current user: public

If you have questions about the server, please let us know.

Query: d4i0va_ a.1.1.1 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}, from SCOP207

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# E-value Template Links and tools%idFirst ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHRNDVLNRLast
1 8.000e-42UniRef50_K9ZA57 Group 1 truncated hemoglobin n=12 Tax=root TaxID=1 RepID=K9ZA57_CYAAP  ali  72  2SSLYEKLGGKEAVDIAVDKFYDKVLKDDRVNYFFANTDMKKQKAHQKAFMTYAFGGPDTFSGRDMRESHKHLVDNMGLTDVHFDAIAENLINTLKELGIEQNLIDEVGAIVGAVSHRNDVLNR 124
2 5.000e-41UniRef50_P73925 Group 1 truncated hemoglobin GlbN n=112 Tax=root TaxID=1 RepID=TRHBN_SYNY3  ali  59  2STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPAHKRDVLNQ 124
3 2.000e-40UniRef50_A0A1Q7PFJ6 Group 1 truncated hemoglobin n=10 Tax=Bacteria TaxID=2 RepID=A0A1Q7PFJ6_9BACT  ali  36  36.SLYDRLGGKPAITAVVDDFVGRVAADNRINGKFANADLPRLKMMLVDQICQASGGPCTYTGRDMKTAHAGM----GINGSEFDALVRDLVATLNKFKVPEREKNELLAALGPM--RTDIVER 151
4 1.000e-39UniRef50_A0A1Q8ZD49 Group 1 truncated hemoglobin n=12 Tax=Bacteria TaxID=2 RepID=A0A1Q8ZD49_9CYAN  ali  72  2STLYDKLGGAAAVDLAVEKFYEKVLADERVQHFFAHTDMQQQKKHQKAFMTYAFGGAKHWDGRPMRDAHKELVTEMGLTDSHFDAIAEDLVATLVELEVPQALIDEVVQIVGSVAHRSDVLNR 124
5 1.000e-39UniRef50_A0A1G9UI78 Group 1 truncated hemoglobin n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A1G9UI78_9DELT  ali  52  45PSLYAQLGGEAAVDAAVDRFYAKVLADDRVSDFFEGVDMQRQAAKQKEFLIFAFGGPVTYSGQDMRAAHAHLVEEKGLSDMHFDAIVELLGETLREMGVEENLIAQAAAVAEIV--REPVLNK 165
6 2.000e-39UniRef50_A0A1J1LLV4 Group 1 truncated hemoglobin n=9 Tax=Bacteria TaxID=2 RepID=A0A1J1LLV4_9CYAN  ali  56  2STLYEKLGGAETVKLAVDNFYDRVLQDNRIKHFFNGMDMVKQKSHQRAFLTYAFGGTPQYDGRAMREAHKHLVEEQGLKGEHFDAIAENLELTLQDFEIAEELIAEVMSVASDPQHRSDVLNQ 124
7 3.000e-39UniRef50_A0A0S3PFQ0 Group 1 truncated hemoglobin n=46 Tax=Bacteria TaxID=2 RepID=A0A0S3PFQ0_9NOSO  ali  62  2ATLFEKLGGADAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRKHQKDFLTYAFGGTDKYNGRYMRQAHKDLVEKFGLNSEHFDAVAEDLIETLKEMGVSQELIAEVAAVAAAPQHRKDVLNQ 124
8 7.000e-39UniRef50_UPI000DE9FBCE group 1 truncated hemoglobin n=1 Tax=Roseimicrobium gellanilyticum TaxID=748857 RepID=UPI000DE9FBCE  ali  56  69GSLYQKLGGKAAIDAAVELFYVKVLADKRVNYFFEDINMNKQKRKQKEFLSAALGGPIPYVGKDLRSAHESL---GGLNDTHFDAIAEHLQATLTELKVDPQLIGQAMAIVGST--RDAVLNR 186
9 9.000e-39UniRef50_Q1N6W8 Group 1 truncated hemoglobin n=3 Tax=Proteobacteria TaxID=1224 RepID=Q1N6W8_9GAMM  ali  44  2PSLYEKLGGDKAVSATVEIFYKKVIADKELSPFFSGINIDRQKRMQSKFLTVAFGGPNNYSGQTMRAAHR-RPVELGLNEHHFNLVAGHLKQSLIELQVPPELVHQVMAIAAST--KQDVLNQ 121
10 1.000e-38UniRef50_D8P7L8 Group 1 truncated hemoglobin n=43 Tax=cellular organisms TaxID=131567 RepID=D8P7L8_9BACT  ali  31  37.SLYDRLGGKTAITAVVDDFVGRVAADTRINGKFANANIPRLESMLVDQICQASGGPCTYTGRDMKSTHAGM----GVSSSDFDALVGDLVATLNKFKVPEREKNELLSALGPM--KSDIVEK 152
11 2.000e-38UniRef50_A0A0K2GHS1 Hemoglobin-like protein HbN (Modular protein) (Modular protein) n=2 Tax=Nitrospira TaxID=203693 RepID=A0A0K2GHS1_NITMO  ali  34  36.SLYDRLGGKPAITAVVDDFVGRVAADSRINGKFANANIPRLKTMLVDQICQASGGPCTYSGRDMKAAHAGM----GITGEEFDALVGDLVATLNKFKVGEREKNDLLGALGPM--KKDIVT. 150
12 3.000e-38UniRef50_A0A0P8A6W1 Group 1 truncated hemoglobin n=13 Tax=cellular organisms TaxID=131567 RepID=A0A0P8A6W1_9CYAN  ali  55  2TTLFEKLGGEPAIDAAVDKFYNRVLNDDRIKHFFADTNMTRQRQHQKAFLTYALGG-GGYTGRSMRQAHKALVEEQGLRGEHFDAVAEDLLITLKEMGVADDLLSEVAAVVGDVQHKKDVLNQ 123
13 3.000e-38UniRef50_A0A1H2WM25 Hemoglobin n=6 Tax=Bacteria TaxID=2 RepID=A0A1H2WM25_9BACL  ali  26  6.SLYERMGGDSTIRQIVESFYPRVQQDPLLAPLFPE-DIAETIEKQRLFLTQFFGGPPLYSQIHGHPRLRARHMPFPITPHHAEAWLRNMDAALDDVGISGSLREEMWSRLTSTAV--HMVNR 124
14 6.000e-38UniRef50_A0A1R4HBC8 Group 1 truncated hemoglobin GlbN (Modular protein) n=2 Tax=Crenothrix polyspora TaxID=360316 RepID=A0A1R4HBC8_9GAMM  ali  45  320..LYDRIGGDKSMEIAVDLFYRKVLQDELVGKFFEDTDMESQRLKQKSFLSMVFGGPYQYSGLDIRSAHQHLVEQMGITDSHFDRVAALFQETLTELRVPEKEINSMMEILGTF--RGDVLGR 438
15 7.000e-38UniRef50_A0A1I1FAJ4 Group 1 truncated hemoglobin n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1I1FAJ4_9GAMM  ali  46  4.SLFDSIGGKDAVNAAVDLFYRKVLMDESISHYFESVDMEAQRDKQKSFLTFAFGGPNNYTGQSLREAHAPLVSK-GLNENHFTAVAGHLQSTLDELGVPEDLSSQVMGIAAGTIN--DVLNR 122
16 8.000e-38UniRef50_A0A1Y3A243 Uncharacterized protein n=1 Tax=Crenothrix sp. D3 TaxID=1880899 RepID=A0A1Y3A243_9GAMM  ali  43  203..LYDRLGGDKAIEIVVDHFYRKVLKDEFVAPFFEDVDMDAQRQKQKGFLAMAFGGPYHYTGRDLRTTHERLVKEMGLSEKHFDHIVGILKETFQELNIHEKEINQVLELLATT--RDDILCR 321
17 1.000e-37UniRef50_V9W715 Bacterial globin family protein n=54 Tax=Bacillales TaxID=1385 RepID=V9W715_9BACL  ali  23  8.TLYDRMGGEEAIRKLVEAFYPKVQADPLLSPLFP-ADITPVMEKQYLFLTQFFGGPALYSEKYGHPMMRGRHLPFPIDKARADAWLECMRAALEESGIEESLCVFLIDRLTGTAY....... 121
18 2.000e-37UniRef50_A9WBH0 Globin n=14 Tax=Terrabacteria group TaxID=1783272 RepID=A9WBH0_CHLAA  ali  25  4PTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFP-ADLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQ--AMMNR 123
19 2.000e-37UniRef50_A0A1H9WF22 Group 1 truncated hemoglobin n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1H9WF22_9BACI  ali  47  2ASLYDRLGGKDAIAAAVDQFYEKVLADETVNHFFTNTDMEKQRDHQTKFLTYALGGPNEYGGTSMKKAHEGMN----IQPEHFNAIAEHLADTLTELGVEQADIEAVMEKISGLA--PHIIHQ 118
20 3.000e-37UniRef50_A0A1G0LN75 Group 1 truncated hemoglobin n=5 Tax=Bacteria TaxID=2 RepID=A0A1G0LN75_9BACT  ali  38  35..LYERLGGQGAITAVVDTFVANVAADTRINAFFRGVDLPQLKRLLVEQICQATGGPCTYSGRSMRAAHTGMN----ITTAQFDALVEDLVRALDRFQVPAREKSELLTALGGM--RGDIVGR 149
21 3.000e-37UniRef50_D1A239 Group 1 truncated hemoglobin n=4 Tax=Actinobacteria TaxID=201174 RepID=D1A239_THECD  ali  33  8.SIYEAIGGEDALIAVVDDLYRRILDDPLLKGFFTSVNMPRLKGRQVEFFGQALGGPMTYTGASMRKAHAGL----GIGPEHFAAVAGHLKDALAGAGVPADLIEEIMNLVAPLA--DEIVT. 122
22 3.000e-37UniRef50_A0A235B428 Globin n=1 Tax=Paludifilum halophilum TaxID=1642702 RepID=A0A235B428_9BACL  ali  25  8.TLYEKMGGAETIDCIVSAFYPRVQSDPLLAPLFPE-DIRPVMEKQKCFLTQFFGGPPLYSQKYGHPRLRMRHLPFPITPSRANAWLRCMSLALDEAGIEGELRQEMWSRLYFTA--SHMIN. 125
23 5.000e-37UniRef50_Q22YY3 Group 1 truncated hemoglobin n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=Q22YY3_TETTS  ali  44  56.SVYDKLGGKENIALAVTKFYDKVLKDDRVKHFFKHTDMKHQTKQQTNFLCFAFGGPNNYVGKNMKDGHKGMN----IDDSQFNAIVELLAQTLTEMGVPQDVIGEIAAICEPL--RKDI... 168
24 9.000e-37UniRef50_A0A2P1PMQ0 Group 1 truncated hemoglobin n=1 Tax=Ahniella affigens TaxID=2021234 RepID=A0A2P1PMQ0_9GAMM  ali  41  2SSLYEQLGGEPTIELLVTKFYHRVLADPMLAPMFDGIDPDRLEQHQRRFLAVALGGPNAYQGRDLTSAHAHIARRHGLSDLHFDAVLKHLAATLRALNADESAIAQVMTIAEST--RSMVLGR 122
25 1.000e-36UniRef50_B4RAP7 Methyl-accepting chemotaxis protein McpH n=3 Tax=Phenylobacterium TaxID=20 RepID=B4RAP7_PHEZH  ali  50  17PTLFERLGGAPAVDAAVELFYAKVLADDRINRFFQGVDMVRQAGRQKAFLTMLMGGPNTYTGQNLRLGHRKLVAA-GLDDSHFDAVVGHLAQTLRELGAAEDDIAEAGALAES--ARADVLNR 136
26 2.000e-36UniRef50_A8JAR4 Putative truncated hemoglobin n=5 Tax=Chlamydomonadales TaxID=3042 RepID=A8JAR4_CHLRE  ali  45  10.SLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASAR........ 123
27 3.000e-36UniRef50_A0A2H3L0A1 Globin n=1 Tax=Candidatus Chloroploca asiatica TaxID=1506545 RepID=A0A2H3L0A1_9CHLR  ali  24  7PTIYEQIGGADVLRQLVEAFYTRVEHDPRLRPMFPD-DLEPGKEHQFLFLMQYFGGPGEYGERRGHPRLRMRHAPYPIGPVERNAWLEHMLASIDEVGIDEPARSVMRTYFEQAAN--AMMNR 126
28 3.000e-36UniRef50_A0A0V7ZVU6 Group 1 truncated hemoglobin n=2 Tax=Bacteria TaxID=2 RepID=A0A0V7ZVU6_9CYAN  ali  47  6STLFERLGGETAVKAVVDKFYLRVMEDSRINHFFAGVNMEKQREHQAAFLKFTFGGSSYYQGLSLRKAHQNLVKEFGLSDEHFDAVFEHLVSTLKDLNVANDLIQEVGDNLESIR........ 120
29 3.000e-36UniRef50_A0A269PN41 Group 1 truncated hemoglobin n=1 Tax=Pseudoalteromonas sp. NBT06-2 TaxID=2025950 RepID=A0A269PN41_9GAMM  ali  45  3SSLFENIGGKDAVNAAVDLFYRKVLMDDTISHYFESVDMEAQRNKQKSFLTFAFGGPNDYSGKSLRDAHTSLVNN-GLNEAQFMAVAGHLQATLDELDVPKALSEQVMAIAAGTM--DDVLNR 122
30 4.000e-36UniRef50_A0A1A3L1P2 Group 1 truncated hemoglobin n=2 Tax=Mycobacterium asiaticum TaxID=1790 RepID=A0A1A3L1P2_MYCAS  ali  34  14.SIYDRIGGYQAIETVVDDFYDRVLADAELAAFFTGTNMSRLKGRQAEFFAAALGGPDAYSGAPMKQVHQGR----GITMHHFGLVAGHLGDALTAAGVPPDTITEILGVIAPLA........ 123
31 4.000e-36UniRef50_A0A2D6K3B8 Group 1 truncated hemoglobin n=1 Tax=Micavibrio sp. TaxID=2024841 RepID=A0A2D6K3B8_9PROT  ali  40  6.SLYERIGGQEALKATVDRFYIKLVTDEIVGHYFSNIDLKKLIAHQCQFLSYVFGGPYKYDGRNMQDAHAHL----KISENDFSIVTNHLHKTLQELHVSSELIDEIMQIVATTH--DDIVSK 121
32 4.000e-36UniRef50_A0A1E5JVT9 Group 1 truncated hemoglobin n=66 Tax=root TaxID=1 RepID=A0A1E5JVT9_9GAMM  ali  47  4.SLFERLGGQNAVNAAVDIFYRKMLTDERVSHFFDDIDMKQQILKQKGFLTLVFGGPNKYNGKNMREGHAHL-LKRGLNDTHVDIVIEHLGATLAELGAPAEDINQVAAIANSV--RNDVLGR 122
33 4.000e-36UniRef50_A0A2A4UD50 Group 1 truncated hemoglobin n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2A4UD50_9PROT  ali  51  2.SLYEELGGEAAVNAAVDIFYRRVLSDAYVIRFFEGVDMEKQAAKQKAFLTMVFGGPNSYTGLDMREGHKHLV-KLGLNDTHFEHILAHLRSTLAELGVGAEKIQEVINIADSV--RADVLDR 120
34 4.000e-36UniRef50_A0A1Z9IE47 Group 1 truncated hemoglobin n=1 Tax=Opitutales bacterium TMED158 TaxID=1986794 RepID=A0A1Z9IE47_9BACT  ali  43  9..LFDRLGGSPAIDAAVDQFYERVLADEALAPFFEGISMLRQIKQQKAFFTTALGGPAIYKGRNMKEAHASL----AIQESHFGLVAKHLIETLAALGVSQDLIDEVVAAISPL--KDEIVN. 122
35 5.000e-36UniRef50_A0A218Q0U9 Group 1 truncated hemoglobin n=1 Tax=Nodularia sp. NIES-3585 TaxID=1973477 RepID=A0A218Q0U9_9CYAN  ali  57  2TTLFDQLGGKEAVDLAVDKFYERVLRDERINYFFKDVDMVKQRNHQKAFLTYAFGGTSQYNGRYMREAHQELVEKRGLNSEHFDAVAENLMDTLKEMGVPDHLLAEVAAIAAAPQHKKDVLN. 123
36 5.000e-36UniRef50_UPI0009FE54D7 hypothetical protein n=1 Tax=Alicyclobacillus vulcanalis TaxID=252246 RepID=UPI0009FE54D7  ali  24  60TSLYEAIGGAATFRRLVDAFYDRVEQDELLRPLFPPT-FDEVKERQYWFLTQLFGGPRLYTERRGHPMLRARHLRFPITLRHAERWLHCMAAAMQEVELPRAAQAVMLERLAGIAQ--HMVN. 178
37 6.000e-36UniRef50_A0A2E0A5S7 Group 1 truncated hemoglobin n=7 Tax=root TaxID=1 RepID=A0A2E0A5S7_9GAMM  ali  20  21GSLYEDLGGREGIATVVDNFITEISFDPSIYPFFSKTNVPRLREKLEEQFCMLSGGPCEYTGDTMEKVHTGMH----ISSAEFNRTVELLQSAMDDAGVPFTTQNRLIRLLAPL--REEIIRR 137
38 6.000e-36UniRef50_A0A1M9GQV1 Group 1 truncated hemoglobin n=16 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1M9GQV1_9MYCO  ali  42  4.TLYEKVGGEEGIAKVVDYFYELVLKDDSVNHFFKETDMEKQRRHQTKFISFALGGPNQYSGQSMAKAHEGMN----LQPAHFDAIAKHLHDALAHFGVSEADIDTALTKVASL--RDDIIYK 120
39 8.000e-36UniRef50_T0RE17 Group 1 truncated hemoglobin n=87 Tax=cellular organisms TaxID=131567 RepID=T0RE17_9PROT  ali  47  2STLFEQLGGEGAVDAAVDIFYRKVLQDDRIKDFFTDVDMDEQINKQKAFLTFAFGGPNKYSGLNMKDAHARLV-DKGMNDSHVDVVIELLGGTLKELGVGDNLIGEVAAIAESV--RGQVLGK 121
40 8.000e-36UniRef50_UPI0005D1F2B1 group 1 truncated hemoglobin n=1 Tax=Acidobacterium ailaaui TaxID=1382359 RepID=UPI0005D1F2B1  ali  36  4SSIYDRIGGAASVEAAVDLFYRRILADPELAPFFANVNVERLKRHQFAFLSHALGGPVRYTGAQMSQAHAHL----AIEQRHFDAVASHLAQTLRALGVDDQSVQEILAAIAPLAV--QIVN. 119
41 9.000e-36UniRef50_A0A1I0ELH4 Group 1 truncated hemoglobin n=1 Tax=Nonomuraea wenchangensis TaxID=568860 RepID=A0A1I0ELH4_9ACTN  ali  37  2ASIFDRIGGASAVSAVVDDFYGRVLADPRLASHFTGTDMSKLKSHQRSFVAAALGGPQEYRGKSMGEAHAGL----GITAEQFDAVVAHLAGALEHCGVEGETITAIAGALAPL--KAQIVS. 117
42 1.000e-35UniRef50_UPI00036D3BE3 hypothetical protein n=1 Tax=Methylosarcina fibrata TaxID=105972 RepID=UPI00036D3BE3  ali  42  303..LYDRIGGDKALEICTDLFYRKVLHDKLVGRFFQDVDMEKQRLKQKSFLTMAFGGPYQYTGADLRTSHKRLVDQYGLSDVHFDRVCELFRETVTEVNIPPDQVEEIMKILEGT--RESVLNR 421
43 1.000e-35UniRef50_A0A1W9G9G3 Group 1 truncated hemoglobin n=9 Tax=Bacteria TaxID=2 RepID=A0A1W9G9G3_9BACT  ali  33  41.SLYERLGGTGPITAVVGKFVSNVAADKRINGYFAKADIPKLKRQLVDQVCQASGGPCTYDGQDMKTTHKGM----KITTAAFNALVEDLVAALDTFNVPEQEKGELLAVLGPM--KKDIV.. 154
44 2.000e-35UniRef50_A0A176I9A3 Group 1 truncated hemoglobin n=18 Tax=Proteobacteria TaxID=1224 RepID=A0A176I9A3_9GAMM  ali  21  27...YQELGGKEGVEKIVDNFINEISFDQNIVKFFEGTDITRLREKLIEQFCHESGGPCEYTGDSMKDVHAGM----KITKAEFNRVVELLQAAMDDAGTPQTAQNRLIRSLAPM--RPDIIHQ 140
45 2.000e-35UniRef50_A0A2R6G2X0 Group 1 truncated hemoglobin n=3 Tax=unclassified Halobacteriales (miscellaneous) TaxID=38063 RepID=A0A2R6G2X0_9EURY  ali  36  19GTLYERLGGRDAIASVVEDFYDRMLDDERVADFFEDVDMARQRAHQTQFLSSVTGGPVEYSGADMREAHEGM----GITDEDYDIVGGHLDASLADAGVADTDREAVIAEVEAL--RDPIVGR 135
46 2.000e-35UniRef50_A0A1J4XWX1 Group 1 truncated hemoglobin n=38 Tax=Proteobacteria TaxID=1224 RepID=A0A1J4XWX1_9PROT  ali  46  47ASVYKQIGGEAAVNAAVDVFYRRVLADAYVNRFFAGVDMDKQAGKQKAFLTMVMGGPHNYTGKDMREGHKHLIR-MGLNDSHFDHILMHLRATLAQLGVPENLIQTIIGVAEST--RADVLDR 166
47 2.000e-35UniRef50_P17724 Group 1 truncated hemoglobin n=6 Tax=Tetrahymena TaxID=5890 RepID=TRHBN_TETPY  ali  47  6.TIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGMN----LQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHT--RKDMLGK 121
48 3.000e-35UniRef50_D8PAF5 Group 1 truncated hemoglobin n=9 Tax=Bacteria TaxID=2 RepID=D8PAF5_9BACT  ali  33  43.SLYDRLGGKPAITAVVDQFVANVAADGRINSRFATTDIPKLKGHLVDQVCGATGGPCSYRGRDMKSTHLGMQ----ISSADFGALVQDLVAALDKFNVPAGEKGELLGLLGPM--KKDIV.. 156
49 3.000e-35UniRef50_A0A257PPG0 Group 1 truncated hemoglobin n=1 Tax=Thiomonas sp. 20-64-5 TaxID=1970453 RepID=A0A257PPG0_9BURK  ali  29  16PTLYEQLGGKEAITKVVHDMILNVAADNRINHFFAKTNIPHLQMELVTQVCEGTGGPCKYTGLSMRQAHKGMH----LNTADFNALVEDLQKSMDSNHVPLGLQNQLLAILAPMQ--PDVVHQ 132
50 3.000e-35UniRef50_A0A1Y5DH94 Group 1 truncated hemoglobin n=1 Tax=Bermanella sp. 47_1433_sub80_T6 TaxID=1856278 RepID=A0A1Y5DH94_9GAMM  ali  46  2GSLFENIGGENAVTAAVDIFYSKIINDTALAPFFDGMDLDRQKRMQRSFLTVAFGGPNKYSGRGMRAAH-SRPVAIGLEERHFNKVAEHLQKTLIELSVPHNLIQEVMAIAGST--KGDVLN. 120
51 4.000e-35UniRef50_P0A593 Group 1 truncated hemoglobin GlbN n=388 Tax=Terrabacteria group TaxID=1783272 RepID=TRHBN_MYCBO  ali  34  14.SIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGR----GITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLA........ 123
52 4.000e-35UniRef50_A0A1X9M6D6 Group 1 truncated hemoglobin n=51 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1X9M6D6_9BACI  ali  43  4.TLYEKVGGEDAIAKVVDYFYELVLKDETVNQFFKETDMEKQRRHQTKFISFALGGPNQYSGKSMAKAHSGMN----LQPAHFDAIAKHLHTALAHFGINEPDIDKAITKVASL--REDILYK 120
53 4.000e-35UniRef50_A0A2V0P9W4 Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0P9W4_9CHLO  ali  46  5.TIFDKLGGAGNVRAAVDKFYEKILADPSISHFFSSIDMKKQKAKQFQMMSLVFGGPNEYKGRDMYTAHKHL----PLTDAHFDAVAGHFVSTLNELGVEKAVVEEATAVVAST--RGQVLGR 120
54 5.000e-35UniRef50_A0A2A5HLL9 Uncharacterized protein (Fragment) n=1 Tax=Alteromonadaceae bacterium TaxID=1916082 RepID=A0A2A5HLL9_9ALTE  ali  48  8.SLFIRIGGDAAVTAAVTLFYEKVGADDRIKHFFVDVDIKRQEKKLRSFLKFAFGGQKTYSGKAMTAAHKNLVENKGLNDSHFDAVMDCFGQTLTELGVDADLIEEAAGIAQSV--RGDVLG. 126
55 7.000e-35UniRef50_A0A2R6Y5G6 Hemoglobin-like protein HbO n=4 Tax=Bacillales TaxID=1385 RepID=A0A2R6Y5G6_9BACL  ali  19  3.TLFDALGGSEGIGRIVNTFYGKVKNDPLLSPIFPE-DLTETARKQYMFLCQFFGGPPLYSEEFGSPMLRARHIHFPITPSRAERWLKLMSEAFDEEGVDPLTKELAFLRLTKTAH....... 116
56 8.000e-35UniRef50_Q0F0A3 Group 1 truncated hemoglobin n=15 Tax=root TaxID=1 RepID=Q0F0A3_9PROT  ali  49  46.SLFDQLGGDAAVNAAVDIFYRRVLADAYVVRFFEGVDMDKQAAKQKAFLTMAFGGPHNYTGKDMREGHRHLV-KMGLNDSHFDHILMHLRATLAELGVANNLIQQVIATAETT--RDDVLDR 164
57 8.000e-35UniRef50_K0HW79 Group 1 truncated hemoglobin n=49 Tax=Betaproteobacteria TaxID=28216 RepID=K0HW79_9BURK  ali  24  43..LYQALGEKPGITRLVDDFVNRVVKDPRIGGHFKDTKPAALKESLTDQFCQLSGGPCKYEGADMKSAHADM----DINKGHFNALVEVLQSAMDAQGIPFAQQNRLLALLAPMHR--DVITK 157
58 1.000e-34UniRef50_A0A1H8KJJ9 Hemoglobin n=1 Tax=Halorientalis persicus TaxID=1367881 RepID=A0A1H8KJJ9_9EURY  ali  36  4TTLYDRLGGADGIETVVDEFYDRMLDDEQMQPFFEDVDMERQRQHQALFISQVAGGPAEYSGENMRAAHREL----DLTQDDFETVVSHLRAALAACGADEADADEVIAAVRGLE--DDVLCR 120
59 1.000e-34UniRef50_A0A1Y5FNV2 Group 1 truncated hemoglobin n=1 Tax=Gammaproteobacteria bacterium 53_120_T64 TaxID=1856295 RepID=A0A1Y5FNV2_9GAMM  ali  51  12...YDDIGGEAAVDAAVDIFYRKVLADKRVNKFFTTVDMEAQREKQKAFLTTAFGGPNNYTGKDLRQGHKAMN----LNEGHFNAIAESLVATLEELTVPQGSIDQIMAIVATT--KDDVLNR 125
60 2.000e-34UniRef50_A0A2V8RES6 Group 1 truncated hemoglobin n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8RES6_9BACT  ali  33  44.SLYERLGGEAAISAVIDDFAARVLADARINQKFAKSNPERLVFHLKEQVCAVTGGPCKYTGNSMTKTHHNM----KVTEGEFNALVEDLVATLDKFNVPAKEKGEVLAALGPL--KSQIV.. 157
61 2.000e-34UniRef50_A0A0F0LPX2 Group 2 truncated hemoglobin GlbO n=236 Tax=Bacteria TaxID=2 RepID=A0A0F0LPX2_9MICO  ali  17  9PSLYEQMGGRPAFARLVDTFYRGVAEDDVLRPMYPEEDLEPAKERLLLFLEQYWGGPSTYSEQRGHPRLRMRHMPFHVNADARDRWLAHMRDGVDDLDLPPLLEATLWDYLQRAAF--AMVN. 128
62 2.000e-34UniRef50_W9AXG7 Group 1 truncated hemoglobin n=3 Tax=Mycobacteriaceae TaxID=1762 RepID=W9AXG7_9MYCO  ali  36  2.SIYEQIGGAPAIEAVVADFYVRVLADDELAGFFTGTNMARLKGKQAEFFAAALGGPEPYTGAPMRQVHQGR----GITLHHFNLVAGHLSDSLSAAGVPDELVAQIIAAVAPLA........ 111
63 3.000e-34UniRef50_J9HMW8 Globin n=4 Tax=Alicyclobacillus TaxID=29330 RepID=J9HMW8_9BACL  ali  22  5.TVYEAIGGEATMRKLVESFYDKVAADTLLRPLFPPT-FDDVKERQFWFLTQLFGGPRLYTERRGQPMLRARHLPFPITTRHAQAWLRCMASAMADADIPTPAREAMLQRLTATAY--HMVN. 122
64 3.000e-34UniRef50_E3EA79 Globin n=169 Tax=Bacillales TaxID=1385 RepID=E3EA79_PAEPS  ali  22  6.SIYDNLGGAEGIRAIIEAFYPRVYKDPLLSPLFP-KDMEPVKEKQFMFLSQFFGGPSLFSDAYGHPMLRARHMKFPVTEERAEAWLSCMADALTDTGIEEPLRSIILSRLSGPAH....... 119
65 3.000e-34UniRef50_G8RKF8 Group 1 truncated hemoglobin n=11 Tax=Actinobacteria TaxID=201174 RepID=G8RKF8_MYCRN  ali  39  2ASIYERIGGAEALEGVVEDFYGRVLADQELAPFFSGTRMERLKGKQFEFFAAALGGPEPYIGPSMRQVHQGR----GITRHHFDLVGGHLRKSLSAAEVPEHTAEQIMTAVESLA--DDVVS. 117
66 5.000e-34UniRef50_UPI0004E102E8 group 1 truncated hemoglobin n=1 Tax=Bryobacter aggregatus TaxID=360054 RepID=UPI0004E102E8  ali  40  7.TLYDRIGGKPAIDAAVELFYQRVIADPELNPFFAPMSVERIKTHQKAFFAMALGGAAHYQGRGMKEAHAQL----GIRAVHFDRVAEHLGITLEDLGVEPGVRNETLTLVALL--KSQIVS. 121
67 5.000e-34UniRef50_A0A2J8AJW7 Group 1 truncated hemoglobin glbN n=1 Tax=Tetrabaena socialis TaxID=47790 RepID=A0A2J8AJW7_9CHLO  ali  50  35.SLYDKLGGPAAVEAAVDIFYKKIMADAELEPFFEGIDMNKQMRKQVAFMTFAFGGAPHYGGRGLYAVHKRLITEKGLREEHFDMVAGHLVATLQELGVAQNLVDEVVGVVGPTK........ 148
