESAQFGVPEVKLGVLPGGGTQRLISAVGKAKAMRMLLTGEPVNATWAESAGLVAEVVPDDQVVEAAIGNAIAANAPLAVRLTKDALASLETPLSAGLAHERRNFLLLLGTEDAQEGTSAFIERRR. 255
481 3.000e-98UniRef50_A0A0W8E462 Enoyl-coa hydratase n=5 Tax=root TaxID=1 RepID=A0A0W8E462_9ZZZZ  ali  20  8.YKFIKVRIENDIAIIQYNRPEALNAANAELVMERNDAVYQAGDPEIKVLIMTGNDKAYSAGGDLAAMVNYGVKGA--REFADKVTAASLSLTNLPKPTIAMIAGFCFGGGFENALSCDLRIAADNAKFALPEINVGIYPGAGTQRLPQHVSLCKAKELVFLGETIDAQTALDLGLINKVVPLAELEDTAMARKLAKKPAFSLRMAKEALNAAWTSLEKGMQIETHGWAMTYGTKDAKEGMNAFLEKRK. 258
482 3.000e-98UniRef50_A0A2H5YNF7 Short-chain-enoyl-CoA hydratase n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H5YNF7_9BACT  ali  22  2TWETIQYEKRDRVAIITLNRPQVLNAFNETMGQEVSRALAEAEDRGVGCVVLTGAGRAFCSGADVRVFRQRI---EESRRGGIVGEALMRQIYDLPKPVIAAINGPAVGLGATITLPCDIRLASDQARIGFIFARVGLILEFGSTFLPRIVGMAKALELGMTARIIDAQEALGIGLVSRVIPHERFLVMALASEIANGPTRVLGWLKEAVHGVQSDLEAALRTENEILDRCRRSPEHREGVMAFLEKRQ. 252
483 3.000e-98UniRef50_A0A1F2XQ82 Uncharacterized protein n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A1F2XQ82_9ACTN  ali  19  3..QYVSTEQDGAVAVVTIDHPPV-NALSAPLLEELEAEIDRLADDSVRAVVLKGAGRAFVAGADISEFPSLRAAVEEAHEAARGIQKLGARMDAARTPFVAAIHGFCLGGGLELAMCCDIRVASDDAQLGQPEIKLGLIPGGGTQRLPRLVGHGRAMLLNLTGDFIDGKTAYDWGLVEKVVPREELLEAAMAQAIAARSPHSVAVLRELARTTDLSLEEGLRREAYAFRQCLESEDGAEGVSAFLEKRE. 256
484 3.000e-98UniRef50_A0A2C8EW46 Enoyl-CoA hydratase-isomerase n=14 Tax=Proteobacteria TaxID=1224 RepID=A0A2C8EW46_9PSED  ali  22  17...........GVALLRLNRPQATNALSLELQALLSRYFVALADPQVRCILLTGGEKVFAA