68 6.000e-34UniRef50_A0A165RYQ4 Group 2 truncated hemoglobin GlbO n=50 Tax=Bacteria TaxID=2 RepID=A0A165RYQ4_9MICO  ali  14  6PSFYEQVGGRPTFERLVHEFYRGVADDPVLKPMYPEEDLGPAEERLLMFLEQYWGGPTTYSEQRGHPRLRMRHLPFKVNPDARDRWLAHMRAAVDTLDLPPVAEATLWDYLQRAAF--AMVN. 125
69 6.000e-34UniRef50_Q08753 Group 1 truncated hemoglobin LI637 n=3 Tax=Chlamydomonas moewusii TaxID=3054 RepID=TRHN1_CHLMO  ali  48  43SSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLVPH--LSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVAST--RTEVLN. 160
70 7.000e-34UniRef50_A0A2P6TJJ4 Globin n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TJJ4_CHLSO  ali  48  82..LFDDLGGAEGLKLAVDIFYEKVLADAELQPFFQAVDMQKQKAKQVKFMTFVFGGPDQYQGRSMYESHSALVKYQGLDHRHFDLIKQYLGETLQEMGVSQEVIQHAAGIVESTR........ 194
71 7.000e-34UniRef50_A0A1I3MQR6 Hemoglobin n=2 Tax=Paenibacillus sp. UNC496MF TaxID=1502753 RepID=A0A1I3MQR6_9BACL  ali  20  7STIFEAVGGVAGIRRIVEAFYPKVQRNPLIGPLFP-ADIDPVMDRQTLFLSQFFGGPPLYSDEYGHPMMRARHLPFPITPERAEAWLGCMREALAGTDLPQELQAIIVDRLSGPAH....... 121
72 7.000e-34UniRef50_A0A258BSW4 Group 1 truncated hemoglobin n=37 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A258BSW4_9RHOB  ali  27  51..LYEVFGGQAGIGRIVDDLVDRSIADSRIAEIFAASDLVRLRRTLKEQFCYLLAGPCDYTGKDMQSSHKD----HGITNREFNALVENLQLAMDAEGVPFRAQNKLLAKLAPMQR--DVVTR 165
73 8.000e-34UniRef50_C6CW20 Globin n=162 Tax=Bacillales TaxID=1385 RepID=C6CW20_PAESJ  ali  26  38.SLYEAIGGAETLRRIVESFYPKVQAHELLGPLFPE-NIIPVMEKQIMFLTQFFGGPTLFSDEYGHPMMRARHMPFPITPKHAEAWLDCMKRALQEAGLDEELQAYIIERLSGPAN....... 152
74 9.000e-34UniRef50_A0A2I8VHT4 Group 1 truncated hemoglobin n=1 Tax=Salinigranum rubrum TaxID=755307 RepID=A0A2I8VHT4_9EURY  ali  40  15..LYDRLGGRDGIAAVVETFYDRVLADERLHDYFEGMEMDDLRAHQTAFLSAVAGGPEDYSGREMRAAHATLN----LDESDFDAVAGHLDEALAAHGVSDADRAAVLREVTSL--KPAVLNR 129
75 9.000e-34UniRef50_UPI000DBF5808 group 1 truncated hemoglobin n=1 Tax=Thermoflavimicrobium sp. FBKL4.011 TaxID=2137476 RepID=UPI000DBF5808  ali  43  3ATIYEQLGGEVGIAQAVDIFYELVLEDERINYLFEKTDMAKLKRHQAAFLTFATGGPNKYTGQSMQAAHKGLH----ITQEQFQVVASHLASTLKVLHVQDHLIEQVIQTVAQLE--KDIVSR 119
76 9.000e-34UniRef50_A0A1E4JWB2 Group 1 truncated hemoglobin n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E4JWB2_9GAMM  ali  36  29.TLYQRLGGAAGVEAVVDASLRQIHGDLRINLFFENTDLPDLRRLLIEQICAATGGPCTYTGRSMEEAHSGMN----LTDRDFDIFVEDLVAAMTEVKVSPALQQEVLALFAPM--RPQVVGQ 144
77 1.000e-33UniRef50_A0A0P7XZ87 Group 1 truncated hemoglobin n=47 Tax=Proteobacteria TaxID=1224 RepID=A0A0P7XZ87_9RHOB  ali  25  45PAVFEAFGGIEGIDRIVDDMVERITVDPRLADIFRASDFVRLRRTLKEQFCYLLGGPCDYTGMPMRSSHAD----HGITTAEFNALVENLQLAMDAEGVPFRMQNRLLALLAPMQR--DIVTR 161
78 1.000e-33UniRef50_A0A2R7T4H2 Group 1 truncated hemoglobin (Fragment) n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2R7T4H2_9BURK  ali  27  2..LYQALGGREAIQRFTDDFYDRMLKDVRIARFFDGINANYLKRVLADYFCVVAGGPCSYDGVSMADAHAGL----GIRKAHFNALVENLQRAMDAAGLPFSTQNQLLARLAHFHR--DIVTQ 116
79 1.000e-33UniRef50_UPI000B850C5B group 1 truncated hemoglobin n=1 Tax=Blastococcus endophyticus TaxID=673521 RepID=UPI000B850C5B  ali  35  59.SLYERLGETAGIRTAVDDFYRRVLGDPELAGYFEGVDLAGLHSHQTDLLVQVTGGPAGYTGRDLAAAHQGR----DISPEAFDRVVAHLVATLTALGVGEADIGAVGAAL--TAHRDEVV.. 172
80 1.000e-33UniRef50_A0A2G2A1S9 Group 1 truncated hemoglobin n=1 Tax=Coxiella sp. (in: Bacteria) TaxID=59288 RepID=A0A2G2A1S9_9COXI  ali  42  4.TLYDRLGGAPIIDATVDRFYEKILADDLVSGFFTNINIDRQRQMLKAFLSMSFGGPDAYKGRDMRSVHRRAVEA-GIGDKHFDRVLSLLATSLKEQGVTDEMIDEAAIITEKLRH--DILGR 122
81 1.000e-33UniRef50_A0A2T4UW78 Mechanosensitive ion channel protein n=1 Tax=Rathayibacter caricis DSM 15933 TaxID=1328867 RepID=A0A2T4UW78_9MICO  ali  16  371.SFWEHIGGRPTFERLVRRFYEGVREDEVLWPMYPEDDLEGAIQRLTGFLEQYWGGPGTYSQERGHPRLRMRHQPFRVNPAARDHWLQHMRVAVDELELAPADDALLWDYLERAAH--AMVN. 489
82 1.000e-33UniRef50_A0A2E5QR74 Uncharacterized protein n=1 Tax=Roseibacillus sp. TaxID=2024856 RepID=A0A2E5QR74_9BACT  ali  48  72.SIYHKIGGAAAVNATIDLFYTKVLADKTVNHYFDGVDMKKQHKRQKAFVSAALGGPKAWTGKDMRKAHLSL----ELKESDFNAIAGHLQKTLQELKVKEELIKQVMAVAAST--KDDVLNR 187
83 1.000e-33UniRef50_UPI000DCC56C6 PAS domain S-box protein n=1 Tax=Chryseolinea sp. SDU1-6 TaxID=2059302 RepID=UPI000DCC56C6  ali  40  7TSLFERIGGKEALNAAVDIFYKKVLEDPRINSFFQATDMKRQRTKLKSFLAMALGAPVKYTGKDLESAHAPLVAK-GLNEDHFIIVAQHLEATLNELNVPLPLSAEVMAIAAGTKN....... 121
84 1.000e-33UniRef50_A0A0Q7D3W6 Group 1 truncated hemoglobin n=12 Tax=Proteobacteria TaxID=1224 RepID=A0A0Q7D3W6_9BURK  ali  21  28..LYQALGGTPGLTKLMDDFVPRLTADPRIAEFFKETKLSELKKQLVDQFCVVSGGSCIYEGETMKNSHAEM----KIRKSDFNALVEVLQQSMDQQGIPFTVQNRLLARLAPMHR--DIVN. 141
85 2.000e-33UniRef50_A0A1Q7L6N3 Cyanoglobin n=9 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7L6N3_9BACT  ali  31  19.SLYKRLGGYDALAAVTDDFIGRLVTDPKLGRFFIGDSKARIRQHIVDFLCVATGGPCKYTGRDMETAHTGL----GITEEDWTITVKALGDTLNKFKVPAREQQEVVTAIAPLKSK--IVGK 137
86 2.000e-33UniRef50_A0A1H7WI86 Hemoglobin n=20 Tax=Bacillaceae TaxID=186817 RepID=A0A1H7WI86_9BACI  ali  22  7.SLYSEIGGQETIDQLVNAFYPRVYADDDLKPLFQG-DMEEIKRKQRMFLSQFLGGPALYSEEFGPPAMRQRHLPFEITPTRAKSWLRCMREALDEHPAGEAFYERLTQVAKIMVNRPD.... 128
87 3.000e-33UniRef50_A0A0K1K6J9 Group 1 truncated hemoglobin n=23 Tax=cellular organisms TaxID=131567 RepID=A0A0K1K6J9_9BURK  ali  23  28.STYRGLGGQEGIRKIVDTFIPLILADERIKASFEDTDMKQLAERLAEQFCEFSGGPCKYTGKYKGKDMASVHIDLKISNAQFNALAEDLQIAMERNNVPNSVANKLIAKLAPMQR--DIVTK 147
88 3.000e-33UniRef50_A0A095SQ96 Putative methyl-accepting chemotaxis protein n=8 Tax=Alcanivorax TaxID=59753 RepID=A0A095SQ96_9GAMM  ali  32  12.SLYSQVGGEPAIKAVVTEFYNRVLGDPSLAPFFRHKQRKGLEKSQVRFFSQALGGPRNYSGRTMAEAHKNMN----ITVKTFDKVAEYLNDTLLAVGVAEDLAEQIMQAVAPL--KGEIVN. 126
89 3.000e-33UniRef50_A0A1H8SEM6 Group 1 truncated hemoglobin n=3 Tax=Geodermatophilaceae TaxID=85030 RepID=A0A1H8SEM6_9ACTN  ali  35  2.SLYERLGETAGIRTAVDDFYRRVLGDPELAGYFEGVDLAGLHSHQTDLLVQVTGGPAGYTGRDLAAAHQGR----DISPEAFDRVVAHLVATLTALGVGEADIGAVGAAL--TAHRDEVV.. 115
90 3.000e-33UniRef50_A0A0U3PHZ2 Group 1 truncated hemoglobin n=20 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0U3PHZ2_9ACTN  ali  34  15PTLFERLGGEDAVGAVVDLFYARVLGDPDLLPYFTGVDLDRLKQHQRRFIGQALGATRPYSGRSMRKAHEHL----AVTDDAFGKVVGHLAGALTEAGVNEATIGTIAEALLPL--KADIVT. 130
91 3.000e-33UniRef50_A0A1H1PMG4 Group 1 truncated hemoglobin n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1H1PMG4_9ACTN  ali  36  13...YDRIGGGPAVRAVVERFYELVLADADLAPFFVGVDMSGLKRHQALLISQVLGGPAEFTGRELRTAHAGL----AITAEHFGAVVAHLVTALTEAGAPPEVIARVGAALG--ATEKDIVTQ 126
92 3.000e-33UniRef50_A0A2G4YVC7 Group 1 truncated hemoglobin n=1 Tax=Emcibacter sp. ZYL TaxID=2043170 RepID=A0A2G4YVC7_9PROT  ali  29  24.TLYDKIGGQAAITQVVTRTLDLSLQDPRIKHTFARSKMDRLAKHISDQVCQLTGGPCIYTGVTMKKAHVGL----ELTTLHFNALVENLQQAMREANIPTATQNKLLALLAPMHR--DVVEK 139
93 4.000e-33UniRef50_L0JT35 Globin n=111 Tax=Halobacteria TaxID=183963 RepID=L0JT35_NATP1  ali  37  4.SLYERLGGEDAITAVVDEFYDRIMADEQVAGYFDDVDMQKQRAHQAQFISSVTGGPVEYAGGEMEAVHADM----GITPSDFGAIATHLDDALAEFDVAEDDREAVLDEIAS--YQDAIVT. 118
94 4.000e-33UniRef50_A0A1I4KWX3 Mechanosensitive ion channel n=7 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1I4KWX3_9MICO  ali  14  355PAFYDVVGGHPTFVRLVDTFYRGVADDPVLRPMYPEEDLGPAKERLTLFLEQYWGGPGTYSEQRGHPRLRMRHNPFRVNPEARDRWLAHMRTAVDELGLPPLQEETLWSYLERAAF--AMVN. 474
95 4.000e-33UniRef50_A0A162K9J8 Globin n=16 Tax=Bacillales TaxID=1385 RepID=A0A162K9J8_9BACL  ali  25  5..LFDELGGQQGVRKLVESFYPKVLKDPLLAPLFP-KDISTTMDKQEMFLSQFFGGPDLYTSEFGHPRMRARHMPFKITPIHADAWLSCMSQALEETVDSELIREAVIERLRVSAY....... 117
96 4.000e-33UniRef50_W5W254 Oxygen-binding heme protein n=9 Tax=Actinobacteria TaxID=201174 RepID=W5W254_9PSEU  ali  15  6.SFYEAVGGEQTFRRIVARFYEEVAKDEILRPMYPEEDLGPAEERLLLFLMQYWGGPHTYSEQRGHPRLRMRHSPFQIGPLARDAWLRCMRVAVDEAGLAEPARQQLWEYLEMAANS--MVN. 124
97 5.000e-33UniRef50_A0A0Q9TX83 Globin n=9 Tax=Paenibacillaceae TaxID=186822 RepID=A0A0Q9TX83_9BACL  ali  23  3..LYDYIGGETTIRNIVDAFYPKVLAHPLLAPIFPE-DLEPLIEKQFQFLTQFFGGPSLYTDEHGNPMMRARHAPFPITRDRADAWLACMQRTLEEVVPSNEVRSIILDRLKGPAY....... 115
98 6.000e-33UniRef50_A0A1F2VQG4 Uncharacterized protein n=1 Tax=Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b TaxID=1797193 RepID=A0A1F2VQG4_9BACT  ali  35  2..........PAIKAAVDAFYERVLTDPQLKPFFAGVNMRWLKGRQNAFFIQALGGPQVYKGQDMATAHAHL----PITQEHFGQVAGHLVAALAAVGVPKALIDEVVAAVAPLA--PQIVN. 107
99 7.000e-33UniRef50_A0A2V9LYW3 Group 1 truncated hemoglobin n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9LYW3_9BACT  ali  36  22.SLYERIGGKSKIIPAVDIFYRKVLADESLKQFFEPVDMDQLRSLQAMFLTMLVGAKMKYTGKDIRTAHAGL-KGKGLNDEHFDAFLKHFKNALQEVGIEHEAVAEIIGRLEGT--RAEVLGR 140
100 8.000e-33UniRef50_A0A1H2FYQ8 Group 1 truncated hemoglobin n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1H2FYQ8_9PSED  ali  26  28..LYQALGGQAGIARIVEGLLINISENPRIVHHFQDTDIDRLHDMLIEQFCFEAGGPCEYTGDSMAESHTGM----DLTESDFNALVEDLIAAMQEQGVPVAAQNRLLARLAPM--RSDIIYR 142
101 9.000e-33UniRef50_A0A2V9K244 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9K244_9BACT  ali  27  174.SLYKRLGGYDSIAAVVDDFIGRLAKDPTLGKFFAGHSLKRIRQLVVDQLCEATGGPCVYIGRTMKESHAGM----GITENDWKIAVDHLVATLDKFNVPAREKDEVLSALTAL--KKDIVS. 291
102 1.000e-32UniRef50_A0A168F0B4 Group 2 truncated hemoglobin GlbO n=115 Tax=root TaxID=1 RepID=A0A168F0B4_9MICO  ali  14  4PSFFEEIGGHEVFVRLVDVFYEGVATDEVLRPMYPEEDLGPAKVRLTMFLEQYWGGPTTYSEQRGHPRLRMRHAPFTVNPDARDRWLKHMRVAVDSLDLAPAHESQLWDYLERAA........ 118
103 1.000e-32UniRef50_A0A258AM35 Group 1 truncated hemoglobin n=1 Tax=Verrucomicrobia bacterium 12-59-8 TaxID=1970608 RepID=A0A258AM35_9BACT  ali  32  43PSLYERLGGENMITALIPAFYVRVLADPELGPFFKHTELEKLHAMQREFFVMATGGPIEYSGRPLAHTHHGR----GITKQHFARFTGHLVETLLDMGVTQGEADEVIDRINAMTN--EIVG. 158
104 1.000e-32UniRef50_G0QQ62 Protozoan cyanobacterial globin family protein, putative (Fragment) n=1 Tax=Ichthyophthirius multifiliis (strain G5) TaxID=857967 Rep  ali  35  25.SIYEQLGGQKSLEALSKQLYDKILADNKIKHFFVNTDINHQIKQQCDFLTMCFGGPNNYKGKTMRDTHRGM----GITDEEFNIVIQHIGQIMCEMGIQQDLIKKCADIAETT--RCDIVGQ 140
105 1.000e-32UniRef50_A0A163RS56 Group 2 truncated hemoglobin GlbO n=397 Tax=Terrabacteria group TaxID=1783272 RepID=A0A163RS56_9CELL  ali  15  33GSFYDEIGGHETFVKLVDVFYAGVAADPVLKPMYPEEDLGPAKVRLTTFLEQYWGGPTTYSEQRGHPRLRMRHAPYKVNPDARDRWLAHMRAGVDSLDLAPLHEATLWDYLERAAH....... 148
106 1.000e-32UniRef50_A0A0J5VCJ1 Globin n=4 Tax=Bacillus TaxID=55087 RepID=A0A0J5VCJ1_BACFI  ali  21  6.TLFEEIGGTEPIEKLVEAFYPRVYADPVLSPLFEG-DIEDIKRKQRMFLTQFLGGPPLYSQEFGPPAMKQRHLPFEITPLRAQRWLACMKEAFQETGLEQNFYDRLMQVAAIMVNSPE.... 127
107 1.000e-32UniRef50_A0A0G8DI99 Globin n=436 Tax=Bacilli TaxID=91061 RepID=A0A0G8DI99_BACCE  ali  16  7.TPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQ--HMVN. 124
108 1.000e-32UniRef50_A0A149VX14 Group 2 truncated hemoglobin YjbI n=85 Tax=root TaxID=1 RepID=A0A149VX14_9PROT  ali  17  8...YENLGGEPGIRKLVEAFYHIMDTDPMATRILHPEDLSSSKEKLFMFLSGWLGGPPLYIEAYGHPRLRQRHLPFPIGDEERDQWMGCMHQALEQCGLDEELKQQLIGSFSKTA........ 121
109 2.000e-32UniRef50_A0A0U5BB26 Globin-like protein n=62 Tax=Bacteria TaxID=2 RepID=A0A0U5BB26_9MICO  ali  15  15.SFFTQIGGHATFERLVRRFYEGIEHDEVLRPMYPDNDMDGAVWRLTAFLEQYWGGPSTYSEQRGHPRLRMRHMPFKVNPDARDRWLTHMRAALDELALPPMHEEALWDYLQRAAY--AMVN. 133
110 2.000e-32UniRef50_A0A2A2FAS2 Group 1 truncated hemoglobin n=37 Tax=Halobacteria TaxID=183963 RepID=A0A2A2FAS2_9EURY  ali  30  6.SIYADIGGREAVEAVVSDFYDRVFDDPVLEPYFEGVDREALYAHQVQFISAVAGGPVSYEGADMRAAHEGM----GITEEGFGRVATYLAEALRENGVAEENVETILDEVGALE--PDMVGQ 121
111 2.000e-32UniRef50_A0A1Q6VD07 Uncharacterized protein (Fragment) n=7 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1Q6VD07_9BACT  ali  28  32PSLYKRLGGRDGIALVVDDFVANMVADPRVNARFQGMQPPRLKSNLSDQICDAAGGPCSYLGRDMKTTHQGMN----VSEVEWNATVENLTKALDKHGVGAREKSELLGLLGPM--KGEIVG. 150
112 2.000e-32UniRef50_A0A2D6JFU4 Group 1 truncated hemoglobin n=1 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2D6JFU4_9PROT  ali  30  10TNLFDKYGGFETLAKLVHEFYSKLLEDSEIKPYFQAVDLEKLMQHQVNFLGLALGGPNKYEGKDLGVAHKHLN----ISEEHFLIVAGYLEEVLDEAGVDESDIAAIMAVVGST--KEQIV.. 124
113 2.000e-32UniRef50_A0A1F1UUZ3 Uncharacterized protein n=8 Tax=Corynebacterium TaxID=1716 RepID=A0A1F1UUZ3_9CORY  ali  18  12.TLYEAVGGEEFFHTLVHRFYAQVKEDDLIGPMYPDEDWEGAESRLRWFLTQYWGGPRTYQERRGNPMLRRRHFPFAIGEAEADRWLELMGKAMAEFDLPQPYRAAMWNHMQRVAY--MMINQ 134
114 2.000e-32UniRef50_O31607 Group 2 truncated hemoglobin YjbI n=614 Tax=Bacteria TaxID=2 RepID=TRHBO_BACSU  ali  16  8..PYEAIG-EELLSQLVDTFYERVASHPLLKPIFP-SDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTAR--HMVNQ 124
115 2.000e-32UniRef50_UPI000B84FF2C group 1 truncated hemoglobin n=1 Tax=Planifilum fulgidum TaxID=201973 RepID=UPI000B84FF2C  ali  33  77TNLYYKLGGQKAIRAVVEEFYRRMLEDELVNEAFRGIDMDRLRNHQTAFLSYALGGPVEYDGRTLREGHKGLN----ITSEQYERMIRIMNDTLRTFNVADEDRVKIEAFLRSV--KPFVVGQ 193
116 2.000e-32UniRef50_A0A256HN62 Group 1 truncated hemoglobin n=4 Tax=Halobacteria TaxID=183963 RepID=A0A256HN62_9EURY  ali  40  4ATLYDRLGGGPAIGAVVNEFYDRVLADERVAHHFDDVEMADQRSHQTKFLSAVTGGPIEYGGDDMETAHGGL----GVTDAEFDAIAAHLDAALREFDVDDADREAVLEAVEAF--REDIV.. 118
117 2.000e-32UniRef50_A0A246IZZ3 Uncharacterized protein n=1 Tax=Roseateles terrae TaxID=431060 RepID=A0A246IZZ3_9BURK  ali  25  87.SLYQALGGDEGVARISAGLVDRVYADERIKHLFQQTNPRFLSEQLRKQFCELAGGPCKYDGETMKKSHAGL----AINKAHFNALVEDLQLAMDAQGVPFATQNRLLALLAPMHR--DVITR 202
118 2.000e-32UniRef50_A0A259FIW0 Uncharacterized protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A259FIW0_9PROT  ali  28  22GTLYERLGGEAGVAQITSEYIDAVANDPAVNQSFEKVNLKRLKKMLAEFTCSLTGGGCVYSGDDMKIVHKNL----KITEREFNALVEALRVSLDRHGVSQRDKNALLAIFAPMQR--DIVEK 138
119 2.000e-32UniRef50_A0A0C1KZH4 Group 1 truncated hemoglobin n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A0C1KZH4_9BACT  ali  29  12.SLYDKLGGEVGLRKIVTDILDRNSNNPQISHYFRNVDMNILNQHVFEFFSMGIGGPHQYTGKDMLTAHTGLH----INEKDFDIANDDVVKALNDNKVPEAEQKEIIGILESL--REQVVNR 127
120 2.000e-32UniRef50_A0A1H7DV10 Hemoglobin n=2 Tax=Paraburkholderia diazotrophica TaxID=667676 RepID=A0A1H7DV10_9BURK  ali  23  18.SLYRTFGGQAGLAKIIDDFYDLVLKDPRTAPYFDGAPIRRIKQKLGEQLCVLLGGPCTYTGRTMKRTHEGQN----IDRAAFNAAVEDLQTAMDKNGVPFHAQNKLLAKLAPMYR....... 128
121 3.000e-32UniRef50_A0A1P8FJX4 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium GR16-43 TaxID=1904640 RepID=A0A1P8FJX4_9PROT  ali  21  27PTLWKRLGGTPVVTAIVDELIDRSIADARTKRSFDGVKIPRVKEKVVEQICFLSGGPCQYTGDPMTEVHKGL----KINNAEFDLFVQFLRDALDHAKVGIAEKNELLRLLAPMKR--DIVT. 142
122 3.000e-32UniRef50_A0A1Q7IXE5 Group 1 truncated hemoglobin n=4 Tax=Bacteria TaxID=2 RepID=A0A1Q7IXE5_9ACTN  ali  35  4.TLFERLGGIGAITAVVEDFRDRVAGDDRINLKFARTDLARLTKMLIDQVCEATGGPCRYNGRSMKAAHGGM----KVTKGEFNALVDDLVATLNQFKVPSSEQEELLGILGPL--KSDIV.. 117
123 3.000e-32UniRef50_Q4FLB5 Group 1 truncated hemoglobin n=5 Tax=Pelagibacteraceae TaxID=1655514 RepID=Q4FLB5_PELUB  ali  34  18.TLFEKYGGKKTVGQIVINFYQKLMADENLKKFFTNSDMKVLISHQTNFISQALGGPKEYTGLDMKTAHQGM----KISQEDFNGVAGHLKQTLEELNVESQDVDTIIGVVAPLS--EHIVSK 133
124 3.000e-32UniRef50_A0A2H5Z9Y2 Group 2 truncated hemoglobin YjbI n=3 Tax=Bacteria TaxID=2 RepID=A0A2H5Z9Y2_9BACT  ali  16  7SSLIERAGGRETIEWAVDHFYDRVERDPILRPIYP-QDLRPGREKLKLFFVQWLGGPPLYSERYGHPRLRRRHFPFVIDEQAAERWLALMSEALAAAGIPQAVRSAIEQRLRPLAF--HMVN. 125
125 3.000e-32UniRef50_UPI00035F92D1 group 1 truncated hemoglobin n=1 Tax=Robiginitomaculum antarcticum TaxID=437507 RepID=UPI00035F92D1  ali  26  29TTLYDRLGGEAGVSQIVKGTLVYTLADPRIAQTFENSNVDRVERLLIQQICELTGGPCTYSGQTMVNTHRGL----DLNSMHFNALVENMQLAMDDSGVPYRAQNQLLAILAPMHR--DIV.. 143
126 3.000e-32UniRef50_A0A075LHG2 Globin n=74 Tax=Terrabacteria group TaxID=1783272 RepID=A0A075LHG2_9BACI  ali  19  6.TLYDGIGGQAILKQLVDAFYRRVAENPDLKPIFPD-DLTETRRKQQQFLTQFLGGPPLYTEEHGHPKLRYRHLPFEITPTRKDAWLSCMAAALTETDIEEPYKSIIYERLALTAH--HMMN. 123
127 3.000e-32UniRef50_A0A1T5L9F0 Hemoglobin n=12 Tax=Bacteria TaxID=2 RepID=A0A1T5L9F0_9BACT  ali  20  30PTLYDQIG-EENLRTLVDRFYDLVFENEQISHLFKN-DKNEIKEKQRLFLIQFLGGPDLYSEKYGHPRLRARHMPHVITQDDAVAWLSCMSAAITSLTIEESIKDEIFKRLVPTA--MFMVNR 148
128 4.000e-32UniRef50_A0A2E0QQP7 Group 1 truncated hemoglobin n=1 Tax=Verrucomicrobiales bacterium TaxID=2026801 RepID=A0A2E0QQP7_9BACT  ali  32  5.SIYERIGGQPTIDSLVDSFYEKVLADPELSSYFKHAPMDKLRTMQREFFSSATGGPIIYSGRPLGQVHANM----AISKREFQRFTEHLLQTLKEVGVEEKDAYEIISHV............ 110
129 4.000e-32UniRef50_A0A2T0LAY0 Group 1 truncated hemoglobin n=2 Tax=Planifilum fimeticola TaxID=201975 RepID=A0A2T0LAY0_9BACL  ali  37  4TSLYYKLGGQKAIKAVVEEFYRRMLEDELVNELFKGIDMNRLKAHQTAFLSYALGGPVEYDGRTLREGHKGLN----ITSEQYERMIRIMNDTLKTFNVSTDDRIKIESFLRSV--KPFVVG. 119
130 4.000e-32UniRef50_D6CQ02 Group 1 truncated hemoglobin n=13 Tax=root TaxID=1 RepID=D6CQ02_THIA3  ali  27  36.TLYEQLGGKPAITKVVHDMIVNVAADNRINHFFAKTNIPHLQMELVNQVCEGTGGPCKYTGLNMRQAHKGMN----LSTADFNALVEDLQKSMDSNHVPLGLQNQLLAILAPME--PHVVHQ 151
131 4.000e-32UniRef50_D8IXU2 Group 1 truncated hemoglobin n=15 Tax=Proteobacteria TaxID=1224 RepID=D8IXU2_HERSS  ali  23  29.TLFADLGGLPVIRQTVHDFMANMLADARIRHTFDHSNLKRVEDMLVEQFCMLSGGPCTYTGDPMKEVHQGL----KLTNADFNALVEDLQQAMDKNGIPFRTQNRLLALLAPMQR--DTVTR 144
132 4.000e-32UniRef50_A0A1Y3AGM6 Group 1 truncated hemoglobin n=4 Tax=Halobacteria TaxID=183963 RepID=A0A1Y3AGM6_9EURY  ali  36  5.TLYERLGGEPAIGAVVSDFYDGVLSDDRVSHHFDDVDMADQRSHQTKFLSAVTGGPLRYEGEEMAVAHDGL----AITAAEFEVVATHLDEALREFDVDDADREAVMAAVAGFE--DDVVG. 119
133 4.000e-32UniRef50_UPI0005CC863E hypothetical protein n=1 Tax=Risungbinella massiliensis TaxID=1329796 RepID=UPI0005CC863E  ali  23  5TSIYQEIGESATVRRLVETFYGKVLKHPKLGHFFT-KGIDEIIEKQFLFLTRYLGGPNLYPEDISPPALRTRHLEFEITKEVSDAWLECMGESVDEIGIDGETRAKMMEKFQAIAY--HMVNK 124
134 4.000e-32UniRef50_A0A258AJV4 Group 1 truncated hemoglobin n=1 Tax=Verrucomicrobia bacterium 12-59-8 TaxID=1970608 RepID=A0A258AJV4_9BACT  ali  33  6PSLYERLGGEAMITALIPAFYVRVLADPELAPFFKHTELEKLHAMQREFFMMATGGPLEYSGRPLAHSHHGR----GITRHHFALFTGHLVETLRDMNVTEEETDEVIQRINAMTN--EIVG. 121
135 4.000e-32UniRef50_A0A1H8ARX5 Group 1 truncated hemoglobin n=4 Tax=Thermoactinomycetaceae TaxID=186824 RepID=A0A1H8ARX5_9BACL  ali  31  7STLYERIGGEQAIAAVINEFYNRMLQDDRVSHHFVGANMDRLRRHQTYFMSYALGGPKRYEGSTLRSAHAGLQ----ISSEEYEIAIKHLNSSLRKYNVPIEDIAKIEAFLRSV--KPHIINK 124
136 5.000e-32UniRef50_A0A1B1Z3R2 Globin n=45 Tax=Bacillales TaxID=1385 RepID=A0A1B1Z3R2_9BACI  ali  17  7.SPYYLLGEKQGIEKLVTTFYSLVSKDPLLSPLFPD-DLTETAYKQTRFLSQFFGGPPLYTEEFGHPMLRARHMPFPITNTHAKAWINCMERAMTIQKLEPELQEFLLSRLKMTAY--HMVN. 124
137 5.000e-32UniRef50_A0A1A0NUG1 Group 1 truncated hemoglobin n=4 Tax=Corynebacteriales TaxID=85007 RepID=A0A1A0NUG1_9MYCO  ali  32  2PCIYDQIGGHEALEVVVADFYKRVLADVDLAGFFTGTNMARLQGKQVEFFAAALGGPQPYTGASMRQVHQGR----GITMHHFDLVAGHLAASLGAAGVPEETTEQILAAIAPL......... 111
138 5.000e-32UniRef50_A0A2D2DEB0 Group 1 truncated hemoglobin n=3 Tax=Massilia TaxID=149698 RepID=A0A2D2DEB0_9BURK  ali  22  28.TTYQGLGGQSGIKKIVDTFVPMIMADARIKESFRDTDLKNLSMRLEEQFCELAGGPCKYKGKDMKEIHDGLN----ITNAQFNALAEDLQAAMDKNGIAPAVQNKLVARLAPMQ--KEIVTK 143
139 5.000e-32UniRef50_A0A2T5CKR2 Uncharacterized protein (Fragment) n=1 Tax=Alcaligenes xylosoxydans xylosoxydans TaxID=85698 RepID=A0A2T5CKR2_ALCXX  ali  14  16SSIFDLLGGEPGVRALVDRFYDLMDMEPDLKELRHGPSLDQARDKLFWFLCGYFGGPDHYIERFGHPRLRARHLPFSIGEVERDQWVTCIGRAMEDQGIEPALVERLLQSFYGVATGCAIV.. 138
140 5.000e-32UniRef50_I1YH18 Group 1 truncated hemoglobin n=9 Tax=Proteobacteria TaxID=1224 RepID=I1YH18_METFJ  ali  18  24.TLYDDLGGAEGIDQIVSHFINQIGHDPVILPYFADSHVSRFREKITEHFCHISDGPCAYTGDNMVDIHVGM----DINEHDFNRVVDLLYNALEQSGVPHPAQNRLIARLAPL--RSDIIYR 139
141 5.000e-32UniRef50_A0A2A8IJF6 Globin n=1 Tax=Bacillus sp. AFS006103 TaxID=2033483 RepID=A0A2A8IJF6_9BACI  ali  24  7.SLYEEIGGQETIDQLVNAFYPRVYADPELRPLFEG-DMEEIKRKQRMFLPQFLGGPALYSQEFGPPAMQHRHMPFEVTPRRAVCWLRCMKEAFEEIGLDQAFYDRLTQVAGIMVNSPD.... 128
142 5.000e-32UniRef50_A0A2V6NXD3 Hemin transporter n=2 Tax=Bacteria TaxID=2 RepID=A0A2V6NXD3_9BACT  ali  31  1......MGGKPAITAVVDDFVANVAADSRISFRFANANVPRLKMLLVDQVCEATGGPCKYTGKDMRAAHAGMQ----ISDAEFNALAEDLTRSLDKFKVPDREKTELLGAIGGL--RSQVVNQ 111
143 5.000e-32UniRef50_F4L646 Globin n=2 Tax=Bacteroidetes TaxID=976 RepID=F4L646_HALH1  ali  27  29PTLYDRLGGVAAISAVVDQFLTNVVGDNVINARFAATRTQLLRNNLIDQICAGAGGPCQYKGKTMLESHKGMN----ITQAEFNALVGDLVAALDKFKVPQKEKDDLLAILGPMQT--DIVGK 150
144 6.000e-32UniRef50_A0A248JTQ5 Uncharacterized protein n=1 Tax=Nitrospirillum amazonense CBAmc TaxID=1441467 RepID=A0A248JTQ5_9PROT  ali  26  36...FQAFGGKAGLQSLMEDFMANLLADPRTRPFFEKANQTRVKAQLVDQFCQALGGPCQYKGLDMKSAHQGL---PPITREHFNALVEDLQDAMDKHKVPFSAQNKLLAELAPLHR....... 145
145 6.000e-32UniRef50_G8RPN1 Group 1 truncated hemoglobin n=1 Tax=Mycobacterium rhodesiae (strain NBB3) TaxID=710685 RepID=G8RPN1_MYCRN  ali  30  2PTVFAQVGGYEGLEVVVADFYDRVLTDAELAHFFTGTNMARLKGKQVEFFAAALGGPEPYTGAPMRQVHQGR----GITMHHFTLVANHLAASLSAAGVPGATVDQILGAIAPL......... 111
146 6.000e-32UniRef50_A0A158A4Q4 Group 1 truncated hemoglobin n=4 Tax=Betaproteobacteria TaxID=28216 RepID=A0A158A4Q4_9BURK  ali  23  24..LYKQFGEKEGLTKIVDDMYDNVLADPRTAPYFDNAPVKRIKQKLVEQICVLLDGPCVYTGRPMRRAHEGQN----IDRAAFNALVEDLQAAMDKNGVPFHAQNKLLAKLAPMYR....... 133
147 7.000e-32UniRef50_D7B3R3 Globin n=21 Tax=Actinobacteria TaxID=201174 RepID=D7B3R3_NOCDD  ali  15  19.TFYEAVGGEETFTRLVRRFYEGVADDPVLRPMYPEEDLGPAEERLRLFLIQYWGGPRTYNEQRGHPRLRMRHVPFRIGVAERDLWLTHMRAAVDSLDLHEALERQLWEYMVMAAHS--MVN. 137
148 7.000e-32UniRef50_A0A2C0Z5K7 Group 1 truncated hemoglobin n=2 Tax=Bacillus TaxID=55087 RepID=A0A2C0Z5K7_9BACI  ali  35  7..IYDHIGGKEKIGQMVDDFYQNVMNDESLNHFFKNIDMEKQREHQTNFLSYAFGGPNQYNGRTIANAHQGINTEH----SHFDSIINHLQNAMQKHEIEEEHMERVIRKIS--EHRQDIVS. 120
149 7.000e-32UniRef50_R4L635 Bacterial-like globin n=69 Tax=root TaxID=1 RepID=R4L635_9ACTN  ali  15  5.SFFEAVGGEPTFRRLVDKFYEGVATDPLLRPMYPEEDLGPAAERLTLFLMQYWGGPNTYSAGRGHPRLRMRHAPFTVGPAERDAWLLHMRVAVDSLGLPEPQHTMLWDYLERAAY--FMVN. 123
150 7.000e-32UniRef50_A8L0I3 Group 1 truncated hemoglobin n=11 Tax=Actinobacteria TaxID=201174 RepID=A8L0I3_FRASN  ali  32  25.SIYDAIGGASAVQAAVDEFYVRVTADPELAPFFAGKDIPRLKAHQQAFISAAIGGPEVYQG----GAIASVHSGLRITDANFNAVVDHLVSALSGLGVPAETTGQIGAALAPL--RADIVT. 139
151 8.000e-32UniRef50_A0A0L6CKY2 Group 1 truncated hemoglobin n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0L6CKY2_9MICO  ali  36  9...YDAVGGAPAIKAVVNRFYELIVGDPSLAPFFEGIDMTSLKRHQVLMVSQVMGGPAEYDGRELRAAHAEM----PIRSEHFAAVVEHLVAALHEFDVPQEIIDRVVAALG--QTQPDIVT. 121
152 8.000e-32UniRef50_E7QW03 Hemoglobin n=5 Tax=Halobacteria TaxID=183963 RepID=E7QW03_9EURY  ali  34  4.SVYHEIGGQSAVEAVVTDFYDRVLSDEQLIPYFEGMDMAELRAHQIQFISSVAGGPVEYTGDDMREAHAHL----DLDESDFDAVGEYLETALRTNGVDDENVEAIMS--EVVALKDPILNR 119
153 8.000e-32UniRef50_A0A239VID9 Oligo-1,6-glucosidase n=106 Tax=Actinobacteria TaxID=201174 RepID=A0A239VID9_9MICO  ali  19  7PSPYERMGGHAAFTTLISTFYDGVRNDPELRALYPEEDLAPAEQRLLEFMEQYWGGPTTYSEKRGHPRLRMRHMPFAITPSQRDRWVTHMMKGVDAMGLPQALRAYLLRAADSLINTPE.... 129
154 9.000e-32UniRef50_A0A2E5DWC6 Group 1 truncated hemoglobin n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A2E5DWC6_9PROT  ali  41  6..LYACLGGSEAIQTVVVMLYDKILSDKKLKPFFSTVDLMRLKRSQVAFLSMAFGGPHHYTGEDLRKVHMRFVKSGMLKDEHFDAVANHLLTSLHELKIDQPLIDQVMDIVEST--RNDVLCK 124
155 9.000e-32UniRef50_A0A1F7NHP0 Uncharacterized protein n=21 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1F7NHP0_9BACT  ali  29  31PSLYQRLGGREGIALVVDDFVANMVADARVNARFKGMQPPKLKSNLSDQICDATGGPCAYLGRDMKATHKGM----KISEGEWNATVGNLVKALDKRKVGETEKKELINALGPM--KQDIVGQ 150
156 1.000e-31UniRef50_A0A132HEW5 Group 2 truncated hemoglobin GlbO n=22 Tax=Terrabacteria group TaxID=1783272 RepID=A0A132HEW5_MICLU  ali  17  237.SFYDAVGGRPTFDRLTAEFYARVREDEILAPMYPQDDFEGAQRRLLMFLEQYWGGPRTYSEERGHPRLRMRHAPYRIDPAARDAWLRHMRAAVDTLELSPLHEAELWDYLERAAH....... 351
157 1.000e-31UniRef50_E2SBB9 Protozoan/cyanobacterial globin family protein n=23 Tax=Bacteria TaxID=2 RepID=E2SBB9_9ACTN  ali  15  2.SFYDDIGGRSTIEQVVRVFYDGVAGDPLLRPMYPEADLDPARERFTLFLEQYWGGPTTYSEQRGHPRLRMRHAPFAVTAEARDAWLHHFRAGLDSADLTPEQDEQFWAYAQHAAT--FMVN. 120
158 1.000e-31UniRef50_A0A2J6NJC8 Globin n=4 Tax=Staphylococcaceae TaxID=90964 RepID=A0A2J6NJC8_9STAP  ali  21  3.TVYKQLG-EETIEALVDRFYDYVDKDPRMRFLFPD-DLTETRYKQKLFQIQFLGGPNKYNETFGHPMLKMRHMPFPITTKERDAWLDNMSKAMNDLNIPDDVKIQVLRRYEITAN--AMVN. 119
159 1.000e-31UniRef50_UPI000782C447 group 1 truncated hemoglobin n=1 Tax=Caldimonas taiwanensis TaxID=307483 RepID=UPI000782C447  ali  26  36..LYHALGGQAGLARLVDRFWDELKADARMAPFFANVNPVPFKQRLAEQLCEVSGGPCVYRGADMKTAHSGI----DVTRADFNALVEVLQRAMDAQDIGFRVQNRLLARLAPMHR--DVVN. 149
160 1.000e-31UniRef50_A0A2T5G6H6 Hemoglobin-like protein HbO n=1 Tax=Hydrogenibacillus schlegelii TaxID=1484 RepID=A0A2T5G6H6_HYDSH  ali  19  43AELYHALGGETGIRRIVEAFYRRVAEDPILKPIFPE-DLTETARKQFLFLTQFFGGPALYSAEFGAPMLRARHLRFPISPRRARRWLELMREAFAEAGIDPATTE--LAFLRLTKTAMHMVN. 161
161 1.000e-31UniRef50_D7CQD1 Group 1 truncated hemoglobin n=3 Tax=Bacteria TaxID=2 RepID=D7CQD1_TRURR  ali  31  5.SLYDELGGERAIEGMVEEFYDRVLADPGLHPFFVGVEMDKLRRMQREFFSAALGGPVRYTGVPLAYAHHGR----GISREHFARFVGILLETLRAHGVGEEAALAIIGRLNT--YTDEIVG. 119
162 1.000e-31UniRef50_A0A2P4URP9 Group 2 truncated hemoglobin GlbO n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2P4URP9_9ACTN  ali  15  6.TFYEAVGGEETFRRLVHRFYEGVAGDPVLRPLYPEEDLGPAEDRLRLFLVQYWGGPNTYSQERGHPRLRMRHAPFVIGAVERDAWLARMREAMDDLDLPEQLDAMLWNYFTMAAQS--MVN. 124
163 1.000e-31UniRef50_A0A1V3NKR7 Group 1 truncated hemoglobin n=2 Tax=Thioalkalivibrio TaxID=106633 RepID=A0A1V3NKR7_9GAMM  ali  39  2.SLYEEIGGEQSIQAALDRFYEKVMGDRRVSRFFDGLDVERIKGKQKAFLSMAFGGPQNYDGRDLRTAHERAVSQ-GLREGEYEVFMGHFRDTLEELGVPGPKIREILDIAAT--GRDDVLN. 119
164 1.000e-31UniRef50_A0A2W4QX06 Globin n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W4QX06_9CHLR  ali  18  21.TLYEVIGGEKTIRRLVDEFYARIETDSYLRPMFPE-DMEPGKRWQYLFLVQSFGGPNLFSQERGHPRLRARHLPFPIDRKARDHWLKHMLDAMDAVGIEEPARTLMRDYF--VRASEHMIN. 138
165 1.000e-31UniRef50_A0A1G9Z5R7 Hemoglobin n=25 Tax=Actinobacteria TaxID=201174 RepID=A0A1G9Z5R7_9MICO  ali  11  30PTFFDEVGGTPFFEKLVHDFYVGVATDPVLKPMYPEDDLGPAEHRLVMFLEQFWGGPGTYSEQRGHPRLRQRHVPFKVNPDARDRWLGHMKVAVDAANLPPLQRGILWDYLERAAF--AMVN. 149
166 2.000e-31UniRef50_A0A0Q7ACS5 Group 1 truncated hemoglobin n=7 Tax=Burkholderiales TaxID=80840 RepID=A0A0Q7ACS5_9BURK  ali  23  27.TLYRQLGGQSGLVKLTDDFMQRLLADPRMNPFFKDTDQKEFKAQLAAQFCEVSGGPCQRKGKDMKTVHDG----QDITKSNFNALVEVLQQSMAAQGIPFTAQNRLLAKLAPMHR--EIINK 142
167 2.000e-31UniRef50_A0A078MQ25 Group 2 truncated hemoglobin GlbO n=235 Tax=Terrabacteria group TaxID=1783272 RepID=A0A078MQ25_9MICC  ali  17  36..FYEAVGGHATFVRLVDEFYDGVATDPLMRPMYPEEDLGPAKERLLLFLEQYWGGPRTYSEQRGHPRLRMRHMPYAVSPAARDAWLLHMRRAVDKLELSPLHEATLWDYLERAAHS--MVN. 153
168 2.000e-31UniRef50_A0A158HKL4 Group 1 truncated hemoglobin n=16 Tax=Proteobacteria TaxID=1224 RepID=A0A158HKL4_9BURK  ali  20  25..LYKQFGEKEGLTKIVDDMYDNVLSDPRTAPYFDNAPVRRIKQKLVEQLCVLLDGPCVYTGRDMKRTHAGQN----IDRAAFNALVEDLQSAMDKNGVPFHAQNKLLAKLAPMYR....... 134
169 2.000e-31UniRef50_H0Q692 Group 1 truncated hemoglobin n=5 Tax=root TaxID=1 RepID=H0Q692_9RHOO  ali  35  27.TLYERLGGKPALTAVVNELWAVVSADKRINALFANTKPEVFGGQLVDFLCQASSGPCKYQGKDMKSAHAGM----KLTEADFNALAEDTVKALDKFKVPAGEKDEVMGLLGSL--KGDVVDR 142
170 2.000e-31UniRef50_W5YPQ9 Group 1 truncated hemoglobin n=40 Tax=Gammaproteobacteria TaxID=1236 RepID=W5YPQ9_9ALTE  ali  28  34PTLYQQLGERAGLAEIVEDLLYLIVDDKRINHQFKGINVAQFHRHLTDQLCQLSGGPCTYSGRPMRKAHADM----AITETQFNALAENLILAMEQNGISTGAQNRLLKRLIPMH--PDI... 147
171 2.000e-31UniRef50_A0A0Q6THS8 Group 1 truncated hemoglobin n=2 Tax=Pelomonas TaxID=335058 RepID=A0A0Q6THS8_9BURK  ali  28  43..LYQQLGGQEAIQRFTNDFYDALLEDARIARFFDGINMKHLKRVLADYFCVVAGGPCVYDGVGMKDAHAHL----GIGKGDFNTLVEHLQRAMDRANVPFGVQNQLLARMA-FSHR-DIVTK 157
172 2.000e-31UniRef50_A0A158D6T6 Group 1 truncated hemoglobin n=8 Tax=Burkholderiaceae TaxID=119060 RepID=A0A158D6T6_9BURK  ali  20  25..LYRQFGEKEGLTKIVDDMYDNVLADPRTAPYFDDAPVKRIKQKIVEQFCVLLDGPCVYTGRNMKRTHEGQN----IDRAAFNAVIEDLQAAMDKNGVPFHAQNRLLAKLAPMYR....... 134
173 2.000e-31UniRef50_M0ETP8 Globin n=17 Tax=Halobacteria TaxID=183963 RepID=M0ETP8_9EURY  ali  30  5.TLYERLGGHEGIRSVVDDFYDRLLDDDVLGPFFADADMETLRRTQTDFLCEKAGGPETYDAAPVREAHLHV----PFTPDHIQRALELLDESLAEFDVPERDAEAVVQAVA........... 111
174 2.000e-31UniRef50_A1SAB3 Group 1 truncated hemoglobin n=19 Tax=Gammaproteobacteria TaxID=1236 RepID=A1SAB3_SHEAM  ali  22  42PTLYQALGGETGVAAVVDGLLARIARDPRIVQHFEETDIAIFRERLIEHLCAVTDGGCVYQGESMADSHKGLN----ITQADFDALVGHLIESLKAQQIPTSTRNALLKRLAPM......... 151
175 2.000e-31UniRef50_A0A2U1ZT43 Globin n=11 Tax=Actinobacteria TaxID=201174 RepID=A0A2U1ZT43_9MICO  ali  15  62ATFYDEVGGHETFALLTQRFYDGVREDDLLAPMYPEADLEGAQWRLEAFLEQYWGGPTTYSAQRGHPRLRMRHAPFEVTPAARDRWLAHMRAALLSLDLPPLHEATLWDYLERAAH--AMVN. 181
176 2.000e-31UniRef50_A0A1N6G440 Hemoglobin n=1 Tax=Algoriphagus halophilus TaxID=226505 RepID=A0A1N6G440_9BACT  ali  28  11.TLYQRLGGETKLKIIVDDVLDKNASNPMIAYYFEKIDMDRLKLLVFEFFSMGIGGPHSYSGRDMRTAHTGLN----ITDEEWDSGTEDTIWALDKNGVDPSTRDEVIAILETM--RGDIVG. 125
177 3.000e-31UniRef50_F5SKL3 Group 1 truncated hemoglobin n=14 Tax=Thermoactinomycetaceae TaxID=186824 RepID=F5SKL3_9BACL  ali  31  12.SLYDKLGGNTAIRAVVNEFYDRMIKDPLVSSLFDGVDLVSLRKHQAQFLAYALGGPVKYDGSTLRESHTGLN----ITDKQYEATIRHLNAVLRKLNVELEDRAKIEAFIRSV--KPFIINK 127
178 3.000e-31UniRef50_A0A1E8FA65 Globin n=4 Tax=Alteromonadaceae TaxID=72275 RepID=A0A1E8FA65_9ALTE  ali  23  11.SLYEELGGQAKINEIVENFVYEIEYNDTILPYFADTDIDRFIEKFAEQLCVFSGGPCSYSGDTMKQVHGGMN----ITEADFNLTVDLFINAMNKANVPHTLQNKL--IARMTHTRKQMLY. 125
179 3.000e-31UniRef50_A0A1Y1R834 Uncharacterized protein n=1 Tax=Oceanospirillales bacterium LUC14_002_19_P2 TaxID=1940822 RepID=A0A1Y1R834_9GAMM  ali  40  2ASLYDRIGGGQAILMAVNVFYDKVSNHPVVGHYFYNLDIDKLARKQAAFLSIAFEGPLDDEVRGLREAHAGL----GITDAEFEIVVGCLEETLVEIGVDEALRKEVLGIVEST--RKDVVQR 118
180 3.000e-31UniRef50_A0A158CQB9 Group 1 truncated hemoglobin GlbN n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A158CQB9_9BURK  ali  20  24..LYRQFGEKPGLTKIVDDTYDNVLSDPRTAPYFDNAPVKRIKQKLVEQLCVLLEGPCVYTGRNMKRTHEGQN----IDRAAFNALVEDLQAAMDKNGVPFHAQNRLLAKLAPMYR....... 133
181 3.000e-31UniRef50_A0A078ABH4 Group 1 truncated hemoglobin n=2 Tax=Oxytrichidae TaxID=57506 RepID=A0A078ABH4_STYLE  ali  44  2TTLYERLGGADAINAVVEGMYQKIFTDEDLIDFFRKTDKPRQLEMQRQFLTYAFGGSSEWHGKSMKESHRGR----GITTDDFNKVAGHVVSTMKELSVPQELIDEVVAIL............ 108
182 3.000e-31UniRef50_A0A2E6LUI1 Group 1 truncated hemoglobin n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E6LUI1_9GAMM  ali  44  3.TLFHKIGGDDAVKALVELFYSKIMVDSRINYFFSGVDMATLKRHQAAFVAFALGGRPDYTGRTMKHAHARLV-ELGLNDTHFNAVAEHLESSMQELGVSENNAFQVMALIES--QREFVLGR 121
183 3.000e-31UniRef50_A0A248JMG1 Group 1 truncated hemoglobin n=3 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A248JMG1_9PROT  ali  22  35..LYQTFGGQPGLVALVDDFMDGMMRDPDLRPYFVNANRPHIKAELVAQFCAILGGPCEYKGMDMKMAHAR----YGIGDHEFNALVQDLQDAMDLHHIPYRAQNRFLAMLAP--YRDDVV.. 147
184 3.000e-31UniRef50_C4L3Q6 Globin n=12 Tax=Bacillales Family XII. Incertae Sedis TaxID=539742 RepID=C4L3Q6_EXISA  ali  22  2.SAYEQFGGERGVQQLVDAFYDLVYADPILLPLFPE-DQDRVKQHQFEFLTQLLGGPKLYSERRGGGNLAMIHHEHPISETHAGHWLGCMEQALKTVDAPESIKRQLFQRL............ 110
185 3.000e-31UniRef50_M5DQ83 Group 1 truncated hemoglobin n=6 Tax=root TaxID=1 RepID=M5DQ83_9GAMM  ali  21  25.TLYDDLGGQQGVANIVDDYITEISFDKNIYPFFKNTDIERLRTKLQEQFCMVSNGPCEYTGDTMEAVHAGMQ----IDKSQFNRVVELLQNAMTSQGVSYADQNRLIQRLAPM--RPAIIHR 140
186 3.000e-31UniRef50_UPI0008376D3D group 1 truncated hemoglobin n=1 Tax=Alteromonadaceae bacterium XY-R5 TaxID=1737567 RepID=UPI0008376D3D  ali  19  23GTLYEKLGEESGISAIVEDLIGLIGEDKQLFHFFAETKVSRFRNKLIEHLCFISDGPCVYTGDNMEDVHTGMH----ISEADFNRMVELLQQAMTTNQVPLPTQNLLLARLAPMRH--QIV.. 137
187 3.000e-31UniRef50_Q0BZ22 Protozoan/cyanobacterial globin family protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=Q0BZ22_HYPNA  ali  26  17..LYEVFGGEAGVSRIVDDLVERSLNDPRIADIFAASDLVRLRRTLKEQFCFILAGPCDYTGMDMASSHKD----HGITNREFNALVENLQHAMNAESVPFRAQNKLLAALAPMQR--DVVTR 131
188 4.000e-31UniRef50_A0A2N9JKN8 Group 2 truncated hemoglobin GlbO (Modular protein) n=2 Tax=Micropruina glycogenica TaxID=75385 RepID=A0A2N9JKN8_9ACTN  ali  18  309.SFFDKVGGHDTFVALVDRFYAGVANDPPLRDLYPEADLGPANVRLRMFLEQYFGGPKTYSEQRGHPRLRLRHGPYAVTPTQRDRWLHHMLAALDSLQLPADDDAEMRDYLTRAAH--FMVN. 427
189 4.000e-31UniRef50_F5YX68 Group 1 truncated hemoglobin n=3 Tax=Mycobacteriaceae TaxID=1762 RepID=F5YX68_MYCSD  ali  33  4..IYDEIGGAAALTAVVDEFYERVLADARLAGYFRNSDMARLKSRQVSFFAAALGGPEPYRGLSMADAHRDRN----IGRLQFDLAVGHLTAALTACEVPEATTAEIIAAIAPLA--DDIVT. 117
190 4.000e-31UniRef50_A0A2E6HSM0 Uncharacterized protein n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6HSM0_9CHLR  ali  17  64.TLFEDIGGRNAVGSWVSAFYDGAAKDPVIGHLFSADSSVP-KQRQAEFLEQWLGGEKLYSQHSGHPRLRLRHFPFVIDEEAAERWLMLMEEALASIDAPSELAEKIINRLTPLA--AHMVN. 181
191 4.000e-31UniRef50_Q82CH9 Putative globin-like protein n=247 Tax=Actinobacteria TaxID=201174 RepID=Q82CH9_STRAW  ali  16  13.TFYEQVGGEETFRRLVHRFYEGVAGDPLLKPMYPEEDLGPAEERFTLFLIQYWGGPTTYSEQRGHPRLRMRHAPFAVDRAAHDAWLKHMRVAVDELGLSEEHEHTLWNYL............ 122
192 4.000e-31UniRef50_A0A0F4QM08 Globin n=7 Tax=root TaxID=1 RepID=A0A0F4QM08_9GAMM  ali  19  19PTLYQQIGGEAGLESLVDLFIDQIGRDKVILPYFAKANVSHFRQGFITHLCDTLDGPCDYQGDSMVQIHTGMQ----ITEADFNRVVELLINAMTEAGIAHTTQNQILARLAPL--RGEVI.. 133
193 5.000e-31UniRef50_A0A1I0VLJ6 Group 1 truncated hemoglobin n=4 Tax=Paenibacillaceae TaxID=186822 RepID=A0A1I0VLJ6_9BACL  ali  37  10.SLYDRLGGKTGIHSVVERFYGKIQEDSKVSHYFRNIDYAKLMEHQTVFLSFATGGPDYYAGKSLTQAHEHL----KITPAHFDDVLGHLSDALIESGVIGSDIVQVLALLLPLKSR...... 121
194 5.000e-31UniRef50_J1EKN7 Group 1 truncated hemoglobin n=11 Tax=Proteobacteria TaxID=1224 RepID=J1EKN7_9BURK  ali  24  30..LYQALGEKPGIDRLVDDFVNRAVKDPRIGAHFKDTKPAALKESLADQFCQLSGGPCKYEGADMKSAHADMQ----INKGHFHALVEVLQSAMDAQGIPFAQQNRLLALLAPMHR--DVIT. 143
195 5.000e-31UniRef50_A0A2U3LT83 Group 1 truncated hemoglobin n=2 Tax=Bryobacteraceae TaxID=1962910 RepID=A0A2U3LT83_9BACT  ali  33  29..LYDRLGGMPAIQAVVDKLVGRILADERVNMWFAHADLEYAREKLADFICQGTGGPCKYAGLDMVAAHKGR----GVTEEAFNAVVEDLVATLDELKVPEKEKGQLLGLLAPM--KAAIV.. 146
196 5.000e-31UniRef50_A0A1I4V5A1 Group 1 truncated hemoglobin n=5 Tax=Bacteria TaxID=2 RepID=A0A1I4V5A1_9GAMM  ali  21  30GSLYAQFGETAGLSALVDSLLERFADDPRIAPKFANTNIPRFRRLFVEHLCVILDGPCTYTGDDMREVHTGL----DISEAQFNAVVEHLIDAMQAQDIPQTAQNRLIARLAPM--RKDIIY. 145
197 6.000e-31UniRef50_A0A0D7QLM0 Globin n=70 Tax=Actinobacteria TaxID=201174 RepID=A0A0D7QLM0_9MICO  ali  16  14.SFYDEVGGRATFEKLVRAFYDGVATDPVLVEMYPEEDHEGAIQRLTGFLEQYWGGPGTYSEERGHPRLRMRHMPFKVNPDARDRWLAHMRAAVDTLELSPLQDATLWGYLDRAAH--AMVN. 132
198 6.000e-31UniRef50_A0A1R0IK10 Group 1 truncated hemoglobin n=4 Tax=Sulfobacillus TaxID=28033 RepID=A0A1R0IK10_SULTH  ali  37  7PTLYEKYG--AAIDRVVSLFYQKVLDDKDLQPFFLGVNMDRQKKHMSAFITYALGGPNNYNGKNMEAAHRKL----KITDHHFDAVSKHLSDSLEQFSVEDSDRMNILSTIERL--REAIVG. 120
199 7.000e-31UniRef50_A0A254N229 Group 1 truncated hemoglobin n=4 Tax=Burkholderiales TaxID=80840 RepID=A0A254N229_9BURK  ali  25  51..LYRALGGRDSIQRFTDDFYERMLQDARIARYFEGVNTKYLKRTLADYFCVVAGGPCVYDGVGMKDAHAHL----GIDAAAFNALVESLQLAMDAAGVPFGTQNQLLARMAFFHR--DIITK 165
200 7.000e-31UniRef50_Q65LA7 Truncated form of bacterial hemoglobin YjbI n=76 Tax=Terrabacteria group TaxID=1783272 RepID=Q65LA7_BACLD  ali  16  8..PYEAIG-EELLSQLVDTFYERVKRHPLLYPIFPD-DLTETARKQKQFLTQYLGGPPLYTEEHGHPILRARHLPFPITPERADAWLSCMKEAMDHVGLKGEIREFLFERLTLTAR--HMVNQ 124
201 7.000e-31UniRef50_G8IRI0 NR2-2/2HbN n=3 Tax=Eukaryota TaxID=2759 RepID=G8IRI0_HETAK  ali  43  547.SLFEKLGGGEAVNAVVNKFYDKVLKDTSLSPIFDGKDVESLKMHQGMFLQWALGGENGYTGRSMKEAHAGL----GITEAHWNTVCGHLVGTLQELGVSAADIDTVVSKVAPL--KDDIVG. 662
202 7.000e-31UniRef50_A0A167KFH9 Uncharacterized protein n=2 Tax=Oleiphilus TaxID=141450 RepID=A0A167KFH9_9GAMM  ali  23  24GSLFEELGGQKGVEEIADRFVRILIKDERTEQAFTETDLDRFYEKVVEQFCEVSGGPCVYSGDTMKDVHKGM----DISAADFNAVVEILQKAMEQSDISLSAQNRLLAKLAPM--RADMLHQ 140
203 8.000e-31UniRef50_A0A172WSI3 Group 1 truncated hemoglobin n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A172WSI3_PSEST  ali  25  24.SLYRQLGGEPGITRIVEGMLLRIARDPRIVEHFQTVDIQRVRDKLIERFCVEAGGPCTYTGDSMEESHKGL----ALTPSDFNALVEDLQAAMTDEGVSMPAQNRLLARLAPM--RGQVIDR 139
204 9.000e-31UniRef50_A0A2E2VIL7 Uncharacterized protein n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2E2VIL7_9CHLR  ali  44  2ATLYENLGGQAALDAFVPALYDKVLTDDRVSSIFRGVGMERQGRMLKAFLTMGFGGPDDYAGKALRQGHKHLVDQ-GLNDEHFDAMAGHIKSTVEDLNXPAELVXQVMGAAGSL--RDEVLNK 121
205 9.000e-31UniRef50_K4KLD3 Cyanoglobin, Hemoglobin-like protein HbN n=1 Tax=Simiduia agarivorans (strain DSM 21679 / JCM 13881 / BCRC 17597 / SA1) TaxID=1117647  ali  21  23..LYERLGGEQGIITIVDNLLYVIAEDPIIRPLFEKTDLDRFHEKLSEQLCEVAGGPCIYTGDDMVEVHAGM----AMNNRHFDAMVTALDQAMQDAGVTFSARNAMLARLAALH........ 131
206 1.000e-30UniRef50_A0A084Y406 Hemoglobin-like protein HbN n=3 Tax=Bacteria TaxID=2 RepID=A0A084Y406_9PROT  ali  30  26PTLYKRLGGYDALAAVTDDFLGRLLPDPKLGRFFVGHSLNRIRGEIIDFLCVVSKGPCSYSGRDMKKAHGGL----KITDEDWDISVKALSTTLDKFKVPAVERKEVLTAVSGL--KGDIVGR 145
207 1.000e-30UniRef50_D2PTJ8 Globin n=21 Tax=Actinobacteria TaxID=201174 RepID=D2PTJ8_KRIFD  ali  18  6.SFYDAVGGAETFHRLVAAFYRGVAADPELRPMYPEQDLGPAEVRFRMFLEQYWGGPRVYSEQRGHPRLRMRHHPFAVTPGARDRWLGHMRAALDEIALPPERDEEIWKYMVMAAHS--MVN. 124
208 1.000e-30UniRef50_C8XH77 Group 1 truncated hemoglobin n=1 Tax=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / CIP 104796 / JCM 9543 / NBRC 105858 /  ali  30  8..PYQELGRHPGIRRAVQEFYERIAADPSLVEYFADADMDRLRRHVVELLAAAVGGPGQYTGRTMAKAHQGLH----ITDEAFDRVLGHLNAALVDVGADDRTIREVLRALSGM--RMDIV.. 120
209 1.000e-30UniRef50_A0A2C6V8S5 Group 1 truncated hemoglobin n=7 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2C6V8S5_NOSLI  ali  34  2STLYEKIGGKPTIEKVVDELHKRILADNSLKGFFANTDMVKQRNHQITFFSQIFEGPKEYGGRAMDKTHTGM----ALQQSHFDAIVKHLSESMAVAGVSADDTKAALDKVSNL--KPAILNK 118
210 1.000e-30UniRef50_Q1N3A5 Group 1 truncated hemoglobin n=101 Tax=root TaxID=1 RepID=Q1N3A5_9GAMM  ali  23  29.SLYERIGGLPTIEKLVDAFIKNIARDEQVLPYFRKSDVTHFRNGFIAHFCTVVDGPCEYKGDSMVDIHTGM----DINEADFNRTVELLVDAMEKVGISYRQQNEILARLASL--RKDII.. 142
211 1.000e-30UniRef50_W2EJM8 Group 1 truncated hemoglobin n=8 Tax=Streptosporangiaceae TaxID=2004 RepID=W2EJM8_9ACTN  ali  33  6.SYYEQVGGAPAVRTVVDGFYVRVLDDADLRPYFAGVDMPRLKRHMVVLLCSVLGGPEPYEGRDLAEAHRGM----GITPEHYAKVGEHLLSVLREAGVGDEILQHVV............... 108
212 1.000e-30UniRef50_A6GNQ3 Group 1 truncated hemoglobin n=32 Tax=Proteobacteria TaxID=1224 RepID=A6GNQ3_9BURK  ali  29  30.SLYEQLGGKESIRMVMDDFVVRLKADPRIGDQFAATNADRLASQLTDQVCEATGGPCKYVGADMKTAHEGMV----ITKAHFNALVEVLQTSMNAYSVPFDVQLEVLSMLAPMHR--DVIT. 144
213 1.000e-30UniRef50_A0A099CUV6 Group 1 truncated hemoglobin n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A099CUV6_9GAMM  ali  23  56...FADFGGKAGLKALMEDFMANLMADPRTQPFFAHVDRTRIKHELVDQFCVILDGPCTYTGASMAQAHRGL----GIKRADFNALVEDLQKAMNKHNIPFRAQNKLLAKLAPMHR--DIVTK 169
214 1.000e-30UniRef50_A0A1V4ENM9 Group 1 truncated hemoglobin n=4 Tax=Streptosporangiaceae TaxID=2004 RepID=A0A1V4ENM9_9ACTN  ali  34  13PSYYDQIGGAPVVRDVVEQFYERVLGDDDLKPYFTGIDMPRLKRHMVMLLCSVLGGPEPYEGRDLGEAHAGM----GITSEHYDKVGEHLFAVLQAGGVGEDI.................... 111
215 1.000e-30UniRef50_A0A2E6LRK9 Group 1 truncated hemoglobin n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E6LRK9_9GAMM  ali  24  25..LYRDLGGDEGVTRIVDAFLVHLAEDELVVDTFADTDIAEFRRLMIEQLCDLSGGPCTYGGRTMAESHAGM----GVTPAMFNALVADFIDAMDDAGVPQGAQNRLLGRLAPMY--GDIV.. 137
216 1.000e-30UniRef50_A0A1R4JAE6 Hemoglobin-like protein HbO n=5 Tax=Micrococcus TaxID=1269 RepID=A0A1R4JAE6_9MICC  ali  15  260TSFFEAVGGHETFAQLTKVFYENVRQDPLLAPMYPQDDWEGAEARLRLFLEQYWGGPRTYSEQRGHPRLRMRHMPYKVDFAARDAWLRHMRTAVDSLDLAPLQEAELWDYLERAAHS--MVN. 379
217 1.000e-30UniRef50_A0A246RWF7 Group 1 truncated hemoglobin n=6 Tax=Halomonas TaxID=2745 RepID=A0A246RWF7_9GAMM  ali  30  26TTLYERLGGKTTIDAVVENLLYRIADDPEVVVFFANTNIDLFAESLASQLCDVSDGPCRYEGPPMDRAHQHM----GLTDVHFNRVVEYLDAAMQAEDIPLGARNELLGRLAPM......... 135
218 2.000e-30UniRef50_A0A0F2RLU6 Globin n=15 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0F2RLU6_9RHOB  ali  22  47PDVFAAFHGQDGIDRIVDDLVDRIIVDPRIEGIFRASDLVRLRRTLKEQFCYLLGGPCEYTGRNMMDAHKD----QGISTREFNALVESLQAAMDTEGVPFAVQNKLVAKLAPMKR--DIVTR 163
219 2.000e-30UniRef50_A0A1I7MG59 Truncated hemoglobin YjbI n=3 Tax=Micrococcaceae TaxID=1268 RepID=A0A1I7MG59_9MICC  ali  13  229STFYDQVGGHETFAKLCRVFYEGVAQDPLLKPMYPEEDLGPAEERLLLFLEQYWGGPRTYSEQRGHPRLRMRHMPYTIDFEARDAWLRHMRTAVDSLELAPLHEHMLWDYLERAAHS--MVN. 348
220 2.000e-30UniRef50_A0A2P6TX38 Globin n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TX38_CHLSO  ali  34  138PSLYDQLGGGVAVKSVVDRFYRRVLDDPQLGRFFEGVDMTKHTRKFLLFVTYVLGGPDEYLQLNPQPVHEELMRRYGLRERHFDLVKGHFGEALQDAGAPQNLIDMALGVVETTRR....... 259
221 2.000e-30UniRef50_A0A1Y1YVF6 Uncharacterized protein n=1 Tax=Basidiobolus meristosporus CBS 931.73 TaxID=1314790 RepID=A0A1Y1YVF6_9FUNG  ali  43  7.TLYETLGGEETIGKVVDVFYNKVLNDDRIKDFFVGVDMEKQRLMQTKFLAFAFGGPA-FNGKKMNVAHRHL----KLKDEHFDAVIDDLGKALRDFDVSDEIIAKIVAVAETT--RDDVLGR 122
222 2.000e-30UniRef50_A0A2E6BIC8 Group 1 truncated hemoglobin n=2 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A2E6BIC8_9GAMM  ali  19  42.TLYDDLGGQPTIDRIADEFIVEIAYDDRVFPRFADSNVQRFREKIIEHFCMIANGPCVYTGDSMVQTHAGMN----ISEAEFNAVVEDLIAAMDTVGVDIGTQNRLLARLATL--RPQIVG. 156
223 3.000e-30UniRef50_A0A2G4YSE9 Group 1 truncated hemoglobin n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2G4YSE9_9PROT  ali  39  2TNLYTQIGGEPAVDAAVDIFYDKINSEKSLDPFFADIDMPQQRSKMKKFLTLLMTGKAENSGEYMRRSHQNL-GQKGINDTHFDTVGNLLKETLEELSVPGDFIGQILGAVESL--RDPVLNR 121
224 3.000e-30UniRef50_UPI000DCF1F68 group 1 truncated hemoglobin n=1 Tax=Chryseolinea sp. SDU1-6 TaxID=2059302 RepID=UPI000DCF1F68  ali  27  35PTLYTRLGGIDAISTVVDDFLTNVVADTEINDKFEATVADSLRANLIDQICAGAGGPCSYKGKSMKEAHAGM----GISTVEFNALVGDLVKALDKNSVPTAEKNELLAVLGPM--KADIV.. 154
225 3.000e-30UniRef50_A0A1I5EVH3 Hemoglobin n=65 Tax=root TaxID=1 RepID=A0A1I5EVH3_9PROT  ali  13  4ATSFERIGGETVIRRLVDHFYDLMDEDPDYVRKLHPQDLTHSREKLFMFLCGWTGGPSLYTEKYGEPRLRTRHMPFPIGVSERDQWLSCMSRAMADIGLDDELRKKLDMAFDQTA........ 120
226 3.000e-30UniRef50_A0A1P8UL37 Group 1 truncated hemoglobin n=2 Tax=Acidihalobacter ferrooxidans TaxID=1765967 RepID=A0A1P8UL37_9GAMM  ali  19  20...YKTFGGMAGIKALTNTFVDNVAADPHINYYFAHANIPQLKYQLAQQFCVVLGGPCKYTGQTMTQAHKGLQ----ITTAAFNYLAADMMAAMKTHNIPMAAQNYFIAQLAAME--PQIVTK 133
227 3.000e-30UniRef50_A0A0K0XZZ1 Putative Globin-like protein n=1 Tax=Wenzhouxiangella marina TaxID=1579979 RepID=A0A0K0XZZ1_9GAMM  ali  30  51.SLYERLGGYEAIDAIVRAGLAEVLADERINFLFEDTDLDNLQLRLTEQICELAGGPCTYEGLSMEEAHFAL----EINDAEFNALVEDFQIAMRANDIPYALENQLIALLAPMK........ 160
228 3.000e-30UniRef50_A0A158FWC5 Group 1 truncated hemoglobin GlbN n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A158FWC5_9BURK  ali  20  29..LYREFGEKPGLAKIVDDLYDNVLADPRTQPYFEDAPIKRIKQKLVEQFCVLLDGPCEYTGRTMKRTHEGQN----IDRAAFNALVEDLQKAMDKNGVPFHSQNKLLAKLAPMYR....... 138
229 3.000e-30UniRef50_A0A0D7QSZ4 Group 1 truncated hemoglobin n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A0D7QSZ4_9MICO  ali  36  3TSMYERLGGHETLKVAVAVFYTRVIADPLLAPYFAGIDLARLRAHQAAFLTVAMGGPDVFAGRSLEDAHEGL----TITGEAFDAMIDHLDFALTDVGVDPGDVDELIARVRPFR........ 113
230 4.000e-30UniRef50_A0BGI7 Group 1 truncated hemoglobin n=4 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0BGI7_PARTE  ali  48  5.TIFDKLGGQANIDAAVVKFYQKVLSDPSVSHYFKNTDMKKQTENQQKFLTMAFGGPNNYTGRDMKAGHAGL----GITTVAFNTIVKHLGDTLKEMGVP....................... 99
231 4.000e-30UniRef50_A0A1Y2MLX4 Group 2 truncated hemoglobin GlbO n=131 Tax=Bacteria TaxID=2 RepID=A0A1Y2MLX4_PSEAH  ali  16  7..FYAEVGGAPVFHRIVHRFYEEVARDDVLRPMYPEEDLGPAEERLRTFLEQYWGGPRTYSEQRGHPRLRMRHAPYTIGPIQRDAWLRCMQIAVDEENLSPEHREQLWNYMQ........... 116
232 4.000e-30UniRef50_A0A1Q5IWX3 Oxidoreductase n=5 Tax=Bacteria TaxID=2 RepID=A0A1Q5IWX3_9ACTN  ali  22  6PTLYEWAGGAEALERLTEAFYARVRKDELLAPLFAHMD-DDHPQHVATFIGEVLGGPTRYTEEHGGPHMVSRHRNRAIKPEQRARWVELMLAAMDEVGLPEDARSAFVGYIE-FGSRRAMAN. 128
233 4.000e-30UniRef50_A0A2G2QTD0 Group 1 truncated hemoglobin n=3 Tax=Porticoccus TaxID=1123967 RepID=A0A2G2QTD0_9GAMM  ali  22  30ATVYEGLGGEPGLAAVVDNLLERMAKDEQIVRYFQDTDITLFREGLTEHLCDVADGPCEYGGDDMKATHRGLN----ITQADFDRLVQLLIYAMQDEGIPIAVRNDLLKRLAPMY--GDVVYQ 146
234 4.000e-30UniRef50_A0A1G0CGU1 Globin n=1 Tax=Fluviicola sp. RIFCSPHIGHO2_12_FULL_43_24 TaxID=1798019 RepID=A0A1G0CGU1_9FLAO  ali  21  3.SLYERIG-KERLNLLVNRFYDLVFNSPVIGPLFQ-TDKETIREKQEAFLTQFLGGPQLYTTTYGHPRMRMRHLPHKITPEAADEWLRCMKTAIDSLEMEDDLKTALYNCFPPVA--KHMIN. 119
235 4.000e-30UniRef50_A0A2N3EE26 Group 1 truncated hemoglobin n=2 Tax=unclassified Alphaproteobacteria (miscellaneous) TaxID=33807 RepID=A0A2N3EE26_9PROT  ali  26  29.TLYTALGGNEGIVRLVDKATEEFLADPRISNTFADTNIARFKEKLAEQFCELSGGPCVYSGQDMHAAHKGL----KLRSRDFSALVENLQVAMGKCDIPFSTQNKLLALLAPMHR--DVVTQ 144
236 5.000e-30UniRef50_UPI00049673A0 group 1 truncated hemoglobin n=1 Tax=[Scytonema hofmanni] UTEX B 1581 TaxID=379535 RepID=UPI00049673A0  ali  35  4..LYDKLGGKPTLDKVVQDFHKRILADNTLQPFFAKTDMEKQRQHQVAFFAQIFEGPNEYKGRAMEATHAGMNLQQP----HFDAIVKHLKDSMAVGGASAEDTNAAVARVEKL--KGAILNK 118
237 5.000e-30UniRef50_D2Q0K6 Group 1 truncated hemoglobin n=4 Tax=Actinobacteria TaxID=201174 RepID=D2Q0K6_KRIFD  ali  34  14...YTAVGGGPAIASVVDLFYREVLADPQLVDYFADTDLARLKRHQVALVSQVMGGPVAYEGDDLAAAHAGR----GITAEDFGRVVEHLVGALRAHDVPTEIIDRVVGALGATQ--GDIVS. 126
238 5.000e-30UniRef50_A0A0M0X980 Globin n=42 Tax=Bacteria TaxID=2 RepID=A0A0M0X980_9BACI  ali  21  8..LFDEIGGAETIDKLVNAFYPRVYADKDLRPLFED-DVEEIKRKQRMFLSQFTGGPALYSEEFGPPAMQRRHLPFEITPTRAKCWLRCMKEAFHEIGLDEHFYDRLTQVAGIMVNSPD.... 128
239 5.000e-30UniRef50_A0A088QWD2 Group 2 hemoglobin glbO n=124 Tax=Actinobacteria TaxID=201174 RepID=A0A088QWD2_9CORY  ali  13  6.TLFDSVGGEDVFNRIVHGFYTRMRSDDLIGPMYPSDDWEGAEDRLRMFLVQYWGGPRSYSEQRGHPRLRMRHMPFSIGEAERDRWLEIMSASLADIELPRPQREAMWN---HMVQVADML.. 125
240 6.000e-30UniRef50_A0A2E6RFX7 Group 1 truncated hemoglobin n=1 Tax=Xanthomonadales bacterium TaxID=2006849 RepID=A0A2E6RFX7_9GAMM  ali  28  31.SLYQRLGGEQGVDRLVGELLDEVHADRRIAFLFEGTDRDNLHAVIVEQICAETGGPCTYRGLDMRAAHSGL----DIRHDEFDAFVEDLIVAMERVGVPTPAQNRLLAIFAPMREK...... 142
241 6.000e-30UniRef50_C0N7K0 Protozoan/cyanobacterial globin family protein n=3 Tax=Methylophaga TaxID=40222 RepID=C0N7K0_9GAMM  ali  20  25.TLYNKLGGEPGVEKIVTNLVQNIGHDEQIFHYFAEANVTRFKEHLAWHLCDISDGPCTYTGDTMQLIHDGM----TINERDFNHMVDLLIEAMYEADVPHHIQNQLLARLAPM--RKDIIYR 140
242 7.000e-30UniRef50_A0A2K9J838 Group 2 truncated hemoglobin YjbI n=9 Tax=Bacillaceae TaxID=186817 RepID=A0A2K9J838_VIRPA  ali  21  7.SIFEAIGGLPVVEKLVEAFYTRVSKHPDLIPIFPE-DLTETIHKQKLFLTQFFGGPPLYAEERGHPMLRRRHLPFAITPTRKDAWLTCMANALIEAEIEEPYRTAIFEKLTLTAN--HMMN. 124
243 7.000e-30UniRef50_A0A1G6YBG9 Hemoglobin n=2 Tax=Kordiimonas TaxID=288021 RepID=A0A1G6YBG9_9PROT  ali  24  23.SLFDDLGGKDAIARMMTRLVELTSADPRTAHQFEQTKKDRLARLLTDQVCELSGGPCKYRGVNMKKSHIKL----GITEAEFNALVEQLQQAMDEEGVPFHTQNRLLALLAPMKR--DIVER 138
244 7.000e-30UniRef50_A0A2A2F5W6 Group 1 truncated hemoglobin n=1 Tax=Halorubrum sp. WN019 TaxID=2032630 RepID=A0A2A2F5W6_9EURY  ali  31  1..MYARIGGNEAVESVVADFYDRVFSDSLLQPYFEDIDRDALYAHQVQFISAVAGGPVSYDGADMQAAHEGM----GITGEAFGRVATYLAEALRENGVTEDDVDAILDEVGAL--KPDVVAQ 115
245 7.000e-30UniRef50_UPI0009FFE289 group 1 truncated hemoglobin n=2 Tax=Solimonas TaxID=413435 RepID=UPI0009FFE289  ali  28  27..LYAALGGHAAVVALIDAFYRRVLADPLLAPYFKGVPLERLRRMQYAFFSAALGGPEDYKGRVIAHAHQGMH----ISREHFQHFVDHLFETLSRLPLDEQDRYDIIARINLYA--DDVIG. 140
246 7.000e-30UniRef50_B1TC86 Globin n=6 Tax=Burkholderia TaxID=32008 RepID=B1TC86_9BURK  ali  14  319PTAFELVGGEARVREMVDRFYDLMDLEPEFAEILHPASLDGSRDKLFWFLCGWLGGPDHYISRFGHPRLRARHLPFPIASVERDQWLRCMAWAMEDTGLPEPLRERLMDTADWMRNRP..... 442
247 8.000e-30UniRef50_A0A160MZH3 Group 1 truncated hemoglobin n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A160MZH3_9GAMM  ali  19  24PTLYEQLGGRDGIAAITDHLLDAFARDPRVAPTFDHVDIRRFRRYFADYLCQTADGPCRYTGDPMSEVHRGMH----IDEAMFNAVVQDLIIAMDREHVPVRVQNRLLARLAP--QRKDIIY. 139
248 8.000e-30UniRef50_A0A1B7UR49 Group 1 truncated hemoglobin n=12 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1B7UR49_9GAMM  ali  22  35..LYQQLGSTVGIEKVVDALLVEIEHDPQIVHHFRDTDIARFRKLLIEQLCELSGGPCKYTGASMQESHTG----FKITQADFDNLVRHLMKAMTEQNISIAAQNQLLGLLAPMY--GDVVYR 149
249 8.000e-30UniRef50_A0A261U9F9 Hemoglobin-like protein n=25 Tax=Burkholderiales TaxID=80840 RepID=A0A261U9F9_9BORD  ali  21  18.TLFETLGGEPAIRSLVDRFYDLMEADFAVLRGVHGPSLDSARDKLFLFLCGYFGGPNYYIERYGHPRLRARHLPFSIGRVERDQWLACMGRAMQDEGFSPELVDRLLEVADWMRNRD..... 140
250 8.000e-30UniRef50_A0A1Z9DYZ9 Group 1 truncated hemoglobin n=1 Tax=Gammaproteobacteria bacterium TMED119 TaxID=1986671 RepID=A0A1Z9DYZ9_9GAMM  ali  41  3PTLYDKIGGREVVQKASHHLYTNILNDELLQPFFKDIDVQTQERKMNAFLTYIFGGNSLYTGKTMRRAHAQAVAA-GLTDSHFDAMMQCAKKXLQTLELEQQLIDEVAGVIE--KHRPNILNR 122
251 9.000e-30UniRef50_A0A0U3E6L5 Globin n=3 Tax=Burkholderiales TaxID=80840 RepID=A0A0U3E6L5_9BURK  ali  26  70.SLFRALGGEAGVAAISAGLVERVYADERIKHLFQETNPRFLTEQLRKQFCELSGGPCKYDGETMKKSHAAL----GINKAHFNALVEDLQLAMDAQGVPFATQNRLLALLAPMYR--DVVTR 185
252 9.000e-30UniRef50_F7RV81 Group 1 truncated hemoglobin n=9 Tax=Idiomarinaceae TaxID=267893 RepID=F7RV81_9GAMM  ali  24  27.SLYQDLGGTAGIEQLVEDLLFNVADDRRIRHHFMDIDIGRLHEKLSEQICELAGGPCVYTGDDMVKSHTGM----GVTRADFNALVEALQVAMDDNGVSVSAQNRLLALLAPMHH--EIVG. 141
253 9.000e-30UniRef50_Q15ZA2 Globin n=8 Tax=Proteobacteria TaxID=1224 RepID=Q15ZA2_PSEA6  ali  18  28PSVYAQMGGQPKVEEVVDNFITEIEFDPVIFEYFTDTDVDRFREKLVEHVCHLTGGHCEYTGDTMARVHAGMN----ITETDFNRGVDLFINAMNKAQIPHPIQNKVLAILA--KTRKEMIY. 143
254 1.000e-29UniRef50_A0A0C2C5Y4 Globin n=2 Tax=Burkholderiales TaxID=80840 RepID=A0A0C2C5Y4_9BURK  ali  19  30..LYRQFGEKEGLARIVDDMYATVIVDPRTAPYFENAPIRRIKPKLVEQLCVLLDGPCVYTGRPMKRTHEGQN----IDRAAFNALVEDLQAAMDKNGVPFHAQNKLLAKLAPMYR....... 139
255 1.000e-29UniRef50_A0A2D6QM74 Group 1 truncated hemoglobin n=5 Tax=Pseudomonadales TaxID=72274 RepID=A0A2D6QM74_9GAMM  ali  25  31.SLYQAMGGQAGINRVVEGLLYQIADDERIVHHFADTDIARLQEKLQEQFCVEAGGPCVYSGDSMADVHAG----FELTEADFNALVEDLIAAMEAEQLPVIVQNRLLQRLAPM--RADIIYR 146
256 1.000e-29UniRef50_A0A1Y5FAB6 Group 1 truncated hemoglobin n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5FAB6_9PROT  ali  33  4.SLFEKYGGFSTLGKLVVEFYKKVLNDKTVAHFFEDVEMDKLMEHQTNFLAFALGGPNEYAGRDVKVAHEVM----DISNRDFSIVAGYLEETLDEAGVEEADIATIISIVSGLQ--DQIVTK 119
257 1.000e-29UniRef50_P15160 Group 1 truncated hemoglobin trHbN n=8 Tax=Paramecium TaxID=5884 RepID=TRHBN_PARCA  ali  32  2.SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANM----GVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETV--RGDVVT. 116
258 1.000e-29UniRef50_A0A157MZZ2 Globin-like protein n=62 Tax=root TaxID=1 RepID=A0A157MZZ2_9BORD  ali  18  19.TLFELLGGEPGLHALVERFYDLMDLEPDFRELRHGPSLDEARQKLFWFLCGYFGGPNHYIERFGHPRLRARHLPFSIGEIERDQWVACMGRAMQDQNVPPALLDRILGTADWMRNRA..... 141
259 1.000e-29UniRef50_C6XEL0 Globin n=22 Tax=Bacteria TaxID=2 RepID=C6XEL0_METGS  ali  17  13ATFFELLGGVDQIRALVERFYDVMDSDPKAARAIHAADLTEAREKLFMFLTGWTGGPQLYIERYGHPFLRRRHMPFEIGEEQRDQWIYCMVRAMHDIGVEEELAEALWGVADFMRNKP..... 136
260 2.000e-29UniRef50_A0A2V6VYV1 Group 1 truncated hemoglobin n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6VYV1_9BACT  ali  30  33PSLYKRLGGREGIAGVVDAFVANALADARIGPAFPADKVGPLKTNIADFICENTGGPCSYGGRTMKDSHRGL----GLEKADFDACNAALAKALDSKNVAAADKEQVMKLVASLMN--DIVEK 152
261 2.000e-29UniRef50_Q00812 Group 1 truncated hemoglobin GlbN n=28 Tax=Nostocales TaxID=1161 RepID=TRHBN_NOSCO  ali  29  2STLYDNIGGQPAIEQVVDELHKRIATDSLLAPVFAGTDMVKQRNHLVAFLAQIFEGPKQYGGRPMDKTHAGLNLQQP----HFDAIAKHLGERMAVRGVSAENTKAALDRVTNM--KGAILNK 118
262 2.000e-29UniRef50_A0A2C8D7F2 Group 2 truncated hemoglobin GlbO n=17 Tax=Corynebacteriaceae TaxID=1653 RepID=A0A2C8D7F2_CORDP  ali  17  5ASFYESVGGEETFHLIVHRFYERMRNDDLIGPMYPDDDWKGAEDRLRWFLAQYWGGPQTFSENRGHPRLRMRHAHFPIGMNEAQRWLDIMSDTLDEATLPPAHRAAMWDHMQRVAQ....... 123
263 2.000e-29UniRef50_UPI0006484D24 group 1 truncated hemoglobin n=1 Tax=Methylibium sp. CF468 TaxID=1500262 RepID=UPI0006484D24  ali  26  37..LYQQLGAQPGLVKLVDDFMVRLLADPRMNPFFKDVDQAHVKAELVTQFCEVAGGPCRRKGPDMKQAHAGM----DINKNNFNALVEVLQQAMQAQGIAFTTQNKLLAKLAPMHR--DIIN. 150
264 2.000e-29UniRef50_A0A2U2XCX5 Globin n=1 Tax=Brumimicrobium sp. C305 TaxID=2100725 RepID=A0A2U2XCX5_9FLAO  ali  18  8.TLYERLG-EHNIKDLVDAFYERVYQHPVLIPLFDEDSIDEIKDKQFRFLTQFLGGPLRYIEKYGPPRMRMRHLPHKIDQNAMIAWLSCMKGAISTLSLSEENATELYNKFPQLAQ--HMVN. 125
265 2.000e-29UniRef50_Q0RMX2 Group 1 truncated hemoglobin n=43 Tax=Actinobacteria TaxID=201174 RepID=Q0RMX2_FRAAA  ali  32  2.SIYQDIGGAKAVKAAVDEFYVRVLADPDLVRFFEGRDLASLKASQREFIGAALGGPEIYQGDAMSQVHASL----GVGNAQFDGVVGHLLAAFASAGVPAEAAGQIAAVLGPL--RGEIVT. 116
266 2.000e-29UniRef50_A0A1I4WWZ2 Hemoglobin n=2 Tax=Dokdonella immobilis TaxID=578942 RepID=A0A1I4WWZ2_9GAMM  ali  23  36PSLFEQFGGKPGIDALMEDFMVKLIEDPRTRNYFAEADQTHIKAMLAEQFCVILGGPCTYTGKGMREAHAKLV----INQGGFNALVEDLQRAMDMHDIPFRAQNRLLAVLAPMHR....... 150
267 2.000e-29UniRef50_F5YY56 Globin (Oxygen-binding protein) GlbO n=143 Tax=Actinobacteria TaxID=201174 RepID=F5YY56_MYCSD  ali  19  10PSFYDAVGGAETFHAIVSRFYQLVAQDAILRPMYPADDMDGAEERLRMFLEQYWGGPRTYSERRGHPRLRMRHIPYRIGPLQRDAWLRCMVTAINEIDLDDARRAELLDYLHSAA........ 127
268 2.000e-29UniRef50_G4F309 Group 1 truncated hemoglobin n=21 Tax=Gammaproteobacteria TaxID=1236 RepID=G4F309_9GAMM  ali  31  36TTLYERLGGEASIDAVVENFLYRIADDDDMVGFFANTNIDFFADSLANKLCDVSDGPCRYEGPPMDRAHQNM----GLTDVHFNRLVEHLDAAMQEEGIALSARNELLGRLAPM......... 145
269 2.000e-29UniRef50_UPI000BF4E5C8 hypothetical protein n=1 Tax=Thermoflexus hugenholtzii TaxID=1495650 RepID=UPI000BF4E5C8  ali  19  53PAPYHQLGGYQAVWRIVEAFYRRVETDDILRPLYPE-NLEPGKQKLAWFFEQWLGGPTSYSDRYGHPRLRRRHFPFVIDERAAGRWLRLMREAWTEAGVPRELQDPIFERLAVLAR--HMIN. 171
270 2.000e-29UniRef50_A0A2D8HTV4 Group 1 truncated hemoglobin n=9 Tax=Alteromonadales TaxID=135622 RepID=A0A2D8HTV4_9GAMM  ali  20  21..LYQQLGEKEGIETVVEEMLYRVGGDDRIAHHFTDVDIMRVHKLISEQICDVSGGPCDYSGDDMKTSHRNM----GVTNADFNALVEHLIAAMEKHDIPVAAQNQLLGLLAPMH--GDIV.. 133
271 2.000e-29UniRef50_A0A223PAL6 Group 1 truncated hemoglobin n=10 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A223PAL6_9BURK  ali  25  32.SLYRDLGGLEVLTKVVDDTLALALADVRIKDTFKDTDMKRLAKLITEQFCELSGGPCKYSGDPMKEVHQGL----ALNNMQFNALVEDLQAAMDKANIPSRTQNKLLALLAPMQR--TVVSK 147
272 3.000e-29UniRef50_UPI0004A72D19 group 1 truncated hemoglobin n=1 Tax=Nevskia soli TaxID=418856 RepID=UPI0004A72D19  ali  31  6.SLFERIGGADAMPSLVEQFYGRVLKDPELKPFFADANMEKLKRMQVEFLSAALGGPVHYEGSPIRRAHSHL----KISLANYQRFTQHLFAALADYKLSEQECYDVIFRLDV--HANDIVTK 121
273 3.000e-29UniRef50_A0A0F0LW35 Group 2 truncated hemoglobin GlbO n=48 Tax=Actinobacteria TaxID=201174 RepID=A0A0F0LW35_9MICO  ali  15  6.SFYDEVGGHATFQRLVEVFYREVALDPVLKPMYPEEDLGPAADRLRMFLEQYWGGPTTYGEQRGHPRLRMRHMPFHVDPDARDRWLRCMRTAVDDAQLSPIHEATLWDYLERAAH--AMVN. 124
274 3.000e-29UniRef50_A3D7E5 Group 1 truncated hemoglobin n=12 Tax=Gammaproteobacteria TaxID=1236 RepID=A3D7E5_SHEB5  ali  22  43.TLYQELGGEAGLSAIVDGLLARIATDPRIVHHFQETDIALFRERAIEHFCLVADGGCVYHGENMALSHQGLN----ITQADFDALVGHLIESMKEQHIPLSTRNALLNRLAPM......... 151
275 4.000e-29UniRef50_A0A2A5CUD8 Group 1 truncated hemoglobin n=1 Tax=Moraxellaceae bacterium TaxID=1889775 RepID=A0A2A5CUD8_9GAMM  ali  30  4.TLFDKYGGFPTFSAVVSNFYKKIMDSNELAPYFEGVDMERLMSHQTNFIAKALGGPDKYEGRDLKKVHAR----FNITQPHFSGVAELLAGALGEAGVTDEDVETVIGVVGSLQ--GQIVS. 118
276 4.000e-29UniRef50_A0A191WBX3 Group 1 truncated hemoglobin n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A191WBX3_9MICO  ali  37  16...YAAVGGAPAITAVVNRFYELVLGDDLLAKHFEGTEMARLKRHQVALVSQVMGGPVEYEGRELRAAHANL----GITAEEFGAVAGHLITALTEAGVPSEIIDRTVGAVAATQ--PDIV.. 127
277 4.000e-29UniRef50_A0A2V8NWU8 Group 1 truncated hemoglobin n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8NWU8_9BACT  ali  27  36.SLYKRLGGYDALAAVTDDFIKGLATDKQLSRFFKGASADRIRQLVLDQLCAATGGPCLYIGRSMKTVHTGL----GITEEDWDISVKLLTQTLDKFKVGKTEKDDLFKILLTL--KPDIVEK 154
278 4.000e-29UniRef50_Q8NMW6 Hemoglobin-like proteins n=42 Tax=root TaxID=1 RepID=Q8NMW6_CORGL  ali  17  7..FYDSVGGEETFSLIVHRFYEQVPNDDILGPMYPPDDFEGAEQRLKMFLSQYWGGPKDYQEQRGHPRLRMRHVNYPIGVTAAERWLQLMSNALDGVDLTAEQRE---AIWEHMVRAADML.. 122
279 4.000e-29UniRef50_A0A0F0L216 Group 2 truncated hemoglobin GlbO n=54 Tax=Actinobacteria TaxID=201174 RepID=A0A0F0L216_9MICO  ali  15  6.SFYDEVGGHATFQRLVDVFYREVALDPVLKPMYPEEDLGPAADRLRMFLEQYWGGPTAYGEQRGHPRLRMRHMPFHVDPDARDRWLRCMRTAVDDAALSPIHEATLWDYLERAAH--AMVN. 124
280 4.000e-29UniRef50_Q5QV13 Group 1 truncated hemoglobin n=91 Tax=root TaxID=1 RepID=Q5QV13_IDILO  ali  21  20.SLYQQLGEQQGIETIVEEMLYRVGGDERIAHHFDGVDIMRVHKLISEQVCDLSGGPCDYSGEDMKTSHRNM----GVDNADFNALVEHLIAAMEKEDVPVSAQNQLLGVLAPMH--GDIV.. 133
281 4.000e-29UniRef50_A0A2G2E8N2 Group 1 truncated hemoglobin n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2G2E8N2_9GAMM  ali  16  26STLYNKLGGEQGVNNIVENLIQQIGQDEQIFHYFAEARVSRFRENLIEHFCAISDGPCQYTGDNMADIHTGMN----INESDFNHLVDLLINAMDAEGIPHRVQNQLLARLAPLR........ 136
282 5.000e-29UniRef50_A0A1Q2HYN2 Hemoglobin-like protein n=23 Tax=Bacteria TaxID=2 RepID=A0A1Q2HYN2_9CORY  ali  16  6.SLYDAVGGEEFFQKLVAGFYAQIKTDDLIGPMYPEDDWEGAEDRLRWFLSQYWGGPRMYQEQRGNPMLRRRHFPFSIGEAEADRWLDLMHNSLDQFSDEELLRDQLWNHMQRVAY--MMINR 128
283 5.000e-29UniRef50_A0A1H4JJY4 Hemoglobin n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1H4JJY4_9ACTN  ali  15  7.TFYDEIGGEATIRTIVHRFYEGVAGDDLLRPMYPEEDLGPAEERFTLFLMQYWGGPTTYSDDRGHPRLRMRHAPFRVTPAAAERWLVHFRAGLDAAALPADQDERFWDYVTHAAQ--FMVN. 125
284 5.000e-29UniRef50_A0A1H1BYI0 Group 1 truncated hemoglobin n=2 Tax=Streptosporangiales TaxID=85012 RepID=A0A1H1BYI0_9ACTN  ali  35  5ASLYEKIGGGPAVREVVDAFYTDVLGDTDLKPYFDGIDMARLKRHMVVLLCSVLGGPEGYRGRELGEAHKNL----GISDEHYAKVGDKLVTALRDHNAGEDVVQHVTTVLN--QVRPSIVEK 121
285 5.000e-29UniRef50_Q13N39 Putative globin n=6 Tax=Proteobacteria TaxID=1224 RepID=Q13N39_PARXL  ali  19  15ATHFDRLGGEPAVIRLVDAFYRRMDTRPDAQRIMHHPDLSSTKAVLVLYLCEWLGGDKQYSAQRGHPRLRMRHAAFAIGLAERDAWLTCMRGALDETGVDPALRDELMQAF............ 127
286 5.000e-29UniRef50_A0A0Q9RQ58 Group 1 truncated hemoglobin n=1 Tax=Paenibacillus sp. Soil787 TaxID=1736411 RepID=A0A0Q9RQ58_9BACL  ali  34  10.SLYDRLGGKNGIQSAVELFYGKIKDDLRLSHYFQHIDFANLMEHQTIFLSFASGGPNYYTGKSLTQSHEHLN----ITSTHFDDVLGHLTDSLIELSVTGRDIVQVLALLLPL--KAQMI.. 123
287 5.000e-29UniRef50_A0A1A9HSM2 Uncharacterized protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1A9HSM2_9BURK  ali  21  26..LYRSLGGEEGIARIVDGMVDRAYADDRIKKKFDGVNPKALKESIRNQFCVLSGGSCKYEGETMKNSHAHL----ALDKADFNALVEDLQFAMDDQQVPFAVQNRLLALLAPMHR--DIITR 140
288 5.000e-29UniRef50_A0A1C2HZJ4 Cyanoglobin n=19 Tax=Acidithiobacillus TaxID=119977 RepID=A0A1C2HZJ4_ACITH  ali  24  40...YAQYGGKAGITKLINTFVGNVANDPHINYYFAHTNIPHLKYELVQQVCMAVGGPCKYTGLSMRKAHEGM----GVTTAAFNYLAQDMMDAMQTQRIPMSAQNYLIAILASME--PQIVT. 152
289 5.000e-29UniRef50_UPI000255CD14 truncated hemoglobin n=1 Tax=Nesterenkonia sp. F TaxID=795955 RepID=UPI000255CD14  ali  15  306.TFYEAVGGHETFVRIVDVFYEQVAEDPDFRALYPEEDLEPAKRRLLMFLEQYWGGPRTYQEERGHPRLRMRHMPFRVDAAARDTWLRYMRRAVDAAELSPLHDEILWDYLSRAAHS--MVN. 424
290 5.000e-29UniRef50_UPI0006853BE5 group 1 truncated hemoglobin n=1 Tax=Amycolatopsis nigrescens TaxID=381445 RepID=UPI0006853BE5  ali  39  1......MGKEAGISTVVEDFYRRVLDDNELRSFFAEVSLPSLRRHMTAFLAAATGGPVSYQGRDMPAAHRGL----GITDTHFDAVAGKLVETLRAHQVPAPDIDAVVGKVGGL--RGEIV.. 109
291 5.000e-29UniRef50_A0A0P8AVZ7 Group 1 truncated hemoglobin n=23 Tax=Halomonadaceae TaxID=28256 RepID=A0A0P8AVZ7_9GAMM  ali  28  27PSLYTRLGGMSTIDNVVENMLYRVADDPEVVVFFANTNIDHFAEAFATQLCDISDGPCQYDGPPMDRAHQHM----GINDAHFNRVVEYLADAMEEEGVPLAEQNELLGRLAPLY--EDIMRR 143
292 6.000e-29UniRef50_UPI000DD3B12A group 1 truncated hemoglobin n=1 Tax=Halomonas taeanensis TaxID=284577 RepID=UPI000DD3B12A  ali  28  36.SLYAALGGKPVIDAVVNDFLYRIAGDERIVDFFANTNIDHFAEAFATQLCDISDGPCDYAGPSMARAHQQM----GITNAHFNAVVDHLRAALVDQDVPAGPRNRLLGRLARLH........ 145
293 6.000e-29UniRef50_A0A2I0R5Y3 Globin n=1 Tax=Brumimicrobium sp. LHR20 TaxID=2058658 RepID=A0A2I0R5Y3_9FLAO  ali  21  8.SLYTVLG-KEKIKKLVDSFYGFVYQDPEIAPLFKG-DIEVIKEKQYCFLTQFFGGPRLYIEKYGAPRMRMRHLPHKIDQKAMEAWLNCMQKAIGTLNLSKEVSEKLYNSFPKLAQ--HMVN. 124
294 6.000e-29UniRef50_A0A2E5Z7G2 Globin n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2E5Z7G2_9CHLR  ali  16  8.SLYNRVGGWPFFEALVNGFYELVENDPVLRPLYPE-NLEPGKFWLVSFLAQYWGGPGYYSENRGHPRLRQRHFMFPIGEKQRNXWFENMSKAVKSMKISESDTEVLIGYFVST......... 119
295 6.000e-29UniRef50_A0A1J5QDR6 Group 2 truncated hemoglobin YjbI n=18 Tax=root TaxID=1 RepID=A0A1J5QDR6_9ZZZZ  ali  15  5ASYYELIGGEAGLRRLVTRFYEVMATEPKAIRAMHPGDLSGAREKLFLFLSGWMGGPPLYVEKYGHPMLRARHLPFPIDESARDQWIYCMLRAMHDVGIEEKLTQQLWGVADFMRNQPEV... 130
296 6.000e-29UniRef50_A4ACE9 Hemoglobin like protein n=1 Tax=Congregibacter litoralis KT71 TaxID=314285 RepID=A4ACE9_9GAMM  ali  18  25..LYHELGQEAGIEAIVDEFLYALADNDRSLPLFANTNIERFRTQFALQLCAVSGGPCEYEGDSMAATHRGMN----IDRAQFNTVVSDLIQAMEARKVPTATQNRLLARLAPMY--SEIVGQ 139
297 6.000e-29UniRef50_A0A0H2LVQ4 Group 1 truncated hemoglobin GlbN n=28 Tax=Proteobacteria TaxID=1224 RepID=A0A0H2LVQ4_VARPD  ali  24  3ATLYERLGGEERIQRLVTDVVENHYSNPLIRSRFANSNRAEVERHVVEFLCAGSGGPQCYTGKDLVSAHKGMN----ISEQELVAAMDDIVAAMTKNGYDQAEKNEVVAILYSL--KGDVV.. 117
298 6.000e-29UniRef50_A0A1B3LWY4 Bacterial-like globin family protein n=26 Tax=Burkholderiales TaxID=80840 RepID=A0A1B3LWY4_9BURK  ali  13  12ATPFEWIGGEVKVRALVDRFYDLMDIEPGYAELRHGNTLEDARQKLFWFLCGWLGGPQHYTEQFGHPRLRMRHMPFSIGVQERDQWLACMDQAMGETGVDAALRARLFQTADWMRNQP..... 135
299 7.000e-29UniRef50_A0A095YG53 Group 2 truncated hemoglobin GlbO n=4 Tax=Corynebacterium TaxID=1716 RepID=A0A095YG53_9CORY  ali  16  3.TMYEALGGDAFFRRLVSGFYQQVRKDDLIGPMYPEDDWDGAEDRLRWFLAQYWGGPTTYNEQRGAPMLRRRHLPYPIGMAEAERWLELMNRSLDQFELNEEQRGALVNHMERVAY....... 120
300 7.000e-29UniRef50_A0A2G3K054 Group 1 truncated hemoglobin n=1 Tax=Chitinimonas sp. BJB300 TaxID=1559339 RepID=A0A2G3K054_9BURK  ali  24  61.SLYERLGGEAGVSEIASEMLDLTASAPQTRRTFDKVNMPRLKQKVAEHICSLTGGPCQYSGDTMKQSHAGM----GITESELNGMVEHLRTVLDARHVAQADKNALLAILAPMKR--DIV.. 174
301 8.000e-29UniRef50_A0A0B2AE70 Uncharacterized protein n=3 Tax=Microbacterium TaxID=33882 RepID=A0A0B2AE70_9MICO  ali  30  9.TLYQQLGEGAGIAAVVDRLYELIMADDTLAPFFVDTRLPQQKGHMAMFLAAATGGPNAYTGMDLGAAHAGR----GISDADFDRVIGHAATALSEAGVDDETIGVVAGAL--MPLRAQVVT. 123
302 8.000e-29UniRef50_I7IWC9 Hemoglobin n=74 Tax=Actinobacteria TaxID=201174 RepID=I7IWC9_9CORY  ali  13  19..FYEAVGGHETFEKIVGGFYRRVPDDDILGPMYPEDDLEGARWRLTAFLEQYWGGPKTYSEVRGHPRLRMRHQPFPVDRAAAQRWLDLMGASLDEIDLPEEYRAAIWN---HMRQVAAML.. 137
303 8.000e-29UniRef50_A0A0K8NU10 Cyanoglobin n=1 Tax=Ideonella sakaiensis (strain 201-F6) TaxID=1547922 RepID=A0A0K8NU10_IDESA  ali  28  75PALYRALGGPAGIDGIVEGMLQRALSDPRLLPFFGDADLPNLRTQLKAQFCRLSGGPCVYEGANMRKAHAGL----DLRAADFNALVEVLQDTMAARGIPFAVQNRFLAQLAPFHR--DVVN. 190
304 8.000e-29UniRef50_A0A0C1DXE9 Uncharacterized protein n=25 Tax=Actinobacteria TaxID=201174 RepID=A0A0C1DXE9_9MICC  ali  14  34.SFYAAVGGHETFVKLIDVFYDGVATDPLLRPMYPEEDLGPAKRRFLMFLEQYWGGPTTYGEERGHPRLRMRHMPFQVTPEAKDRWLFHMRTAVDALDLSPLHEGTLWDYMERAA........ 147
305 8.000e-29UniRef50_A0A1V3PYS1 Uncharacterized protein n=2 Tax=Rhodanobacter sp. C03 TaxID=1945858 RepID=A0A1V3PYS1_9GAMM  ali  22  30ATLYDQLGGEQGIAALTDAALDHYAADPRVAPAFAHADIGRFRRMFAQYLCQVADGPCHYTGDSMADVHRGMN----VSETQFNAVVEGLTASMTSLHISVRVQNRLLRRLAP--ERGDVIYK 146
306 9.000e-29UniRef50_A0A1Y6CB68 Truncated hemoglobin YjbI n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6CB68_9PROT  ali  23  2TSLYDRLGG-DFLAAIITEFYDRAFKDPLIAHLFWGFDQKHLTEMQIQFASSMLGGPGPYRGKSLGQAHRQL----KINQAHFGRRQVLMAEVLDEFQVDPDIKKQWLEREDRLK........ 111
307 9.000e-29UniRef50_A0A2M8PW79 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A2M8PW79_9CHLR  ali  15  12...FERIG-HEGFERLVHAFYQRVATDDILRPMYPSGDLAPAERRLRLFLEQYFGGPTTYSQQRGHPRLRARHLRFPIDQAARDRWVSLMLAALEEAELPDDVAAIMRQYFE........... 119
308 9.000e-29UniRef50_G8IRI3 NR2-2/2HbN (Fragment) n=1 Tax=Chattonella subsalsa TaxID=44440 RepID=G8IRI3_9STRA  ali  47  327.SLYEKVGGEAAIQAVVEKFYEKVLKDNLLSPIFESRDIKSLKLHQKLFLKYALGGTKAYDGRSMSDAHRGL----GIKEPHWKAVCGHXVNTLTELGVSREHIDEVVQRVLPLH--DDIV.. 441
309 1.000e-28UniRef50_W7WUT1 Hemoglobin-like protein HbN n=13 Tax=Betaproteobacteria TaxID=28216 RepID=W7WUT1_9BURK  ali  27  3PSLYQRLGESEGITAIVDDAVDRHAVNPLLAPRFSGKDLAHAKRMGAQFFCMGAGGPQRYEGRDLRTAHAGMN----INEQELIATIDDFVAAMQGQGVGTTEINEVVAILYSL--KGDVL.. 117
310 1.000e-28UniRef50_UPI000A05132A globin n=1 Tax=Tsukamurella paurometabola TaxID=2061 RepID=UPI000A05132A  ali  15  100.SFYDAVGGAETFRDLIHRFYLEVAGDELLRPLYPEADLGPAEERLRMFFEQYWGGPRTYSEKRGHPRLRMRHVPFRITELERDAWLRCMDVAIASIGMEPARKQELRAYCEMAAQ....... 217
311 1.000e-28UniRef50_A0A251X8L7 Uncharacterized protein n=1 Tax=Thioflexothrix psekupsii TaxID=1570016 RepID=A0A251X8L7_9GAMM  ali  20  11...YEKIGGEEGVRQLVELFYEKMDTLPEVRTIMHAQDLTGAKRKLFRFLSGWLGGPALYTPHGQPPRLGQKHAPFPIGHAERDQWLLCMQLAMAELQLEPSLQQELMASFTRLA........ 124
312 1.000e-28UniRef50_A0A2E0MJQ5 Group 1 truncated hemoglobin n=2 Tax=Nocardioidaceae TaxID=85015 RepID=A0A2E0MJQ5_PIMSR  ali  31  5..LYDHLGGRDAITVVVGGLYSRLLDDEQIAPTFAGIDMTRLRHHMTLFLSAALGSDAVYAGRDMATAHAGLQ----ITDEMFDRTVAHLVAVLESVPVAPELIAQVLATIAPL--RSEIV.. 117
313 1.000e-28UniRef50_A0A1G6UKC6 Hemoglobin n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1G6UKC6_9ACTN  ali  15  2STFYDEIGGYDTIALIVKTFYEGVATDEVLRPMYPEEDLGPAEGRFRDFLVQYWGGPSTYSEQRGHPRLRMRHAPFAVNPESKDHWLTHFRAGLDAADLTPEQDAQFWDYVTHAAQ--FMVN. 121
314 1.000e-28UniRef50_J9WFZ6 Group 1 truncated hemoglobin n=25 Tax=Actinobacteria TaxID=201174 RepID=J9WFZ6_MYCIP  ali  31  13GTIYDRIGGHEAIEVAVDDFYVRVLADDELAGFFAGTNMNRLKGKQVEFFAAALGGPQPYTGAPMKQVHQGR----GITMHHFGLVAAHLADALAAAGVPPETVTEILGAIAPLA........ 123
315 1.000e-28UniRef50_M1QJU6 Globin n=9 Tax=Bacteria TaxID=2 RepID=M1QJU6_9AQUI  ali  22  23.TLYQELGGYDAISAVTKTLATKLVQDPKLGVYFKGLN-THHKENLTDFLCSVTGGPCIYTGENMEEAHAGL----GITDSDWNRFVKITESVLDEYRVPPKLQKELLERLVPL--KPYIVQK 141
316 1.000e-28UniRef50_A0A2E3P3R5 Group 1 truncated hemoglobin n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A2E3P3R5_9PROT  ali  21  27.SLYAELGGQAGIDRIVDGLLWEIAEDAEIRALFADTDIQRFRNKLAEQLCAVSDGPCVYTGDSMRETHRHL----AVTSAQFNRLVDDLIRVMERERIATGAQNALLQRLAAM--RGDIV.. 140
317 1.000e-28UniRef50_A0A2T0UPJ5 Group 1 truncated hemoglobin n=2 Tax=Glycomyces TaxID=58113 RepID=A0A2T0UPJ5_9ACTN  ali  36  10.SPYDRIGGAPAVTEAVERFYKRLLADDELSGFFSGADMPQLKRHQVALISQVLDGPKSYAGRDLAEAHKSM----DISVGQYKAVGAHLTAVLEELDVPQDIIDTVGEVLASVA--PDVIG. 124
318 1.000e-28UniRef50_A0A1X3PC99 Uncharacterized protein n=1 Tax=Nesterenkonia sp. PF2B19 TaxID=1881858 RepID=A0A1X3PC99_9MICC  ali  15  285.SFFEEVGGHETFQRIVDVFYDQVAEDPDFRAMYPEEDLEPAKRRLLMFLEQYWGGPRTYQAERGHPRLRMRHMPFRVDAQARDTWLRYMRRAVEAADLSPMHEQILWDYLERAAHS--MVN. 403
319 1.000e-28UniRef50_I0YNU1 Uncharacterized protein n=1 Tax=Coccomyxa subellipsoidea (strain C-169) TaxID=574566 RepID=I0YNU1_COCSC  ali  46  27.SLFKKLGGGPAVRAAVDLFYDKMIDDPRVSYFFEGVDMKKQRAHQAAFLTYAMGGSRSYEGNNMTAAHDRLARNMGMRMEHFDVVLEHLEGALRDLQVPE...................... 127
320 2.000e-28UniRef50_A0A290T881 Hemoglobin n=4 Tax=Pseudoalteromonas TaxID=53246 RepID=A0A290T881_9GAMM  ali  21  25.TLYSQLKGEQGLENIVDSFIQHIANDEQIFHYFAKASVSHFRAGFITHLCDVIGGPCEYKGDNMVDIHTGMN----INEADFNRIVELLVKAMEDNNISYPVQNQVLAKLTP--HRAEIIKR 140
321 2.000e-28UniRef50_A0A1M5BH42 Hemoglobin n=2 Tax=Seinonella peptonophila TaxID=112248 RepID=A0A1M5BH42_9BACL  ali  20  6.SLYEQMGGESKLRELVNIFYNKVKVHHSLSHLFPEDFKP---DKQFLFLTEFLGGPAIYSEAFGQKKLKSKHLHFPVTKESADAWLDCMRESMDEVNLHGAIRKEIWSKLEITAY--QMINQ 122
322 2.000e-28UniRef50_A0A2A2FAU7 Group 1 truncated hemoglobin n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A2FAU7_9GAMM  ali  23  30..LYQALGERSGISTIVKDLLGRIADDDRIAPQFKGIDVRRFHRNLTDQLCTLSGGPCTYSGKDMRSVHAGM----GVTETQFNALVEQLIRAMEEEGVPTWAQNQLLAELVPLHDRI..... 141
323 2.000e-28UniRef50_S6GS09 Group 1 truncated hemoglobin n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=S6GS09_9GAMM  ali  26  4.TLFNKYGGFETFSAIASNFYKKVLDSEQIEHYFRDIDINRLISHQTNFLAKALGGPDKYKGRDLALAHANMN----ISSADFNEVVELLEDALEEAGVEDADIAIILSVIGGLKQQIVM... 118
324 2.000e-28UniRef50_Q11P55 Hemoglobin-like protein n=13 Tax=Bacteria TaxID=2 RepID=Q11P55_CYTH3  ali  23  6..LYYRLG-KENLDLLVDRFYDLVFVNDQIAHLFKN-DKEEIKGKQRLFLTQFLGGPALYSEKFGHPQMRARHMPHPITETDAIAWLHCMSQAIGSLPVSEALKDELFARFPPTA--MFMVNK 122
325 2.000e-28UniRef50_A0A0M2HGR7 Group 2 truncated hemoglobin GlbO n=42 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0M2HGR7_9MICO  ali  16  8.SFYDEVGGHDVFVRLVAAFYRGVADDEVLRPMYPEEDLGPAEHRLLMFLEQYWGGPTTYGEQRGHPRLRMRHAGFHVNPDARDRWLQHMRVAVDELDLSPLHEATLWDYLQRAAH--AMVN. 126
326 2.000e-28UniRef50_A0A0K1JLE0 Globin n=64 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0K1JLE0_9MICO  ali  16  4.TFYDQVGGHETFAKLVHEFYRGVAGDPPLRALYPDEDLGPAEQRFLMFLEQYWGGPTTYSEQRGHPRLRMRHMPFAVTPDQRDRWLLHMMAAVDTLDLDESLRDYLTRAAYSLVNQLD.... 125
327 3.000e-28UniRef50_S6AL66 Globin family protein n=35 Tax=Proteobacteria TaxID=1224 RepID=S6AL66_9PROT  ali  16  3.THYERIGGEEVVHKLVDRFYDLMDQDFQGIRELHAKSLKASREKLFMFLSGWLGGPQLYVEKYGHPRLRQRHLPFAIGDTERDQWMNCMIQAMQDLGLEEGLREELKGAFWKTA........ 118
328 3.000e-28UniRef50_Q3SEA1 Group 1 truncated hemoglobin n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=Q3SEA1_PARTE  ali  32  38..FFDQLGGEAAVTAVTTKFYANIQADPTVANFFKGINMADQTNKTASFLCAALGGPKAWGGRNLKDVHANM----GVTNAQFTTVIGHLRSALTSAGVAAALVDQTVAVAETV--RKDVVT. 151
329 3.000e-28UniRef50_A0A2R6EMB5 Group 1 truncated hemoglobin n=3 Tax=unclassified Halobacteriales (miscellaneous) TaxID=38063 RepID=A0A2R6EMB5_9EURY  ali  43  4.TTYQRLGGRDAVEAVVDEFYDRVLADESLAPFFEGVPMARLRAHQVAFLSAVTGGPDDYDGDDMRAVHAHL----DLTGDHFDAVAGHLVDALRACDVPEEDIDTVVTAVEELH--DPVLGR 119
330 3.000e-28UniRef50_A0A291JXZ0 Group 1 truncated hemoglobin n=4 Tax=Halomonas TaxID=2745 RepID=A0A291JXZ0_9GAMM  ali  22  32TTLYERVGGQASLENVVENLLYRIADDADIVGYFANSNIDLFAASLVTQLCDISDGPCQYEGPPMDRAHQTM----GITDAHFNRVVEYLNEAMIEEGIPLAARNDMLGRLAPM......... 141
331 3.000e-28UniRef50_A0A0D6KXJ7 Group 1 truncated hemoglobin n=16 Tax=Nostocales TaxID=1161 RepID=A0A0D6KXJ7_9CYAN  ali  35  4..LYEKIGGQATLDKVVADLHKRIQADSSVNTFFAKTDMAKQRGHFVAFVAQLLEGPKQYAGRPMDKTHTGMN----IQPQHFDVVAKHLSDAMAANGVSADDISAAMARVSNV--KAAILNK 118
332 3.000e-28UniRef50_A0A0C2C5Y8 Globin n=19 Tax=Bacteria TaxID=2 RepID=A0A0C2C5Y8_9BURK  ali  13  20PTAFELVGGEERVRALVDRFYDLMDLEPEFARALHPPTLENSRDKTFWFLCGWMGGPDHYISRFGHPRLRARHLPFAIASSERDQWLRCMAWAMEDIGLAEPLRERLLDTADWMRNRP..... 143
333 3.000e-28UniRef50_Q9CC59 Group 2 truncated hemoglobin GlbO n=384 Tax=root TaxID=1 RepID=TRHBO_MYCLE  ali  18  4.SFYDAIGGAETFKAIVSRFYAQVPEDEILRELYPADDLAGAEERLRMFLEQYWGGPRTYSSQRGHPRLRMRHAPFRITAIERDAWLRCMHTAIDSHTLDNEHRRELLDYLEMAAH....... 121
334 3.000e-28UniRef50_A0A0G2ZUY5 Cyanoglobin like protein n=26 Tax=Bacteria TaxID=2 RepID=A0A0G2ZUY5_9DELT  ali  26  8PSLYERLGGVYAIAAVVDTFIDRIMANPLVDEAHHRVPKAGFKYLVTEMVCQVTGGPQRYTGKTMAESHKHLN----ISASEWVVFAGIFKAVLDEYKVPEAEQAELFAIVGST--RSDIV.. 128
335 3.000e-28UniRef50_A0A1H9X5Z7 Group 1 truncated hemoglobin n=182 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1H9X5Z7_9BACI  ali  54  2ASLYEKLGGKPAIETAVDKFYVKVLADDTVNHFFTETDMDKQREHQTKFLSYALGGPNQYSGTSMEKAHEGMN----IKPEHFNAIAGH.................................. 86
336 3.000e-28UniRef50_G4QFW5 Globin n=13 Tax=Gammaproteobacteria TaxID=1236 RepID=G4QFW5_GLANF  ali  20  46..LYQTLGGKAKIDEIVDNFINEIAFDQETYAFFKDSNMQRFKEKLSEQLCVMAQGPCTYTGDSMEQVHTGMN----ITEANFNHGVDLFINAMDKADIPHNVQNRLLN--EMAKTRKQMLYR 160
337 3.000e-28UniRef50_A0A2G6SS41 Hemoglobin n=1 Tax=Rhodanobacter sp. TND4EH1 TaxID=1907399 RepID=A0A2G6SS41_9GAMM  ali  19  50...FEQFGGKPGLVTLMNDFMDNLMADPRTHTYFADADREHIKVELVDQFCVILDGPCAYTGKDMVKVHRAM----GVNRAAFNALVEDLQTAMDKNNVPFRAQNKLLAKLAPMHT--AIITK 163
338 3.000e-28UniRef50_A0A1Y0ND31 Group 1 truncated hemoglobin GlbN n=3 Tax=Burkholderiales TaxID=80840 RepID=A0A1Y0ND31_9BURK  ali  22  36..LFQALGGKPGLQALMDLFVAGLKADKRIGEQFKDTKASYLSEQLVDQVCMATGGPCKYEGADMKTAHAGM----GITKGNFNALVEVLQASMDARNIPFATQNQLLALLAPMHR--DIIT. 149
339 3.000e-28UniRef50_A0A2M8NVU2 Globin n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A2M8NVU2_9CHLR  ali  19  7.SIYELVGGEDTFRHLVDIFYAKIEADAYLRPMFPE-SLDEGKEWQFLFLCQFFGGPQRYAEERGHPRLRMRHAPFLIDQKARDLWLNHMLNAIDEVNIQSPMREMMRNYFER.......... 117
340 4.000e-28UniRef50_A0A0N0VKS2 Group 1 truncated hemoglobin n=13 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0N0VKS2_9PSED  ali  21  25.SLYRDLGERAGITRIVEGMLLKIAHDPRIAERFRKIDIVRLRNKLVEQFCVEAGGPCVYTGDTMAESHKGQN----VSRSDFNALVEDLIAAMDEQGIPVRVQNRLIARLAPM--RGEVI.. 138
341 4.000e-28UniRef50_A0A0K2BDR2 Hemoglobin-like protein n=112 Tax=root TaxID=1 RepID=A0A0K2BDR2_9BURK  ali  11  9PTVYDMIGGAEKLRAMVDRFYDLMDLEPEFARALHPPSLDGSRDKTYWFLSGWSGGPNLYIERFGHPFLRARHLPFAIGISERDQWLRCMAWAMEDTGLDEALRTRLMQTADWMRNKPE.... 133
342 4.000e-28UniRef50_R4SN91 Antibiotic biosynthesis monooxygenase n=40 Tax=root TaxID=1 RepID=R4SN91_AMYOR  ali  21  5PTLYEWAGGLDALRRLTTVFYGHVLKDPLLEPVFRHMD-PGHPEHVAVWLAEVFGGPETYSGEHGGHRHMGRHLGRAITEEQRRRWVNLLFDAADEAGLPPEFRSAFAAYVEW.......... 119
343 4.000e-28UniRef50_UPI000B5A7231 group 1 truncated hemoglobin n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A7231  ali  29  45PTLYEELGGAAGVDTLTTDFIRKIAADERIKGRYRDSDIGRFHRMMGEQMCLLTGGGCTYTGDDMLRTHAGM----KITRVEFTAIVEALMLAMDKNNIPQGTQNRLLELYAPMHN--DIVDR 161
344 4.000e-28UniRef50_A0A259KZA3 Group 1 truncated hemoglobin n=1 Tax=Idiomarina sp. 34-48-12 TaxID=1970393 RepID=A0A259KZA3_9GAMM  ali  23  23.TLYDELGQKQGISQLMEAFILEIAEDERVIHHFENVDIDRFHRMLSEHICDLSGGPCNYSGESMATVHTGMN----ISRAEFNAIVEHLMTAMDQQQLPVSTQNRLLAILASFH........ 132
345 4.000e-28UniRef50_A0A259GF27 Uncharacterized protein n=3 Tax=unclassified Hydrogenophilales TaxID=1798413 RepID=A0A259GF27_9PROT  ali  24  26.SLYARIGGQPVVAGVVDQLVETVAHDPTVNQSFDKVNLKRLKAKLAEQICALSGGGCVYTGDDMIRVHKGL----RINEREFFSLVEALRGALDSHGVAQREKNELLAILAPMKR....... 136
346 5.000e-28UniRef50_A0A2E2YJB0 Globin n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E2YJB0_9CHLR  ali  21  18..LFSRLGGREIIXDVVEHFYQLVQNNEELRSLFP-SDLSEGKEKQKLFIEQWLGGESRYSDLYGHPRLRRRHFPFMITERLAGLWLRHMIESFRYCGIEEPELAEVIAIFGPMA--KHMVN. 134
347 5.000e-28UniRef50_A0A0K1QCE9 Cyanoglobin n=1 Tax=Labilithrix luteola TaxID=1391654 RepID=A0A0K1QCE9_9DELT  ali  22  49.SLYERLGAKEGIAKVVDSFVKNLQSNDVTKKRFAKLSKDRLRQNLVDQICHETGGDCEYTGKDMKAAHKGM----KITEAEWNATISALKAAMEENSVGETEADDLFALVAPM--KDDIV.. 165
348 5.000e-28UniRef50_A0A259BEN7 Uncharacterized protein n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A259BEN7_9GAMM  ali  25  31...YDAFGQKAGITSIIDDFVGNVAADNRINAYFAHANIPFLKTSLVNQVCEALGGPCKYTG----PAMGPLHHSMGVTQAAFNALTEDLQLSMTKYNVPIPAQNHLIGILAPMS--KDIITK 144
349 5.000e-28UniRef50_Q0SCY3 Uncharacterized protein n=62 Tax=Bacteria TaxID=2 RepID=Q0SCY3_RHOJR  ali  17  7PSLYEWAGGEQSFRRLIDAFYDRVERDDLLSPMFPGGVHEEHRRNVTLWWCEVFGGPPGYTDRGGYERMLRHHIGLGITPEQRHRFAATMSLAADDAKLPPEFRSAFMAYVEW.......... 122
350 5.000e-28UniRef50_K9UL54 Truncated hemoglobin n=4 Tax=Bacteria TaxID=2 RepID=K9UL54_CHAP6  ali  30  9.SLYERLGGVYSIATVVDDFIDRIMVDPRLNEAHHRVSPAGFKYLVTEMSCWAIGGPQQYSGRSMYDAHAHL----KITREEWAAFMEDLDATFDKFNVPQPERAEFIAIIEST--KPDIV.. 128
351 6.000e-28UniRef50_A0A150HEK1 Group 2 truncated hemoglobin GlbO n=51 Tax=Actinobacteria TaxID=201174 RepID=A0A150HEK1_9MICO  ali  17  7.TFYAQVGGHETFVRLVDAFYRGVAADDVLKPMYPEDDLGPAAERLTLFLEQYWGGPTTYSERRGRPRLRMRHMPFHVNPDARDRWLTHMRRAVDELELSPLHEATLWDYLQRAAH--AMVN. 125
352 6.000e-28UniRef50_A6VWA4 Group 1 truncated hemoglobin n=8 Tax=Marinomonas TaxID=28253 RepID=A6VWA4_MARMS  ali  18  28.SLYDEIGGKPTVEAITDNFIDEISFNKDIYRYFEKTNITRFREKFIEHLCVNIGGPCTYTGDTMLKVHQG----QKINETDFNTTVDLLVNAMKKAGLTYPQQNQVLKVLAPM--RGEMLYK 143
353 6.000e-28UniRef50_M2YCJ8 Hemoglobin-like protein HbO n=5 Tax=Micrococcaceae TaxID=1268 RepID=M2YCJ8_9MICC  ali  15  122SSFYDEIGGHETFAKLTREFYARVAEDERFRSMYPEQDLGPAERRLRMFLEQYWGGPSTYSQERGHPRLRMRHMPFTVDTWARDTWLKHMRAAVETLELSPMHEGVLWDYLERAAH....... 237
354 7.000e-28UniRef50_A0A1Z8V7T0 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z8V7T0_9PROT  ali  35  4.SLFEKYGGFATIHKVVEHFYDGVLDNDTLSPYFEGVDMSQLIDHQTRFFASAMGGPASFDDSHLEKSHQGL----GITEEAWDAVVGVLLETLNTFNVEEGDIQSIVGAVGS--KKPLIV.. 117
355 7.000e-28UniRef50_UPI000A03571A group 1 truncated hemoglobin n=1 Tax=Mariniblastus fucicola TaxID=980251 RepID=UPI000A03571A  ali  27  13.TLFDQIGGRPSIEKMVTAFYQRVLSDPILSPFFANVEIEKLQKMQVAFFTIALGGEEPKKMTSLAEVHRGR----GIERQHLTRFTELLIETLEEVGIPEDAAKKVYERIA--KYSGEVLG. 127
356 7.000e-28UniRef50_C1DCX8 Probable oxygen-binding protein n=2 Tax=Laribacter hongkongensis TaxID=168471 RepID=C1DCX8_LARHH  ali  22  9GTLYELLGGESGVWLLVDRFYNVMDSDPRVAPLRHPPDLESSRQKLFMFLSGWTGGPDLFVQAFGHPRLRMRHMPFSVDESMRDQWMLCMGEALDGLELEDTLRQRLWDLADFMRNR...... 131
357 7.000e-28UniRef50_A0A0F2NT54 Uncharacterized protein n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0F2NT54_9GAMM  ali  22  31..LYQRLGGEQGIEALVYDLLVEIAADERIVERFRDVNIPRFRQGLESYICSISGGPCEYSGESMQVVHAG----HGYTDVEFNALVDDLIRAMEKRQLPVATQNRLLALLAPSYR--DIVYQ 145
358 7.000e-28UniRef50_A0A0Q6B723 Globin n=3 Tax=Methylophilus TaxID=16 RepID=A0A0Q6B723_9PROT  ali  23  24ATLFQRIGGLPMLSRLSNQTLDIVSKDPRTSRSFEGVKMKTLKESVTNFLCVKTGGNCVYEGETMKKSHADLHN----TVAEFEIMVDVLRERMDANGVGTREKNELLRILAPMKY--DVVT. 139
359 7.000e-28UniRef50_G5ZYB7 Truncated hemoglobin n=1 Tax=SAR116 cluster alpha proteobacterium HIMB100 TaxID=909943 RepID=G5ZYB7_9PROT  ali  31  2.SLFEKYGGFATVSKLVSELYEELSQNEITAPYFENSNMTSLMDHQVKFLSQALGGPEQYTGQAMNAAHTGL----KITEAAFTEVAKTIQFILEDNGVEDEDVDQIMALLGSL--KDDVV.. 115
360 7.000e-28UniRef50_A0A261GNC7 Group 1 truncated hemoglobin n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A261GNC7_9GAMM  ali  29  3TSLYERLGGTEGITKIVSDLVDIHLENPRISTRFENIDQNALKHAAATFFITGSGGPNVYEGKDMLAAHKGMN----IDSGEFMAVLDDALKALEKNGVGQREQEEVLYILYSM--RSDVMY. 118
361 7.000e-28UniRef50_A0A095H175 Bacterial-like globin family protein n=543 Tax=Bacteria TaxID=2 RepID=A0A095H175_BURPE  ali  15  12PTAFELVGGEARVRELVDRFYDLMDLEPEFARALHPPTLEGSRDKLFWFLCGWLGGPDHYIERFGHPRLRARHLPFPIASSERDQWLRCIAWAMQDVGLDEPLRERLMDTADWMRNRP..... 135
362 8.000e-28UniRef50_A0A1Y5PLI7 Group 2 truncated hemoglobin GlbO n=87 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y5PLI7_9MYCO  ali  14  26.TFYDAVGGAETFRKIVSRFYELVREDEVLLPLYPPDELDDAEDRLRMFLEQYWGGPRTYGEQRGHPRLRMRHAPFRIGFLERDAWLRCMHTAIDSATLDDEHRSELLAYLEMAAQS--MVN. 147
363 8.000e-28UniRef50_F4QLX8 Bacterial-like globin family protein n=5 Tax=Asticcacaulis TaxID=76890 RepID=F4QLX8_9CAUL  ali  24  38.SLYREFGGHDGLVKLVDDFMVILLDDPRTSVFFVDAKQDHIKKMLVEQFCVVLNGGCTYTGKGMKESHAQL----GIDRASFNALVEDLQKAMDKNDIPFHAQNKLLAALAP-QHR-DIVT. 152
364 8.000e-28UniRef50_P0A596 Group 2 truncated hemoglobin GlbO n=80 Tax=root TaxID=1 RepID=TRHBO_MYCBO  ali  19  4.SFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDLDDEHRRELLDYLEMAAH....... 121
365 8.000e-28UniRef50_A0A2M8CZV2 Group 1 truncated hemoglobin n=1 Tax=Alphaproteobacteria bacterium CG_4_9_14_3_um_filter_47_13 TaxID=1973899 RepID=A0A2M8CZV2_9PR  ali  38  7.TLFERIGGEFTINAVVDEFYDRVLNDDRINYFFDNISMDMQIRKLKVFLKLAFEEQKTYPSFEMRKAHAPLV-ERGLNDTHIDILLEHMTQTLKIHKVPLDVIEETINKIE--KYRDDVLNR 125
366 8.000e-28UniRef50_UPI0004725605 group 1 truncated hemoglobin n=2 Tax=Kordiimonas TaxID=288021 RepID=UPI0004725605  ali  38  8.SLYEQIGGKAAVDQAVVLFHAKMMADPLLNRFFDHISQDDYYRKQSWFLTTVLKGESIGAESYMRMSHKTLVRKHGLNETHFDAVASHLQSSLEDLGLEAEKVAEIVAAAASL--KDAVLNR 127
367 1.000e-27UniRef50_A0A254NDF1 Group 1 truncated hemoglobin n=1 Tax=Pelomonas puraquae TaxID=431059 RepID=A0A254NDF1_9BURK  ali  20  31.SVYRAWGEKAGIQAVMQDFVTRLQADARMAPFFKNANREHLVTQLTEQLCQQSGGPCTYKGVPMKEAHESM----DIGRRDFNALVEVLQQSMEAKGIPFAAQNAMLARLAPMYR--DIINR 146
368 1.000e-27UniRef50_A0A257XFT5 Group 1 truncated hemoglobin n=1 Tax=Methyloversatilis sp. 12-65-5 TaxID=1970398 RepID=A0A257XFT5_9PROT  ali  24  27.TLYQRLGGEPGIERIVSDFVDRFTTDPRTRDALDGIRVTHLKQSITQFICLVADGPNGYEGLDMKKTH----EDAPVTEVQFDSVVEMMRDALDKH-VSTAEKNELLRRLAPMKR--DIV.. 139
369 1.000e-27UniRef50_A0A2E5JUI1 Globin n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E5JUI1_9CHLR  ali  16  14GSVYNRVGGLIFFTDLVEKFYNIVENDPLLRPMYPE-NLTPGKEHLAGFLAQYWGGPMEYTQMRGHPRLRMRHSPFTIGKKERDRWVSHMLSALDVMEISTEDKRLIKEYFENTA........ 127
370 1.000e-27UniRef50_F4P5H7 Uncharacterized protein n=5 Tax=Fungi incertae sedis TaxID=112252 RepID=F4P5H7_BATDJ  ali  42  2ATLLDQVGGEDAVGAVVEIFYDNLVKDERVNSFFVNTNMARQRRMQKMFLLHVLGG-REYNGSSMVKAHAKLN----LKDEHFDAVIEVLTDALKTAGVADPLVKSIIDAAETT--RDAVLGR 117
371 1.000e-27UniRef50_A0A0J6VC89 Hemoglobin GlbO, group 2 n=176 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0J6VC89_9MYCO  ali  14  5.SFYDAVGGHETFRTIVSRFYQQVRDDEILRPLYPEDELDAAEERLLLFLEQYWGGPRTYSEQRGHPRLRMRHAPFRIGYLERDAWLRCMHTAVAEIDLDDAHRQELIAYLEMAAQS--MVN. 126
372 1.000e-27UniRef50_H0RI29 2-on-2 hemoglobin n=48 Tax=Actinobacteria TaxID=201174 RepID=H0RI29_9ACTN  ali  14  14.SFYDEVGGADTFARLTHTFYSEVAKDEILRPLYPEEDLGPAERRLRMFLEQYWGGPRTYSEERGHPRLRMRHHPYKIGPIERDAWLRCMHTAIAEIDLDDEHRRALTDYMEMAAQS--MVN. 135
373 1.000e-27UniRef50_A0A1I7GEF0 Hemoglobin n=3 Tax=Alicyclobacillus TaxID=29330 RepID=A0A1I7GEF0_9BACL  ali  25  6.TLYDWAGGDETIRRLVEVFYSKVPQDEDLAPLFPE-DLSEVRHKQHLFLTQFFGGPPLFSQAYGAPMLRARHLKVRITRRHARAWLRRMGESLQEVGIQGPLYDVMMERLTRTA--IHMVN. 123
374 1.000e-27UniRef50_A0A250L0G4 Oxygen-binding protein n=27 Tax=Proteobacteria TaxID=1224 RepID=A0A250L0G4_9GAMM  ali  21  22...YRRIGGEEAVRRLVERFYQLMDELPEARRAMHPTDLTSSKEKLFLFLSGWLGGPPLYAERLGPPRLRQKHLPFPIDTAARDAWMACMNRALSELVSDTELRAQLSA.............. 129
375 1.000e-27UniRef50_UPI000DAE22D4 group 1 truncated hemoglobin n=1 Tax=Marinobacter bohaiensis TaxID=2201898 RepID=UPI000DAE22D4  ali  26  28.TLYQDLGERTGIANIVRDLLYVVVEDERIAETFRGVDIASLHRNLTDQICYLANGPCTYSGRSMEASHAGL----GIDETDFNALAEDLILAMEQNDVPVSAQNRLLKRLVPLH--DEIV.. 141
376 1.000e-27UniRef50_A0A2A2A2C5 Uncharacterized protein n=12 Tax=Corynebacterium TaxID=1716 RepID=A0A2A2A2C5_9CORY  ali  16  9.SLYDALG-ADFFQRLVEGFYNQVKEDDLIGPMYPDQDWDGAQDRLRWFLVQYWGGPRTYQEKRGNPMLRRRHFPFPIGEPEADRWLHLMENSLNQFELPEAYRFALWNHMQRVAY--MMINQ 130
377 1.000e-27UniRef50_A0A2D5B4V7 Hemoglobin-like protein n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2D5B4V7_9BACT  ali  14  17.TPYDAVGGDAVVRSLADAFYGFMDSNPAYKRALHGPDLGPMQVTFYEFLSGWLGGPQLYVQKHGHPRLRMRHARFPIDESMRDQWLSCMGEAMDQLGIEGDIRAFLDARFAHVA........ 132
378 1.000e-27UniRef50_A0A0J6W320 Group 2 truncated hemoglobin GlbO n=246 Tax=Bacteria TaxID=2 RepID=A0A0J6W320_9MYCO  ali  14  5.SFYDAVGGHETFQRIVSRFYEQVRDDEILRPLYPEDELEAAEERLLLFLEQYWGGPRTYSEQRGHPRLRMRHAPFRIGYLERDAWLRCMHTAVAEIDLDDAHRGELLAYLEMAAQS--MVN. 126
379 1.000e-27UniRef50_A0A0K6GXA7 Group 1 truncated hemoglobin n=4 Tax=Idiomarina TaxID=135575 RepID=A0A0K6GXA7_9GAMM  ali  27  34TALYDDLGGHDGIRQMMETFVLNIAEDERVVHHFVNADIERFHTQISEHICELSGGPCIYKGASMPEVHKGMN----ISRAEFNAIVENLITAMETHDVAVSTQNRLLAILAAMHN--DVIQR 150
380 1.000e-27UniRef50_A0A1E7ZGF1 Globin n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E7ZGF1_9ALTE  ali  19  1......MGGEAKVTEIVNNFVTEVEQEPVILAYFEGSDIDRFIAKFEEQICMVSGGGCQYTGDTMEQVHGGMN----ISEKDFNLTVDLLINAMDKANVPHPLQNRLLNKLAPM--RSQMLYR 111
381 1.000e-27UniRef50_I2GPJ4 Hemoglobin n=5 Tax=Cytophagaceae TaxID=89373 RepID=I2GPJ4_9BACT  ali  26  33.TLYERLGGKNAISAVVDQFIANVAADPKMKRTFQPARVTSLRNNLIDQIGQASGGPEKYMGKDMVTAHKGM----KITDDEFNSLVADLVASLNKFSVPSKEQGELLSVLGGL--KGQIVNQ 158
382 1.000e-27UniRef50_C7NZ91 Globin n=13 Tax=Halobacteria TaxID=183963 RepID=C7NZ91_HALMD  ali  30  4GTLYERLGEREGIRAVVDDFYDRLIADEQLGPFFADADMELLRRTQTDFLCEAAGGPETYDAVPVREAH----IDVPFEPTHIERAIELLEASLDAFDVP....................... 99
383 2.000e-27UniRef50_B2IV60 Globin n=5 Tax=Cyanobacteria TaxID=1117 RepID=B2IV60_NOSP7  ali  23  57SSLYKRLGGYNAIAAVIDDSAKNIFADPLIGKYFIGLSKQRLRELLIAQFCQAAGGPCIYTGRTMKLSHSGI--GRGLTNGEFYAFVNDIALALDKNGVKQPEKNQVLGFANSL--RDQIVEK 178
384 2.000e-27UniRef50_W0MSL1 Group 1 truncated hemoglobin n=51 Tax=root TaxID=1 RepID=W0MSL1_PSESX  ali  25  25.SLYQDLGQRAGIQRVVEGMLINVARDARISEHFKRVNIVLLRDRLVEKLCVEAGGPCRYAGDSMAESHKGQN----LTPSDFNALVENLIASMDAENIPVPVQNRLIARLAPM--RGEVIGK 140
385 2.000e-27UniRef50_I0YPV1 UPF0187-domain-containing protein n=1 Tax=Coccomyxa subellipsoidea (strain C-169) TaxID=574566 RepID=I0YPV1_COCSC  ali  44  423..LYDKLGGQPAVMAAVEIFYKKLLGDVRVARFFNNISIERLK---VRFLTYALGGADEYVGKDPTISHRRLHNEKGLGVQHFYVVVGHLQDTLRELGVSEDLIGETTAVLAPM......... 531
386 2.000e-27UniRef50_A0A143BLJ2 Globin n=89 Tax=Bacteria TaxID=2 RepID=A0A143BLJ2_9BACT  ali  11  3.THFEQLGGESGIRALVDRFYDLMDTAPEAARALHAANLKVSREKLFLFLCGWTGGPQHYVEKYGHPRLRMRHFPFAIGAQERDEWLWCMDHALAGHDAPDELRQKLQQLADHMRNQPE.... 126
387 2.000e-27UniRef50_H8MMA3 Putative methyl-accepting chemotaxis protein n=1 Tax=Corallococcus coralloides (strain ATCC 25202 / DSM 2259 / NBRC 100086 / M2) TaxI  ali  34  11TTLFQRLGGKAPLTAAVQKLYARVTTDALLKPYFRRADLVEIQRQMIAFLTRYLGGPGVYKGPSMRDVHARL----ALKPHHFERVAEHLATVLDEMDVSGPVAREVLAAVGT--PRGDSVSR 127
388 2.000e-27UniRef50_A0A068D262 Bacterial-like globin family protein n=98 Tax=Bacteria TaxID=2 RepID=A0A068D262_9RHIZ  ali  20  6PTLYEWAGGSDALNRLTQTFYDKVAKDPVVGPVFKTMSPD-HPAHVAAFIGEVFGGPKIYSEKGGHREMVMHHLGKHLTEEQRRRWINLLADAADEVGLPPEFRSAFMGYVEW.......... 120
389 2.000e-27UniRef50_UPI0008373935 group 1 truncated hemoglobin n=1 Tax=Rubripirellula obstinata TaxID=406547 RepID=UPI0008373935  ali  25  8..LFERLGGAEGVQVIINEMYDRVLRDDTLAPFFTGVPMERLRRMQYQFIASALDGPVEYTGAELNAIHRGR----GITAKHFAKFCGHFADAVEARGASKEEIDQCLGRLATYKDKI..... 119
390 2.000e-27UniRef50_G2IXT1 Globin n=178 Tax=root TaxID=1 RepID=G2IXT1_PSEUL  ali  15  5.TPFQLLGGAGVVRWLTDRFYDIMDSDPSVKALMHPADLTESRDKLYMFLSGWLGGPSLYIEKYGHPRLRARHMPFPVDSAARDQWMSCMSRAIADLVVEEALKEKLLEAF............ 116
391 2.000e-27UniRef50_A0A257LNY8 Group 1 truncated hemoglobin n=2 Tax=unclassified Burkholderiales TaxID=119065 RepID=A0A257LNY8_9BURK  ali  22  46PGLLADFGGATGLAQISHRLVEAARADPRIGHHFEKTKLPELKKQLADQFCQVLAGPCVYEGDTMKASHADL----AISRADFLALVELLQDAMQAQGVPFRAQNQLLARLAPMHR--DIITR 162
392 2.000e-27UniRef50_A0A1Y6EMM5 Hemoglobin n=2 Tax=Idiomarina planktonica TaxID=1323738 RepID=A0A1Y6EMM5_9GAMM  ali  22  25.SLYQELGGKEGISNVMAEMLYELAGDDRIADQFADTDIDRLHQMLTEQVCEISGGPCTYTGEDMVKIHTGLN----ITNADFNALVENLIIAMEREEIPTTAQNRLLSLLADMHH--EVVG. 139
393 2.000e-27UniRef50_E0TBW6 Protozoan/cyanobacterial globin family protein n=3 Tax=Proteobacteria TaxID=1224 RepID=E0TBW6_PARBH  ali  24  29..LYRALGEKAGIERVIETLLHRSLADPRIADTFEGANFERLEEKLVLQICELAGGPCVYDGLSMADSHMG----QELTTAHFNALVENLRAAMAAEGVGFRAQNRLLALLAPMHR--DVVTK 143
394 2.000e-27UniRef50_A0A1W9G501 Globin n=1 Tax=Nitrospira sp. SG-bin1 TaxID=1827376 RepID=A0A1W9G501_9BACT  ali  18  13.TPYEAAGGIEGITKLVDEFYVNMLQEAKIIRNMHPPDLTDARKKLTYFLCGWLGGPRLFQQHYGPISIPGAHKRFPIGYEERDAWLLCMQRALAVQPYSAELKDYLLAALSIPAERVRQVN. 135
395 2.000e-27UniRef50_A0A1E3CET5 Cyanoglobin n=5 Tax=root TaxID=1 RepID=A0A1E3CET5_9ALTE  ali  28  33ASLYQQLGEREGIANVVEDLLYLIVEDDRINQQFKGMDVAQFHHNLTDQLCELSGGPCTYTGREMRE----LHSDMAITDTQFNALAENLILAMEQNDIPTGAQNRLIKRLLPLY--PDI... 146
396 2.000e-27UniRef50_A0A1B4XJE0 Globin n=3 Tax=Bacteria TaxID=2 RepID=A0A1B4XJE0_9GAMM  ali  21  4.TLYERLGGIEGITRLVDDAVDAHFANPLIKTRFENTDVERAKRMSVEFFCAGSGGPQAYTGKDLVTAHKGMN----ISEQEFIAAVDDILSAMDKNNLGDDVKKDVLGVLYSL--KGQII.. 118
397 2.000e-27UniRef50_A0A075APV3 Globin-like domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075APV3_9FUNG  ali  35  286GTLYEEIGGAETVSAVVDYFYSLLIKDKRVKKYFESIDLDRLKIMQKSFISSVCGGPA-YNGQSMRSAHKRL---LDLENKHFDAILENLETAMKKAAISEENRKKILAVAETT--RKDVLGK 405
398 2.000e-27UniRef50_A0A0N9HME2 Uncharacterized protein n=5 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A0N9HME2_9PSEU  ali  22  80PTLYEWAGGAEAFEKLFTAFYANVAQDPVLAPVFAHMD-PNHPKHVAAWLGEIFGGPEIYSERHGHQHMVSRHLGRALTETHRRRWVNLLIDTADEVGLPAEFRSAFVGYLEW.......... 194
399 3.000e-27UniRef50_Q7UFG6 Hemoglobin-like protein HbN n=13 Tax=Rhodopirellula TaxID=265488 RepID=Q7UFG6_RHOBA  ali  30  8..LLDQLGGMDGVRRVVDEMYVRVLADPELTHFFDGVPIEKLARMQTEFIASITSGDIQYTGADLTKVHAGR----GITGVHFSKFCGHLTDALEANNVSSHAIDQVLGKLA........... 113
400 3.000e-27UniRef50_A0A1I6IGK4 Hemoglobin n=1 Tax=Marinobacter daqiaonensis TaxID=650891 RepID=A0A1I6IGK4_9ALTE  ali  24  29STLYQGLGERSGIAKIVEDLLYRIVEDDRIAPQFKGIDVVQFHTNLTDQICEISGGPCTYTGRAMTEVHEGMN----VTETQFNALAEQLILAMEENQVSTSAQNRLLGRLVELH--PDITHR 145
401 3.000e-27UniRef50_UPI000D72582E hemoglobin n=3 Tax=Micrococcaceae TaxID=1268 RepID=UPI000D72582E  ali  12  201.SFYDQVGGHETFAKLARVFYEQVATDPEFRALYPEEDLGPAEARLRMFLEQYWGGPTTYSQQRGHPRLRKRHMPFEIGPQERDTWLKYMKVAVKSLDLAPLQEETLWDYLERAAHAMQ.... 318
402 3.000e-27UniRef50_A0A1Q8CU46 Antibiotic biosynthesis monooxygenase n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q8CU46_9PSEU  ali  25  105PTLYEWAGGAAAFEKLTEVFYRTVLADPELEPVFRGMD-PGHPRHVAAWLGEVLGGPDRYSERGGHANMVAQHLGRAITERQRRRWVELLIDAADEVGLPPEFRASFVGYLEWGTRMAVMLSR 229
403 3.000e-27UniRef50_A0A1F2QNL0 Uncharacterized protein n=15 Tax=Bacteria TaxID=2 RepID=A0A1F2QNL0_9BACT  ali  25  32.SLYERLGGVYSIAAVVDDFIERIFANPNIYKARSELRKAGLKVHVVNMVCAVTGGPCEYTGLDMKTAHKDFH----ITQKEWDALVVDFEATLDKFKVPAAEQQELIAIVATT--KPDIV.. 151
404 3.000e-27UniRef50_A0A257DE33 Group 1 truncated hemoglobin n=1 Tax=Burkholderiales bacterium PBB1 TaxID=2015563 RepID=A0A257DE33_9BURK  ali  20  58.SLYQALGGHDGLVKIAAEFHHRLLANPQLGPYFRDIDAKQYQERLVIQFCEVSGGPCKQAKHDMRKVHSAM----DINKATFNATVEVLQQSLDAQGVGYRTQNRLLAQLAPMHR--DIVN. 172
405 3.000e-27UniRef50_A3JBC8 Cyanoglobin family protein n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A3JBC8_9ALTE  ali  28  34.SLYLQLGERAGIADVVEDLLYLIVDDTRISHQFKGINVAQFHRHLTDQLCELSGGPCEYAGREMRESHAAM----GITNTQFNALVENLILAMEENDVPTAAQNRLIKKLLPMY--PDI... 146
406 4.000e-27UniRef50_A0A2E0VHS3 Group 1 truncated hemoglobin n=31 Tax=Bacteria TaxID=2 RepID=A0A2E0VHS3_9GAMM  ali  23  37PTLYQRLGGLPAIAVVVDDLLDAVVPDPLLNPAIAAARLPYLKYHVTAMVCQASGGPCTYIGGGMKESHAHLN----ITEAEWDRFVTIFKGILASHSVPEQEAAELLDIVEST--RGDIV.. 157
407 4.000e-27UniRef50_D0L0N5 Globin n=4 Tax=Halothiobacillus TaxID=109262 RepID=D0L0N5_HALNC  ali  24  33...YEEFGQKQGIANIINDFVGVVAADNRINSYFAHANIPALKAALTNQVCEALGGPCKYTG----PAMGPLHHSMGVTQAAFNALTEDLIVAMDQHHVSVPAQNHLIKILAPMS--SDIITK 146
408 4.000e-27UniRef50_A0A2J8AG44 Group 1 truncated hemoglobin glbN n=1 Tax=Tetrabaena socialis TaxID=47790 RepID=A0A2J8AG44_9CHLO  ali  44  12PTLYDRLGGAAAVDAAVDIFYGKLMADAVIAPFFEGIDMKKQRRKQVAFMSYVFGGADGYQGRDLGIAHKRLILEKGLNEGHFDMVANHLAETLRSLNVPTDLLNEAMAVVET--ARPAIFGQ 132
409 4.000e-27UniRef50_W7VVG7 Hemoglobin-like protein YjbI n=144 Tax=root TaxID=1 RepID=W7VVG7_9BURK  ali  17  26ATPYEWVGGEHAVRALVDRFYDLMDLEPDLRRL-HPSTLDGSRDKLFWFLCGWLGGPDLYVERFGHPRLRARHLPYSIGVRERDQWMACMEQAMHECELDPLLVSRL................ 134
410 4.000e-27UniRef50_UPI000D6AB4C5 group 1 truncated hemoglobin n=1 Tax=Pleionea mediterranea TaxID=523701 RepID=UPI000D6AB4C5  ali  24  37...YKAFGEKAGIKKIVDDMFVVILKDPRIKTFFAETDNEYIKQQLTDQFCDQLNGPCEYTGVDMKSSHVGLN----IGRQHFNALVEALRISMDQNNVPFRMQNQLLVKLAPMH--KDII.. 148
411 4.000e-27UniRef50_A0A2A4X7H6 Group 1 truncated hemoglobin n=39 Tax=Bacteria TaxID=2 RepID=A0A2A4X7H6_9GAMM  ali  26  3TTLYERLGGTEGITNIANDLVDIHLANPAIAPRYSNSDPVKVKNGAATFFIAGTGGPNVYEGQDMLATHKGMN----ISAHEFMAVLDDALEALEKNNIGQREQEEVLFIFYSM--RSDIV.. 117
412 4.000e-27UniRef50_A0A0C1JCF8 Globin n=2 Tax=Ruegeria TaxID=97050 RepID=A0A0C1JCF8_9RHOB  ali  30  5.TLYEKYGGFSKISKIVISFYDTLLDNDEVGPFFDNVDMSRMVDHQTKFIASLLGGPASYTDN----QLRQLHSHLDITNTHFDELETVLQDALQKHNVAEEDIAVV--IAEFGKRRPLIV.. 118
413 4.000e-27UniRef50_A0A2A4VJ79 Hemoglobin-like protein n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A2A4VJ79_9PROT  ali  16  13STFYELLGGEETIRELVETFYDIMDSDPKAARAIHKPDLTEAREKLFMFLTGWTGGPQLYMERYGHPRLRARHMPFSIGESERDQWMYCMISAMHKIGIVEPLATQLHGVADFMRNK...... 139
414 4.000e-27UniRef50_A0A249KHF1 Hemoglobin n=26 Tax=root TaxID=1 RepID=A0A249KHF1_9ACTN  ali  16  9...YELFGGEAFFSDLTSQFYAHVATNEILRPMYPESDMKGAARRLQMFLEQYWGGPTTYQEERGHPRLRMRHAGFHINPAARDAWMSCMKAAVDGMNMEAEAKAKLWRYLEGAA--EHLVNR 126
415 5.000e-27UniRef50_A0A0B5FAH4 Cyanoglobin n=42 Tax=Proteobacteria TaxID=1224 RepID=A0A0B5FAH4_9BURK  ali  14  23PTAFSLLGGEDRVRELVDRFYDLMDLESEFARRLHPESLGDSRDKLFWFLCGWLGGPNHYIERFGHPMLRARHLPFPIATSERDQWLRCMAWAMQDIGVEVSLQERLMQAADWMRNRA..... 146
416 5.000e-27UniRef50_A0A0U2ZJW3 Globin n=3 Tax=Lacimicrobium alkaliphilum TaxID=1526571 RepID=A0A0U2ZJW3_9ALTE  ali  17  24PDLYEEIGGSATLSKVFGLAINRIYNDPMLGPHFEGVPKSHLRKMLTEQTCALIGGPCEYTGKDMRESHQERN----VTEAEFYALVEHVQQAMRLIGLTYQQENRILAALAPL--KEDIIYQ 140
417 5.000e-27UniRef50_UPI00098D32D7 group III truncated hemoglobin n=1 Tax=Spirosoma sp. 209 TaxID=1955701 RepID=UPI00098D32D7  ali  24  15.........KADIAHLLDRFYERVRQDPDLGYIFAHVNWPDHLPRINAFWTNLLGGDGSYQGNPMR-AHVDLARKTPITPAHFDRWLALFTQTLTDCFAGERAREALLRIAAVMQSR...... 128
418 5.000e-27UniRef50_A0A257IUG6 Hemin transporter n=7 Tax=Bacteria TaxID=2 RepID=A0A257IUG6_9BACT  ali  28  30PTLYERLGGVNAISAVVDEFIGRVAANPDMVRTFQPPKLIALRQNLIDQIGEASGGPQKYMGKDMVTAHKGMM----ITEVEFNSLAGNLSGALDKFSVPATEKNELLTVIGSL--KPSIVGK 158
419 5.000e-27UniRef50_A0A1I3MUE1 Hemoglobin n=2 Tax=Thermoflavimicrobium TaxID=292636 RepID=A0A1I3MUE1_9BACL  ali  29  8.SLYEKLGGRAAVEAVISDFLNELLSDDRVSYHFVGVDIERLQKNKFKFFAELFGGPIKYTGETLRNAHKGLN----ISSEEYDVFLAHLRSVLRKHGIPLQDIAKMDALIRSF--KPHIINK 124
420 5.000e-27UniRef50_B2GG22 2-on-2 hemoglobin n=78 Tax=Actinobacteria TaxID=201174 RepID=B2GG22_KOCRD  ali  15  15.SFYAQVGGHATFEKLTREFYARVAEDPDFKALYPEQDLGPAEERLRMFLEQYWGGPTTYSEQRGHPRLRMRHAPFPVDTWARETWLAHMRAAMDTLELSPLHDGIMWDYFDRAAH--AMVNR 134
421 6.000e-27UniRef50_A0A2S0V008 Group 1 truncated hemoglobin n=1 Tax=Colwellia sp. Arc7-D TaxID=2161872 RepID=A0A2S0V008_9GAMM  ali  18  35PSLYQQIGQKPAIDKIIDNLVNIIGQDEVVFAHFAQSNVTNFKEKLSVYLCHITDGPCQYNGDTMQDIHRGMY----IDTNQFNHFVELFISAMDEANISYPIQNQLLARLAPLR........ 145
422 6.000e-27UniRef50_A0A150GRI3 Uncharacterized protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150GRI3_GONPE  ali  28  43GSLLQRVGGLDVVRKVVELFYKKLYADPRLILFLHDQDVMHLRAKQSAFVSWLFGPPNPYVGRSVRIAHLRIIKQRGFTPEDFDLGMKYFEEAMKDLGAPEALMGEVMRRMWPFK........ 158
423 6.000e-27UniRef50_A0A075HBB7 Globin (GlbN) n=4 Tax=cellular organisms TaxID=131567 RepID=A0A075HBB7_9ARCH  ali  17  18...YDRVGGETFFYNLIDKFYEYIEADEILRPMYPE-DLAPGKSHLSKFLIQFWGGPKKYSEERGHPRLRNRHIDFAISQKERDIWVNHMFSALESMEISKTDLKIMKSYFEKTA........ 128
424 6.000e-27UniRef50_UPI0003B74819 globin n=1 Tax=Yaniella halotolerans TaxID=225453 RepID=UPI0003B74819  ali  13  233TSFYDQVGGEPTFTKLVHEFYQQVEADPEFKAMYPEDDLGPAEERLRLFLIQYWGGPSDYSQLRGHPRLRARHMPFHIDAKARETWLRFMRNAMDTLDLAPLHYDTMWDYFQRAARAMQ.... 351
425 6.000e-27UniRef50_M7MPZ5 Globin n=16 Tax=Micrococcales TaxID=85006 RepID=M7MPZ5_9MICC  ali  15  70GTFYAQVGGRETFRKLAEAFYESVGADMEFRAMYPEQDLRPATMRLQLFLEQYWGGPKTYSERRGHPRLRMRHVPYTINSHNRDVWLKHMRIAVDSLELPPLLEETLWDYFDRAAH....... 185
426 6.000e-27UniRef50_A0A1R2BJK0 Uncharacterized protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2BJK0_9CILI  ali  34  4.SMFERVGGTPALQELFTRFYAKVLADPIAAPYFKGFDMNDIKGLQIEFWSNFLGSGVPYTGRDMYESHKTL----GCSGASFDVVANSLASTLKELNVPEDIYEAIMNHAASF--RKDIV.. 117
427 7.000e-27UniRef50_A0A1E3GS08 Group 2 truncated hemoglobin YjbI n=58 Tax=root TaxID=1 RepID=A0A1E3GS08_9GAMM  ali  14  18ATPYERIGGETAVRKLCHTFYKIMCETPEVIRGLHPQNIQISEDKLFMFLSGWLGGPSLYIEKYGHPRLRARHLPFSIGIEERDQWLYCMAQALKTMDLEPLFAEQLMQTADFMRNRQE.... 142
428 7.000e-27UniRef50_K0CA27 Uncharacterized protein n=5 Tax=Piscirickettsiaceae TaxID=135616 RepID=K0CA27_CYCSP  ali  13  12TTMYDWIGGEEGVRKLVNRFYDIMDSDEEAKRAMHKDDLTNIRDGLFEYLSGWLGGPPLYVAKHGSPCITKQHKPFKIDQQASNAWMHCMQQAMKDVDIDKKYRDMLTPAFQRI......... 127
429 7.000e-27UniRef50_A0A068T514 Oxygen-binding heme protein n=53 Tax=Bacteria TaxID=2 RepID=A0A068T514_RHIGA  ali  22  4PTLYEWIGGFDALLRLTTEFYRRVPADDLLGPVFAGMDKN-HPEHVAMFIAEVIGGPKLYSERGGHPAMVRHHLERHLTEPMRRRWINILLDTYTDLELPPEFTSALVGYLEW-GTRLAVVN. 126
430 7.000e-27UniRef50_F8EAH9 Globin n=6 Tax=Bacteroidetes TaxID=976 RepID=F8EAH9_RUNSL  ali  24  8.........REDVELMVNQFYQKIRQDAELGHIFEDVDWDLHLPKMYDFWEGILLGTANYAGRPMPP-HFRLTAKYTLTPEHFDRWLHLFFENVDALFEGETAADRAYSIATVMNQRVQQVN. 125
431 7.000e-27UniRef50_UPI000648A1F8 group 1 truncated hemoglobin n=1 Tax=Mesorhizobium sp. F7 TaxID=1574409 RepID=UPI000648A1F8  ali  23  2.TLFERLGGAEGVRRVVDELTTRLEADPGLAPLFAGVDGDGLRRHRERYLAAVLGGPEQYTGRGLREAHR----PLGIDDAQFDRFLGLVLESARAVGTAPGAADELAAFLRGL--RPVIV.. 115
432 8.000e-27UniRef50_A0A2T5T7B2 Truncated hemoglobin YjbI n=10 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A2T5T7B2_9BURK  ali  22  29.STYQGLGGKEGIRKITDTFVALITSDPRIKETFADFDMPQLNVRLQEQFCEYAGGPCKYAGRDMKSVHIDLN----ISNAQFNALAEDLQIAMERHGVPASVSNKLIAKLAPMQR--DIVT. 156
433 8.000e-27UniRef50_A0A2R5F6C2 Hemoglobin n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A2R5F6C2_9PROT  ali  19  13ANLYNLVGGENGIRRLVETFYDIVEQHPEGEPHLRGHGIAHSRVEQFNFLSGFLGGPNLYAEKYGHSNVRTMHEHVEINAKAKDAWLVCMDMAIDEVGLGPDVKSKLMAVAELLVNRND.... 139
434 8.000e-27UniRef50_A0A0N1BYQ4 Uncharacterized protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0N1BYQ4_9PROT  ali  18  31.......GGKAGIDRLATDFVTRMEQDAKIGAFFKDSNPERLRKMLADQFCAELSGPCTYTGQTMQQSHAR----FEIRREHFNRLVEILQDTMNVQGVPFWAQNKLLAKLAPMAR....... 135
435 8.000e-27UniRef50_A0A2E9TED0 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E9TED0_9CHLR  ali  21  47..LFVELGGRENVEKVVDRFYDRIDDDLELRPIFP-ASMAVGRARQKLFLEEWLGGEPRYTTDVGPWQLRRRHAPFRVTEEGASRWIGHMEGALLDCGASAELASQIASCLRPVAFR--MVN. 163
436 8.000e-27UniRef50_A0A2A3I7E8 Truncated hemoglobin YjbI n=2 Tax=Streptomyces TaxID=1883 RepID=A0A2A3I7E8_9ACTN  ali  20  104PTLYEWAGGAPALERLFTRFYERVDEDGLLAPVFAGKD-PAHARHVAAWLGEVFGGPPAYSTEYGGHRHMARHLGRGITEEQRRRWVALLTDTADEVGLPPEFRAVLAHYLEW.......... 218
437 9.000e-27UniRef50_A0A2S0XST3 Hemoglobin-like protein YjbI n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S0XST3_9RHIZ  ali  19  10.SLYHELGGEEAIRRLVDIFYDIVEQDEDAAELHRGHGVAHSREEQFNYLCGFFGGPSYYVQKHGHSRLKEIHEHVAIGPELRDLWLKCMRQAVDKAELPERLQDLILRAAETTRNR...... 133
438 9.000e-27UniRef50_A0A2A2WHI4 Group 1 truncated hemoglobin n=2 Tax=Rhodopirellula TaxID=265488 RepID=A0A2A2WHI4_9PLAN  ali  26  8..LFDRLGGTAAVAAIVQEMYARVLDDPELAPFFENASMDRLQTMQFHFLASAFDGPAEYSGADLTRIHAGR----GITAVHFAKFCGHFADAMEDHGASKRDVDDALGRLALYKDKI..... 119
439 9.000e-27UniRef50_A0A1I7EGP6 Hemoglobin n=3 Tax=Bacteria TaxID=2 RepID=A0A1I7EGP6_9RHIZ  ali  22  6PTLYEWAGGTEALNRLTSTFYEKVLADPLLEPVFRNMSGD-HPAHVAAFIGEVFGGPAIYSEKGGHAGMIKHHLGRHLTEEQRRRWIALILDAADEVGLPPEFRSALVAYLEW.......... 120
440 9.000e-27UniRef50_UPI000D71AF2D group 1 truncated hemoglobin n=1 Tax=Idiomarina maritima TaxID=519453 RepID=UPI000D71AF2D  ali  25  73.SLYLALGEYQGLSQLMEAFVLAIAVDERVIHHFERVDIERFHQMLTLHLCELTGGPCEYTGADMVEVHRGM----RISSAEFNAVVENLITAMQQQQLSVSTQNRLLAILAAMQH--EIVY. 187
441 1.000e-26UniRef50_UPI000DEADA4D globin n=1 Tax=Roseiarcus fermentans TaxID=1473586 RepID=UPI000DEADA4D  ali  22  41PSLYLRIGGAAALEGFVARFYEAMESDPAVARIWHPADLDDLKRRLVAFLSGFVGGPPLYPELYGPPFMRARHLHVPIATDERDMWLKCAGAALDQTIVDPVARAELAAFANHMRNRNDI... 166
442 1.000e-26UniRef50_K9WZP6 Truncated hemoglobin n=19 Tax=Bacteria TaxID=2 RepID=K9WZP6_9NOST  ali  25  2.TLYERLGGYDAISAVADNLLPRLQADPQLGRFWQDDGLKREKQLLVDFLCASSGGPMYYTGRNMMTSHQGM----KISENDWSSFLAHLNATLEFFQLPQNERDEVIAFIQTT--KLDIV.. 118
443 1.000e-26UniRef50_A0A0G3H4K6 Truncated hemoglobin n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A0G3H4K6_9CORY  ali  15  16.SFFDSVGGEETFQLVVHRFYQQVREDDLIGPMYPVDDWEGAEDRLRWFLMQYWGGPQTFSENRGHPRLRMRHAPFEIGEKEAERWLEMMDNAIDEHTLSAAMREHMQRVAYMLINKPD.... 140
444 1.000e-26UniRef50_L7LJB1 2-on-2 hemoglobin n=2 Tax=Gordonia TaxID=79255 RepID=L7LJB1_9ACTN  ali  15  5STFYEEAGGHETFRRITARFYEEVAADEILRPMYPEEDLGPAERRLRMFLEQYWGGPHTYSEERGHPRLRMRHVPYKIGPIERDAWLRCMNIAIESIELDDEHRRALTDYV............ 118
445 1.000e-26UniRef50_A0A1C4ZFF9 Group 1 truncated hemoglobin n=5 Tax=Micromonosporaceae TaxID=28056 RepID=A0A1C4ZFF9_MICEC  ali  36  46PSHYDRIGGAAAVKAAVEVFYDRVLADPELAGYFADIDMVGQRRHLALMLTVVLGGPNEYTGRGLAEAHQ----PLGIPQAHYELVGAHLLATLTQLGVPEDVQDHVRAVLA--QVQDQVV.. 160
446 1.000e-26UniRef50_A6DUG6 Uncharacterized protein n=1 Tax=Lentisphaera araneosa HTCC2155 TaxID=313628 RepID=A6DUG6_9BACT  ali  31  3.SLFHKIGGVPGIEKFLDEFYPIMLNDDRVKDYFKDIDLEALKSHQTFFLSYIFGGIPEYTRQSLKDSHSHL----KITNEVFDITLDNMLKALQKVNLDTSSTVAAMSILETV--RDDLVSR 118
447 1.000e-26UniRef50_UPI00082E7EB3 hemoglobin-like protein n=1 Tax=Polynucleobacter yangtzensis TaxID=1743159 RepID=UPI00082E7EB3  ali  13  6.SVYDNIGGIDKIDELVDRFYDLMALEPVFHRAMHPQDLSTSREKLKFFLVGWMGGPDIYSPKYGHPMLRARHLPFKIGVKERNQWLACMYKAMEECGIEGNIAKQLENTADWMRNQP..... 128
448 1.000e-26UniRef50_A0A2G4JUP6 Group 1 truncated hemoglobin n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2G4JUP6_9CAUL  ali  24  62........GQAGLTRIAGDLVDRSVADPRIKDFFAAADLTRLKRTLTEQFCYVLGGGCAYTGRDMTSVHKD----QGIAPRDFNALVENLQWAMDKEGVPFAAQNRLLAKLAPMS-RQAIENR 171
449 1.000e-26UniRef50_A0A0B8XSR7 Group 3 truncated hemoglobin ctb n=25 Tax=Bacteroidetes TaxID=976 RepID=A0A0B8XSR7_9SPHI  ali  20  9..........EDIQLLVDTFYDKAVKDPQLGHIFNDVNWEHHLPIMYKFWSSVLLGETGYTGNPM-DAHFRLNEKIPLTHEAFNSWKNIFMETVDEFFEGPEAKKKAVSIADLMFYKIH.... 122
450 1.000e-26UniRef50_A0A2T5IWX6 Hemoglobin n=2 Tax=Agitococcus lubricus TaxID=1077255 RepID=A0A2T5IWX6_9LACT  ali  25  39...FLAFGEREGIQQVMQVFMRKLMADERMRPFFQDSDRAKLVEHLTDQLCVVMGGGCQYQGRTMAESHQGQV----IKREHFNALVAHLQSAMDERQIPTQAQHKVLAVLAPMYRQLE.... 150
451 1.000e-26UniRef50_B4V629 Globin n=40 Tax=root TaxID=1 RepID=B4V629_9ACTN  ali  20  8PTIYEWMGGDEAMRRLTDAFYAHALQDEILAPVFAGMD-AEHPQHVAVWLSEVFGGPSDYTAHHGHQHMATKHLGRGITEKQRRRWVDLLMDTADEVELPPEFRAVFTYYIEW.......... 122
452 1.000e-26UniRef50_Q21WA2 Globin n=39 Tax=root TaxID=1 RepID=Q21WA2_RHOFT  ali  26  36TTLYQRLGGADGIARLVDDIIATHLANPLVKTRFEKTDMAHIKKLSCEFLTTGSGGPQTYTGQGMLAAHKGMN----ISEQEFLVVVDDIFVALNKNGIDEDSKKDVLAILYSL--KDQII.. 151
453 1.000e-26UniRef50_A0A1J5SFF2 Group 3 truncated hemoglobin ctb n=17 Tax=root TaxID=1 RepID=A0A1J5SFF2_9ZZZZ  ali  23  8.........REDIKLIVDRFYDKVKADEVIGFIFNDVNWEKHLPVMYDFWENAIFYSGTYSGNPM-NLHNHLHHIRPLSSKHFDQWNKLFNETVDEHFNGEKAKQRALSISTVMQQKIFHVNK 126
454 1.000e-26UniRef50_UPI000D381D4C group 1 truncated hemoglobin n=1 Tax=Alteromonas sp. IO390401 TaxID=2079254 RepID=UPI000D381D4C  ali  22  23.TAYARLGGMPALYAVTDNFITLIEHEPRILKYFKGVDIAEFRRHFAIQLCMETGGPCEYTGRTMQDAHAMMN----ITEADFNLTVELLIKAGEQAGLATSEINYLLMKLATM--RKDMLYK 138
455 1.000e-26UniRef50_A0A2E8F2R9 Group 1 truncated hemoglobin n=2 Tax=Bacteria TaxID=2 RepID=A0A2E8F2R9_9PLAN  ali  23  8.SLYERIGGYDAIAAATDDLLQRLTSDPDLGFYWRGHSMKRDRQLIVDFLCESIGGPSIYRGRDMRTSHAGL----RITEREWEIFMAHTAATLDHFDVSEPEKQEFLDCAANL--KDDIV.. 124
456 1.000e-26UniRef50_Q8P7S7 Group 1 truncated hemoglobin n=252 Tax=Gammaproteobacteria TaxID=1236 RepID=Q8P7S7_XANCP  ali  20  27.TLYEELGGQPGIEALVETMLSRIADDPRIVEHFARVNIVMLNERLVQKFCHVADGPCPDTAKSMAQAHQHM----AIREDDFNALVEDLNWAMDQRNIPRRTQNRLLARLAAMH--GEIVN. 141
457 1.000e-26UniRef50_K6YV08 Hemoglobin n=10 Tax=Proteobacteria TaxID=1224 RepID=K6YV08_9ALTE  ali  20  1..MYQALGGKSKIEEIVDNYINEIAFDERTYAFFKDSNMQRVKEKLSEQLCVMAQGPCTYSGDSMEQVHSGMN----ITEADFNHGVDLFINAMNKADIPYMLQNRLLKAVA--KTRDQMIYR 115
458 1.000e-26UniRef50_A0A257FKF5 Group 1 truncated hemoglobin n=1 Tax=Burkholderiales bacterium PBB2 TaxID=2015564 RepID=A0A257FKF5_9BURK  ali  25  29TSLFERLGGTAGIATVVDRTLERSANDPRTRRSFAGIKLAAIKTSLAQQLCALSGGGCVYEGETMARSHQD----ARIQASEFDVLVQILREELDRAGVSAGAKNELLRLLAPMKR--DIVS. 144
459 1.000e-26UniRef50_A0A2P6VMT3 Globin n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6VMT3_9CHLO  ali  33  155PSLYDQLGGGVALKVVVDVLYQHVLGDPRLSPFFEGVDMSKHARKFLLFASYVLGGPDEYLQLHPEPVHERLIKNMGLVESHFEMVKEHFGEALQGLGATPLLIEQALSIVESTR........ 275
460 1.000e-26UniRef50_A0A2K8LXQ2 Antibiotic biosynthesis monooxygenase n=20 Tax=Actinobacteria TaxID=201174 RepID=A0A2K8LXQ2_9PSEU  ali  23  105PTLYEWAGGAAALTRLTEAFYAKVPEDDLLAEVFAGMS-PEHPAHVAVWLGEVFGGPAAYTGQHGGHAHMARHAGRAITEPQRRRWVSLLLATADEVGLPPEFRAALAGYLEW-GSRLAVV.. 226
461 2.000e-26UniRef50_A0A2N3EFF4 Preprotein translocase subunit TatC n=2 Tax=unclassified Alphaproteobacteria (miscellaneous) TaxID=33807 RepID=A0A2N3EFF4_9PROT :  ali  23  23....DAAGGEAEIERLVRTFYARIREDEVLGPIFDGENWEPHLLKMCDFWSSVMLTTGRYKGQPMRAHLK----LKTVTPGHFDRWLMLFRATAEEVCAPERFVEKAARIAESLQ........ 138
462 2.000e-26UniRef50_Q0F2H6 Putative globin n=7 Tax=Proteobacteria TaxID=1224 RepID=Q0F2H6_9PROT  ali  12  10..FYERIGGETKLRQLVHRFYQHMDELPEAQPIMHADNLQSAEDKLFMFLSGWMGGPQLYIEKFGHPRLRMRHLSFKIDESARDQWILCMKHALDDVIEDEKLRTELLQVADFMRNQPD.... 132
463 2.000e-26UniRef50_H1UU69 Sec-independent protein translocase n=2 Tax=Acetobacter pasteurianus TaxID=438 RepID=H1UU69_ACEPA  ali  23  148.........EDGLATLVDAFYTRVRADPKLGPIFEDTNWPEHLQTLTAFWSSVMLGTGRYKGQPVPVHMQHRDR---ITPELFDRWLALWGETTSTHDVAAVLQDKAANIARSLQ........ 255
464 2.000e-26UniRef50_A0A2N2LB34 Uncharacterized protein n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-9 TaxID=2013732 RepID=A0A2N2LB34_9CHLR  ali  21  87..LFERIGGREVVERVVREFYDRVAADPELRALFPE-DLEHGREKQTLFMEQWLGGEARYSTLYGHPRLRIRHFPFVIDQKAAGRWLRHFGEALRAAGVGEPEIAEILAGLGPMAR--HMIN. 203
465 2.000e-26UniRef50_A0A0P6WLF5 Hemin transporter n=1 Tax=Prosthecomicrobium hirschii TaxID=665126 RepID=A0A0P6WLF5_9RHIZ  ali  30  3..............AVVDDFVANVAADKRINGFFARADIPRLKRRLVQQICAGTGGPCLYQGQDMKTAHAGM----GIRKVHFTALVQDLQKTLRKFKVPMREQKELLAILGPMQ--KDIV.. 103
466 2.000e-26UniRef50_A0A1N6SUL1 Hemoglobin n=5 Tax=Alteromonadales TaxID=135622 RepID=A0A1N6SUL1_9GAMM  ali  23  35TSLYQALGNDVGVSAIIDGLLKRISTDTRIVHHFDATDIALFRERLIEHICWVAGGDCEYHGESMEKTHQGLN----ITQADFDALVGHLIASMKEQHIPLATRNALLKRLAPM......... 144
467 2.000e-26UniRef50_UPI00097C77F7 group 1 truncated hemoglobin n=1 Tax=Pelomonas sp. KK5 TaxID=1855730 RepID=UPI00097C77F7  ali  25  31PTLYQRLGGAPVVQIVVDRTLERAAVDERTRRSFDGIKLGAVKESLAAQICSISGGGCRYEGETMAKAHKD----SKIQPREFDAMVDMLRQELDRAGVDAGPKNELLKLLAPMKR--DIVT. 146
468 2.000e-26UniRef50_A0A2W4MJ60 Hemoglobin-like protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2W4MJ60_9ACTN  ali  15  21ATPYEELGGDARVRELVNAFYDVIEEESPVIRAMLPRNTSTSREKLYEYLSGWLGGPPLYEAKRGHPRLRMRHLPFPIDADGAREWMRCFRKAMDRVGVTGTIRDFLDEKLTPLA--DHMVNR 141
469 2.000e-26UniRef50_A0A2D2DLY1 Group 1 truncated hemoglobin n=1 Tax=Massilia violaceinigra TaxID=2045208 RepID=A0A2D2DLY1_9BURK  ali  24  32PSLFVRLGGMTGVTAVVDDFVSKVSVDPRSKRTFEGVNLPRLKASVVLHVCALSGGPCKYEGDSMALAHRGM----AITSEELSVMGYYVDQALQRQGVARANREELESMLDKLG--PEILNK 148
470 2.000e-26UniRef50_A0A1X1QKX1 Hemoglobin-like protein n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A1X1QKX1_9GAMM  ali  16  14.TQYEKLGGEAGVRRLVKYFYQTMHNVAEVKAIMHASDLGEAEEKLYLFLSGWLGGPSLYIEKHGDPRLRARHLSFSIGTKERDQWLHCMDQALAKVDIDKPMHDELMQAADFMRNKSE.... 137
471 2.000e-26UniRef50_A0A0S9E0X9 Group 1 truncated hemoglobin n=2 Tax=Agreia sp. Leaf244 TaxID=1736305 RepID=A0A0S9E0X9_9MICO  ali  36  1..MYERLGGHDTVKVAVAVFYTRVLADPLLAPYFEGIDLARLRSHQAAFLSVAMEGPDVFAGRPLSEAHAGL----EVAGEAFDAMIEHLEFALVDVGVDAGDVAELVSRVRSF--RDLVVT. 114
472 2.000e-26UniRef50_A0A1I2CMC3 Hemoglobin n=8 Tax=Comamonadaceae TaxID=80864 RepID=A0A1I2CMC3_9BURK  ali  19  66..LYQALGEKAGIAALMGDMVDRALKDPRIGPMFENMRPQALKDSLAAQICVLTGGPCEYEGTDMKYAHAQL----KIDKAQFNALVEVLQDAMDARGIPFTQQNRLLALLAPMHR--DIIT. 183
473 2.000e-26UniRef50_A0A177PYN4 Uncharacterized protein n=1 Tax=bacterium SCGC AG-212-C10 TaxID=1799370 RepID=A0A177PYN4_9BACT  ali  19  5.TLYSRAGGREGISAIVESFYEKVEKDAHMRSIYP-ADLEPGKAKLKLFFEQWFDGPPVYTELYGHPRLRRRHFPFVIDDRHAGLWLRYMRQSMAENGISNADLGTIFKAFGDLA--KHMVN. 122
474 2.000e-26UniRef50_A0A2M7MUC4 Uncharacterized protein n=1 Tax=Hydrogenophilales bacterium CG_4_10_14_3_um_filter_63_21 TaxID=1974028 RepID=A0A2M7MUC4_9PROT  ali  30  110ASLYWRLGGVDAINAAVDETIKVSKADPRLAGRITGACAP----KLKEQLCAASGGPCTYTGRDMKTAHKGLN----ITEAEFGAVAQNLVSVLDAFKVPEKEKNELVGLIAPMQ--GAIVGQ 222
475 3.000e-26UniRef50_A0A239AAC2 Hemoglobin n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A239AAC2_9PSED  ali  12  14...YQAAGGIEGIRRLVDDFYLLLDSEPKAGRAMHPASLDMARDKLACFLSGWLGGPRLYSEKYGSISIPAFHAKWPIDQAHSEAWLHCMKLAIERQGYPAPFAEYLLRQLRVPAER...... 129
476 3.000e-26UniRef50_A8FVI8 Globin n=14 Tax=Bacteria TaxID=2 RepID=A8FVI8_SHESH  ali  19  4TSLYERLGGEGKIALIAADIFDTHAANPTIASRYKDSDRDRVIKVVTEFLCSGTGGPQDYTGKNMLDAHRAMN----INEREYMAVLDDIIVALDKNGVGEREKQEMLMIAYSI--KEEIIG. 119
477 3.000e-26UniRef50_A0A1N4MA44 Hemoglobin-like protein HbO n=23 Tax=Actinobacteria TaxID=201174 RepID=A0A1N4MA44_9MYCO  ali  15  9.TIFAAVGGHETFTRLVDAFYANVAADEPLIAMYPGHELTGAKRRLQMFLEQYFGGPTTYQEERGHPRLRMRHFPFPIDFDARDRWLRAMRAALDEVALPPLYDELFWDYFQRAAT--AMVN. 128
478 3.000e-26UniRef50_A0A075AMS7 Globin-like domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075AMS7_9FUNG  ali  35  8..LFEEIGGVVTISLVVDKFCSMLLKDKRINTYFKNVDVDRLKRMQTSFLCSVSGGPP-YNGQSMRSAHKRL---LDLKDKHFDAILENLDKAMEQAQISYEHRKKLLCLAEF--ARSDVLGK 125
479 3.000e-26UniRef50_A0A2K3CTI7 Uncharacterized protein n=1 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A0A2K3CTI7_CHLRE  ali  29  54..LLDRMGGADYVKRVAERFYHKLYADEQLAPFLGEHDVVSLRAKQNAFLIWAFGPPNRYPGRHLRTAHLRLIKQKGFTVEHFEMGLKHFEEALKEMDAPPSVVRDALMKLRP.......... 165
480 3.000e-26UniRef50_UPI000C6E6027 group 1 truncated hemoglobin n=1 Tax=Colwellia echini TaxID=1982103 RepID=UPI000C6E6027  ali  20  53..LYNAVGGQKGIEKLVNVFVKNIANAPEILPYFAKSSVKHFKQGFINHFCVIVNGPCKYAGDNMIDIHTGMN----ITERDFNRVVELLVESMDEVDISYPNQNKILKKLAAL--RSQVIKR 167
481 4.000e-26UniRef50_UPI000DC03355 group 1 truncated hemoglobin n=1 Tax=Thermoflavimicrobium sp. FBKL4.011 TaxID=2137476 RepID=UPI000DC03355  ali  24  8GTLFNQLGGISTVETVVAEFYDRLLVDDQLSHLFVNVDLDVLQKHFTSFFVTFFLGPASYSGKTLRMAHKGLQ----ITSEEYNIALKHLRRVLFKYKVSIEIVAKLEANL--LAVKPHIVNK 125
482 4.000e-26UniRef50_A0A078A2L1 Group 1 truncated hemoglobin n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A078A2L1_STYLE  ali  32  16SSLFERLGGQEGVTNIVEGMYAKIFNDPDVADFFRKSDKGHQVKKMAAFFIYTTGGQEDWDGKSMKETHQGR----GIGSRQFERVIDHIRSTMHELGHLDELIDELVNRLDLLK........ 126
483 4.000e-26UniRef50_A0A1Q7YHD6 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1Q7YHD6_9BACT  ali  29  43.TLYERLGGMPAITAFVDDAAARLAADPRINKKLAKTDVPRLRLHLIEQLCMVTGGPCEYTGRSMKKTHRHMQ----VTEGEWNATVEDLVATMNHLNIAQQEQTDLLNILGSL--KSQIV.. 156
484 4.000e-26UniRef50_A0A0Q6R961 Uncharacterized protein n=2 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0Q6R961_9MICO  ali  26  3..LIRRLGGDEGVAALVDQLSARVKADPLMGPYFRDVDEAALNRHRSMFLSALLGGQHSYTGKTVAEAH----GPFRLGDAEFDAFLRVMRETLEAADVPAVDRRTVLRRLSRL--RADIVSR 117
485 4.000e-26UniRef50_A0A1G7ULY6 Hemoglobin n=2 Tax=Halomonas taeanensis TaxID=284577 RepID=A0A1G7ULY6_9GAMM  ali  35  93.SLYASLGGKAVIDAVVNDFLYRIAGDERIVGFFANTNIDHFAEAFATQLCDISDGPCDYTGPSMARAHQHM----GITDAHFNAVVEHLRAALIDQGVP....................... 187
486 4.000e-26UniRef50_UPI000DAEE019 globin n=1 Tax=Phenylobacterium sp. LX32 TaxID=2170551 RepID=UPI000DAEE019  ali  16  13.TPYQALGEEVGVRALAEAFYDAMEREPSLARAMHGADLTPMKARLADFLIGWTGGPPVYSARPGRPCVMSAHAPFPIGAEAASQWLACMKIALDEVGAEPALRKLLEPAFERM......... 128
487 4.000e-26UniRef50_UPI0003F78FE5 group 1 truncated hemoglobin n=4 Tax=Actinobacteria TaxID=201174 RepID=UPI0003F78FE5  ali  34  10.SAYDRIGGAPAVTEAVERFYRRLLADDELSGFFTGTDLPQLKRHQVALISQVLDGPKAYGGRELAEAHRGM----DISPGQYKAVGMHLTAVLEELEVPRDIIDSVEQVLTVVA--PDII.. 123
488 4.000e-26UniRef50_A0A0P1HXU9 Hemoglobin-like protein HbN n=22 Tax=Rhodobacterales TaxID=204455 RepID=A0A0P1HXU9_9RHOB  ali  30  4.TIYEKYGGFSAISRVVMTFYEMALESDQIGDYFADVDMARLIDHQTKFISSLLGGPASFSDERLEAVHRAL----GITHEDFDEMAALLKEALEQHGLSEPDVRTTLTAIE--AKRNIIVTR 119
489 4.000e-26UniRef50_A0A261CZP3 Antibiotic biosynthesis monooxygenase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A261CZP3_9ACTN  ali  22  108PTLYEWAGGEAALEKLFVRFYEIVPADDLLGPLFAGMD-PHHAQHVAMWLGEVFGGPTDYTDRGGYENMLGHHIDKSITPQQRRRWVTLLIDAADEVGLPDDARAAFVSYLEW.......... 222
490 4.000e-26UniRef50_A0A1H7Q4T9 Truncated hemoglobin YjbI n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1H7Q4T9_9ACTN  ali  20  99PTLYEWAGGAQALERLTETFYRHVKDDDLIGPLFAHMD-PRHPAYVAMWLGEVFGGPARYSEERGGHSHMSHHLGKGITEQQRRRWVSLLMDAADEVGLPAEFRAAFAGYIEW.......... 213
491 4.000e-26UniRef50_A0A2S5TJ72 Group 1 truncated hemoglobin n=2 Tax=Sinobacteraceae TaxID=568386 RepID=A0A2S5TJ72_9GAMM  ali  31  30.TPYERIGAAPGVARLVGVFYEQVLADPELAPFFRGVAMQKLQHMQAELFAVALGGPVSYMGRPIIHAHQ----PHRITLPHFQRFVQHLFEVLREFPLSEDERTDLIARI............ 135
492 4.000e-26UniRef50_A0A2E9QL25 Hemin transporter n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9QL25_9DELT  ali  15  17........GEEGFRDLTAAFYKRVKQDDILGPMYPDNDWEGAEERLRDFLVFRFGGPRRYLEKRGHPRMRRRHMPYVLNSKSRDRWLLLMGEAFEETDIPPPIRQHLFAFFTKVAH....... 124
493 5.000e-26UniRef50_A0A1A7KK59 Group 3 truncated hemoglobin ctb n=22 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1A7KK59_9FLAO  ali  21  7.........REDIELLVNSFYDKVVQDETIGFFFKDVDWDKHLPKMYSFWESILFGQMSYKGNPM-AVHFPINQLEAMEKKHFERWLQLWKQTIEENFTGENAITKSENIANLMAYKMEM... 122
494 5.000e-26UniRef50_A0A1X7BVD3 Group 1 truncated hemoglobin GlbN n=2 Tax=Roseovarius aestuarii TaxID=475083 RepID=A0A1X7BVD3_9RHOB  ali  34  35.SLYERLGGYDAISAVVDDFAGKLFEDEVVGKRFGDDTRASFRQKNKNLVCIATGGPCKVISRPADVVHGGL----GITASEFDIVAGHLSDTLNSFNVPEQEQEELMAIIASL--RPDIV.. 151
495 5.000e-26UniRef50_A0A2E4UTT8 Uncharacterized protein n=3 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E4UTT8_9GAMM  ali  17  5TSIYDRLGGEAGVRRLVTEFYDEMERNPDAAAILPHANLEEARQKLFEYFSGWLGGPPLYTSKYGHPRLRARHLHIAISVPERDAWLICMVNALRTM.......................... 102
496 5.000e-26UniRef50_A0A0N1LAT9 Group 1 truncated hemoglobin n=2 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A0N1LAT9_9PROT  ali  26  39..LFQQLGGKPGITQFTNTFVQRISEDPRIKDFFADTDLQRLSLLLGEQFCELSGGPCQYKGRDMRESHRNM----GVRTVHFNALAENLQIAMAQHGVPNRAAAKLIALLAPMH--GDVVQR 153
497 5.000e-26UniRef50_A0A243W8D7 Sec-independent protein translocase TatC n=2 Tax=Cytophagales TaxID=768507 RepID=A0A243W8D7_9BACT  ali  20  11.........EADIKTLVDSFYDKVNQDDLLAPIFAHVNWAAHLPAMYDFWSSLLLGTSRYRGRPFPK-----HLPLPVDATHFQRWLNLFYATVEENFAGPQAKVRALNIATMFEYRI..... 120
498 5.000e-26UniRef50_A0A2D9WMK5 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D9WMK5_9CHLR  ali  17  72..LLQAIGGRSAIQKFVELFYASASVDGLIGHMFSE-NIKAGQAKQSLFMEQWLGGKPVYSKIWGHPRLRIRHFPFVIGPDHAERWLELMGAALLQSGITPSLTNDIMDRLKPLA--KHMVN. 188
499 5.000e-26UniRef50_A4BB88 Protozoan/cyanobacterial globin n=1 Tax=Reinekea blandensis MED297 TaxID=314283 RepID=A4BB88_9GAMM  ali  21  31.TLYQRLGGLQGVTTIVDNLLYELGSNEKLIGFFAETDIDRFRSKLIEQLCQVSDGGCEYTGDSMAQAHSTM----SLDQSHFDSLVNDLIAAMDAAGTPVTAQNDLLSRLVPM......... 139
500 5.000e-26UniRef50_UPI0009E03739 group 1 truncated hemoglobin n=1 Tax=Aquabacterium sp. NJ1 TaxID=1538295 RepID=UPI0009E03739  ali  22  166APLYQQLGGVAKIDAVADRTLERVSTDPRTMRSFDGIKMPYLKKSVAAYLCKVADGPCVYEGETMANSHA----KSNISGAEFDIMVSVMREELDRAGVPEGAKNELLRRLAPT--RRDIV.. 280
501 6.000e-26UniRef50_A0A2V9TZC1 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9TZC1_9BACT  ali  29  87..LYDLIGGQNIIEAATKIFYDKVSQDDNLRHFFEKVDMTDLRSRQSMFVSMLLAG-RVYTGKNIRDAHAG-SRDCGLTDAHFDLFLQHFRAALEEVGVKPENAEIIMKRLES.......... 195
502 6.000e-26UniRef50_UPI000A06C3C9 group III truncated hemoglobin n=1 Tax=Terriglobus sp. TAA 43 TaxID=278961 RepID=UPI000A06C3C9  ali  19  14.........EEQIANLVDVFYAKVRTDPEIGPIFNAVDWPHHLSVLKDFWSTVLLTSGRYKGDP-----AMRHVGLGLDPEHFDRWLALFSETTVEIF-PAETAEWILSKAQRIGR....... 116
503 6.000e-26UniRef50_C6WW87 Globin n=16 Tax=Bacteria TaxID=2 RepID=C6WW87_METML  ali  18  14.TFFELLGGAQNIRLLVETFYDIMDSDPKAKPLMHQPDLTSAREKLFMFLTGWTGGPQLYIERYGHPMLRKRHLPFEIGESARDQWMYCMIKAMHQLEYDDDLANQLYGVADFMRNK...... 139
504 6.000e-26UniRef50_A0A2K3CTN5 Uncharacterized protein n=3 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A0A2K3CTN5_CHLRE  ali  25  47..LLQRVGGSDVVKHVVELFYRHLYADPSLIKFLHDQEMTHLRAKQSAFISWLFGPPNPYTGKSVRIAHLRIIKQRGFSPEDFDLGMKYFAESMRELGAPEILINEVLRRITP--YKDAI... 163
505 6.000e-26UniRef50_A6GP10 Globin-like protein n=7 Tax=Bacteria TaxID=2 RepID=A6GP10_9BURK  ali  12  31...........GVRKLVDLFYDEMDQNPSFERILHPVHLDHSREKFYLFLSGWLGGPDLYSPQFGHPRLRMRHMPFPISSEDRDQWLLCMVNALRSMQLPEKVIEGLMRTADWMRNKPD.... 144
506 6.000e-26UniRef50_A0A1M5U0G3 Hemoglobin n=2 Tax=Chryseolinea serpens TaxID=947013 RepID=A0A1M5U0G3_9BACT  ali  17  8.........REQVEKLISAFYARVSEDALLAPVFSHVDWPHHLPIMVNFWSSMLLGDQSYRGNPFQK-----HIHLPIGREHFDQWLHLFYTTMDEHFTADEAKSRAASIATLFQHR...... 113
507 7.000e-26UniRef50_A0A2A4W6X3 Uncharacterized protein n=1 Tax=Piscirickettsiaceae bacterium TaxID=2030828 RepID=A0A2A4W6X3_9GAMM  ali  12  11GTMYDWIGGEEGVRKLVNRFYELMDQESEAKRAMHKEDLSNIRTGLXEYLSGWLGGPPLYVMKHGSPCITKPHTPFKINQAAADAWMHCMKKAMTDVNIERKYQEMLTPAFQRM......... 126
508 7.000e-26UniRef50_A0A1X9NN75 Globin n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1X9NN75_9GAMM  ali  14  5.TPYQLLG-DAGIRKLADAFYEEMDAQPETIRAMHAANLDLIKDKLYEYLSGWMGGPPIYSEKYGTVCLTDPHKPYPIGPDERDQWLACMDGALERIDASEELKEMLKG---PMYQVADII.. 122
509 7.000e-26UniRef50_A0A238L1I4 Group 3 truncated hemoglobin ctb n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A238L1I4_9RHOB  ali  23  21..LMARTGLDDAIVRLVHGFYDKVRADPLLGPIFAATDWGPHLDKLVDFWSSVALMTGRYHGAPMPK-----HLPLPVEQAHFDRWLALFRQTATEVCPPEGAIERAERIAASIHMNIQVARR 142
510 7.000e-26UniRef50_A0A0W7W8P1 Globin n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0W7W8P1_9MICO  ali  13  4.TVWSQVGGTETFEKIAVAFYRGVREDEVLAPMYPQDDWEGATWRIRAFLEQYWGGPSAYQEERGHPRLRMRHNAFPVTPDAKERWLKHMHAALDEVELPPMHDAAFRDYIERAA--LALVNR 123
511 7.000e-26UniRef50_A0A0B4CKC8 SEC-independent protein translocase TATC n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A0B4CKC8_9FLAO  ali  21  7.........REDIEQLVNSFYTKVIKDEKIASFFTDVDWEQHLPKMYSFWESILFGQMTYKGNPMG-AHFPVNEIKAMEQEHFERWLELWTQTIEENFAGENAIYKAQNIAKLMAFKMEIARR 125
512 8.000e-26UniRef50_A0A1D2S1R1 Globin n=1 Tax=Acidovorax sp. SCN 68-22 TaxID=1660087 RepID=A0A1D2S1R1_9BURK  ali  16  27PGLYAALGELPGIERLVGEFIPRLKRHPRLGAHFRDVKAGPFQEALSEQICWLAGGPCTFQGRDMRADMRGVHADLKIDQADFNALVEVLQDAMDAQGIPFAQQNRLLALLAPMHR--EIVT. 149
513 8.000e-26UniRef50_A0A1D7QWI0 Group 2 truncated hemoglobin yjbI n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1D7QWI0_9BACI  ali  20  8.TLFERIGESE-LHLLIERFYTHVQKHPDISDLFPE-DMSETIRKQKQFLTQFSGGPDDYTMEHGHPMLRMRHMPFHIGEKEADAWLSCMHEALLESAIDIGTQQELYARLSHTA--KHMIN. 124
514 8.000e-26UniRef50_A0A1W6E308 Sec-independent protein translocase TatC n=2 Tax=Cytophagaceae TaxID=89373 RepID=A0A1W6E308_9BACT  ali  23  14..........EAVRLLVNSFYEKVQVDPLIGPIFAEVDWASHLPKMYAFWESLILGNGAYNGHPFRP-HLLVNQQHPLRREHFERWLTLFSATLTEQFTAEQVRQRALQIASVWNHKLEYIN. 130
515 8.000e-26UniRef50_A0A250WV04 Uncharacterized protein n=1 Tax=Chlamydomonas eustigma TaxID=1157962 RepID=A0A250WV04_9CHLO  ali  35  99.TIYKRLGGSSKIEAIVNILYEKIMEDKKLLPFFQEVSLEYIKSHQVAFLGMAFDGPNRFNVDIMVLAHARLIREKGLEQTHFDLFIQHFLSSLQHLNVPQLLINEMMTVVGPLR........ 215
516 9.000e-26UniRef50_A0A1C6SBT7 Group 1 truncated hemoglobin n=3 Tax=Micromonospora TaxID=1873 RepID=A0A1C6SBT7_9ACTN  ali  39  9PSYYDRIGGAAAVKAAVDVFYGRVLADPELAGYFTDIDMVGQRRHLALMLTVVLGGPNEYAGRGLAEAHQ----PLGIPDAHYDLVGAHLLATLTQLGVPADVQDHVRAVLG--QVRDQVVT. 124
517 9.000e-26UniRef50_I7LVA6 Group 1 truncated hemoglobin n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=I7LVA6_TETTS  ali  41  52.SLNARLGGDEVVAKATKSFYAKVLKDETLKPFFKNVDMAKQTKKQTDFNIFAFGGSEKWYGRKLTEVHKYM----GVSNANFDKVGEYFSESLRELGVSEDLIREVEQCNE--KYRSVVVT. 166
518 9.000e-26UniRef50_A0A258QA56 Uncharacterized protein n=1 Tax=Halothiobacillus sp. 28-55-5 TaxID=1970386 RepID=A0A258QA56_9GAMM  ali  25  207...YDAFGQKAGITSIIDDFVGNVAADNRINAYFAHANIPFLKTSLVNQVCEALGGPCKYTG----PAMGPLHHSMGVTQAAFNALTEDLQLSMTKYNVPIPAQNHLIGILAPMS--KDIITK 320
519 1.000e-25UniRef50_Q7NRT9 Probable oxygen-binding protein n=47 Tax=Proteobacteria TaxID=1224 RepID=Q7NRT9_CHRVO  ali  17  8.TPYQLLGGEGVVRWLTDRFYDIMDSEPSVKPLMHPADLAGSRQKLFMFLSGWLGGPSLYMEAFGHPRLRMRHMPFAVDEDARDQWMFCMRRAVSELVVEDWLKDKLLEAFHNTA........ 123
520 1.000e-25UniRef50_A0A2D6MTK2 Globin n=3 Tax=root TaxID=1 RepID=A0A2D6MTK2_9DELT  ali  21  7.SPYQRLGGDEEVIRLVECFYRQMSTLPEAARAMHADDIAPMVDKLSVFLIGWMGGPENYNKRFGRVVIPAAHEPYPIGPDERDQWLVCMQKALEEVEAEEDLVQMLMKAFYLMA........ 122
521 1.000e-25UniRef50_A0A2W5VRN8 Sec-independent protein translocase TatC n=2 Tax=Bacteria TaxID=2 RepID=A0A2W5VRN8_9RHOO  ali  20  11...........DLTILVDSFYEKVKSDSLLGPVFSYVNWAKHLPVMYNFWCSMLLGEGSYKGSPLQP-----HLHLPIGREHFDQWLRLFNETVDEKFFADETKLRAEAIAGVFQHK...... 114
522 1.000e-25UniRef50_A0A2K8LBI1 Hemoglobin n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2K8LBI1_9PROT  ali  18  9.TLYERIGGEVPLRLLVERFYRHMDELAEARPIMHAKSLKVSEEKLFMFLSGWMGGPSLYIEKYGHPRLRMRHMPFAIDESARDQWMLCMRHALDEVVEDACLRDELMQIADFMRNR...... 130
523 1.000e-25UniRef50_D0SKD3 Protozoan/cyanobacterial globin family protein n=11 Tax=Acinetobacter TaxID=469 RepID=D0SKD3_ACIJU  ali  29  197PALWEALGGDHTVRKILTEFYKKVYADQQLAPFFERVTIDRIIGKQFAFLKQLITGEATFFGEQPRNSHHWMV----ISDELFEHRMLLMHQTLLEHKLSADLIEQFERY--ELQFKNDIV.. 311
524 1.000e-25UniRef50_C0N294 Protozoan/cyanobacterial globin family protein n=5 Tax=Methylophaga TaxID=40222 RepID=C0N294_9GAMM  ali  29  32ASLFNRLGGPDKIRVIVEDTYHNHVTNPIIRDRFVDSDHAAVKQKVYEIFAAATGSEEEYTGRDMKTTHRTMN----INEMEFNAVVDDVMAALEKNGVGQQEKNEVLAILWSV--RGDIVN. 148
525 1.000e-25UniRef50_A0A1S9CY47 Group 1 truncated hemoglobin GlbN n=1 Tax=Chromatiales bacterium USCg_Taylor TaxID=1934255 RepID=A0A1S9CY47_9GAMM  ali  28  49.SLFERLGGREGLTAIAEGFISNIGADPRTRVHFTNVNMGTFKTKIVEYVCERTGGPCKYTGGEIKT----MAAPLQLGNADFDAFVENLTKSFDNKQVPQADKDELLELLGKL--RPDVV.. 162
526 1.000e-25UniRef50_A0A1F4GCF8 Uncharacterized protein n=2 Tax=unclassified Burkholderiales TaxID=119065 RepID=A0A1F4GCF8_9BURK  ali  24  35PPLYQQLGGVENIEAVSRAMIQRMSTDPRTKRTFDGINLRTLSASLAAHLCKVADGPCVYEGETMRNAHADL----GLGGSEFETVVQILRDELDRTGVSQAAKNELLRRLAP--SRRDIVT. 150
527 1.000e-25UniRef50_A0A2V2SFS5 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V2SFS5_9BACT  ali  28  168TSLFERLGGEPGISNIVTDFAPRALDDPRVNRAGESVAWDALRKHLVEFLALATGGPAKYTGRQIEAVHADMH----ISNPEFDAVIGDLKASLDKLQVPNMEQKELLAIIEST--RPQIVTK 304
528 1.000e-25UniRef50_A0A260ANB6 Oxidoreductase n=3 Tax=Rhodococcus TaxID=1661425 RepID=A0A260ANB6_9NOCA  ali  18  4PTLYDWAGGDAAFRRLLDAFYDHVERDPLLSPMFPGGVSEDHRAHVTLWWAEVFGGPDRYTELGGYHRMLAHHIDLGITALQRRRFVELMSIAADDAELPPEFRSAFMAYVEW.......... 119
529 1.000e-25UniRef50_A0A0G4H7N6 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4H7N6_VITBC  ali  51  78.SLYVRIGGAAAVEAAVDRFYTKILADDRVKRFFSETDMKKQRSHMGKFLTFAFGGSSSYSERGMREAHKKPVSQ-GMDETHFDAVMENLAATLKDLGVPDDLIGEAAAIA--LSTKKDVLNQ 196
530 1.000e-25UniRef50_A8J8P7 Predicted protein n=1 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A8J8P7_CHLRE  ali  25  46.TLLKRIGGEKGMKDVVEMFYRKIYANERLRHFLKDKDVSLLRSKQAAFMT-WLFGPATYTGRSVRCAHLRMIKQRGFSEDDFLLGMSCFEEAMRDYGAPQRLTNEIMAKILPFK---DII.. 163
531 1.000e-25UniRef50_A0A243R966 Antibiotic biosynthesis monooxygenase n=22 Tax=Actinobacteria TaxID=201174 RepID=A0A243R966_9ACTN  ali  21  105PTLYDWAGGAEALERLTEIFYGHVMEDDLIGPLFAGMD-PGHPRYVAMWLGEVFGGPDRYTERGGYPHMLSQHLGKGITEPQRRRWVSLLLDAADEADLPPEFRAAFLGYIEW.......... 219
532 1.000e-25UniRef50_A0A1Y5TR09 Group 1 truncated hemoglobin GlbN n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Y5TR09_9RHOB  ali  28  4.TLFEKYGGFSTISKLVLTFYDRMLEDDDVGPFFDDVDLSKLIDHQTKFISALMGGPATFSDDHIERAHRHM----TIENHHFDRLKEIVAETLADFDIEAADIEAVLDGFE........... 110
533 1.000e-25UniRef50_A0A1I7ILW5 Hemoglobin n=1 Tax=Halomonas korlensis TaxID=463301 RepID=A0A1I7ILW5_9GAMM  ali  23  5..LYDRLGGRAGIDKLVDRIVELHLQNDVAGPRYRALDIDHAREKVKEFLAAGSGGPVEYTGRSMIETHTGMN----VSAAEFVAVVDDIMQAMRELDYPQPVCNEVLGVAYSL--KGEIVHR 122
534 1.000e-25UniRef50_A0A220PUD9 Group 1 truncated hemoglobin n=2 Tax=Shewanella TaxID=22 RepID=A0A220PUD9_9GAMM  ali  22  4ATLYERLGGETQIAKIATDIFDTHADNPDIASRYLNSDRHAVIEKVTEFLCAATGGPQEYTGKSMIETHKTMN----INEKEFLAVLDDIMLVLDKHQVGQQEKQELLLAAYSL--KGEIIGR 120
535 1.000e-25UniRef50_B4D1F1 Hemoglobin-like protein n=4 Tax=Bacteria TaxID=2 RepID=B4D1F1_9BACT  ali  23  17........GRADIERLVDTFYGKVRQDELIGFIFNDVDWAAHLPKMYAFWETVLFRTGNFSGNPLAT-HARLVPLTTMGPPQFERWLALFTATVDELFAGEKLKASAADIANVLHTKI..... 131
536 1.000e-25UniRef50_D3SDZ1 Globin n=23 Tax=Proteobacteria TaxID=1224 RepID=D3SDZ1_THISK  ali  24  4TSLYERLGGEARIHELASTIFDKHTQNTTIRNRYVDADRNDVIRLVTEFICNGTGGPQAYSGRDMLTTHRGMN----ISEEEFVAVVDDIVEALDEHGVGQREKEELLMISWSL--KPEIV.. 118
537 1.000e-25UniRef50_A0A1H3PIU8 Hemoglobin n=2 Tax=Bacillus TaxID=55087 RepID=A0A1H3PIU8_9BACI  ali  15  8.TPYAQIG-EEKLHQLIDRFYELVSQHPDISFLFPD-DLAETARKQKQFLTQFLGGPALYTEEHGHPMLRARHMPFPITADRAKAWLSCMELAMNDVHLQEPIKSQLFHRLSYTAQ--HMIN. 124
538 1.000e-25UniRef50_UPI00039DF36C group 1 truncated hemoglobin n=1 Tax=Streptomyces scabrisporus TaxID=159449 RepID=UPI00039DF36C  ali  24  2.SIYESIGGEPVLVEVLDGLYRRIALDADLAPFFANRDLDRIKARQAEFLGHALGGPVEYRGRPLYPSMKDVHRHARIEQWHFARFVEHLAASLTAAGVADEITQEILTVLAPLA--DDIVT. 141
539 2.000e-25UniRef50_A0A1I9YS88 Globin n=27 Tax=Proteobacteria TaxID=1224 RepID=A0A1I9YS88_9BURK  ali  18  16.THFDRLGGETAVIRLVDAFYRHMRADAQRIRAMHHPDLSSTKAVLVLYLCEWLGADKQYSAPRGQPRLRRRHATFAIGTAERDAWLACMRAAFDETGVDPALRDELMQAFFKIADR...... 133
540 2.000e-25UniRef50_G8QLZ2 Truncated hemoglobin n=6 Tax=Betaproteobacteria TaxID=28216 RepID=G8QLZ2_DECSP  ali  17  5.TPYEMLGGPQSLRELVDRFYDLMDLEPEFARAMHPPTLDGSRDKLFMFLSGWLGGPDLFVQQFGHPRLRARHMPFSIGTESRDQWVKCMVRAMEEVGVEEALRLKLYNTADFMRNR...... 126
541 2.000e-25UniRef50_Q1I987 Uncharacterized protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=Q1I987_PSEE4  ali  14  13...YQAAGGIDGLRRLVDDFYRLMEQNPAAARRMHPDDLSGSRDKLACFLSGWLGGPRLYSERYGSIAIPSFHAQWPISEAHSAIWLDCMAQAIALQPWSGEFAEYLLRQLRVPAERIVQASR 134
542 2.000e-25UniRef50_A0A222GDF1 Group 1 truncated hemoglobin n=4 Tax=Colwellia TaxID=28228 RepID=A0A222GDF1_9GAMM  ali  16  33PSLYQKIGEKPAIDMIINNLVNIIGQDKVIFSHFAQSNVTHFKEKLSVYLCHITDGPCEYNGDTMQDIHRGMY----IDTNQFNHFVELFIGAMDASDISYPIQNELLARLAPLR........ 143
543 2.000e-25UniRef50_A0A2E5FAA8 Uncharacterized protein n=2 Tax=Cycloclasticus TaxID=34067 RepID=A0A2E5FAA8_9GAMM  ali  14  12TTMYHWIGGEEGVRKLVNRFYDIMDSDDEAKRAMHKEDLSDIRQGLFEYLSGWLGGPPLFVAKHGSPCITKQHQPYKIDQKASDAWMHCMKKAMRDVGIDAKYRDMLTPAFQRI......... 127
544 2.000e-25UniRef50_A0A1G6S7L3 Hemoglobin n=3 Tax=Algoriphagus TaxID=246875 RepID=A0A1G6S7L3_9BACT  ali  14  6.SIYEAVG-KDTIQELAAGFYREVAQNEDLRRLYPEQDLQPAERRLFLFLVQVFGGPQTYSEERGHPRLKMRHFQWKIDPKMRNHWLNAMFASMDKLELDPQVRELMMNYFVKVAN--HMVN. 123
545 2.000e-25UniRef50_A0A2U2BX86 Group 1 truncated hemoglobin n=1 Tax=Marinicauda sp. WD6-1 TaxID=2135793 RepID=A0A2U2BX86_9RHOB  ali  29  2TTIYDRYGGFAKLRKVISDFYERVLDDQRLSPFFEHIEMARLIDHQTKFIASITGGPASFTNSQLQRAHARL----GITSGDFRAVVQLLEETFEDHGFESADIAQVMREVR........... 109
546 2.000e-25UniRef50_A0A1U9NCM6 Globin n=3 Tax=Cellvibrio TaxID=10 RepID=A0A1U9NCM6_9GAMM  ali  25  28PSLYEALGQQAGIDKITHQLILNFARDERVKHRFKGVNMQKFKTGFVTYVCAIVEGPCQYKGDDMKTIHSG----YGFTNTEFNAVVDNLILAMEQCAIPVSTQNRLLAKLAP--SYDDVVYR 144
547 2.000e-25UniRef50_A0A1X7MCL6 Globin, truncated bacterial-like n=1 Tax=methanotrophic bacterial endosymbiont of Bathymodiolus sp. TaxID=280772 RepID=A0A1X7MCL6  ali  46  1.......................MLSDHRINRFFAKTDMEEQLAKQKAFFTMAFGGPNNYTGGDMRTVHARLV-KMGLDSSHFDAVMEHLGATMTELGVPGNLIAQAAAIAEST--RKDVLGK 97
548 2.000e-25UniRef50_A0A2N3ULR8 Truncated hemoglobin YjbI n=87 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3ULR8_9ACTN  ali  18  105PTLYEWAGGQPAMERLFTRFYQRVDEDPLLAPVFADKEPDHAL-RVAAWLGEVFGGPARYTERGGHRHMAARHLGRGITEQQRRRWVALLLDTADEVELPPEFRAVLAYYLEW.......... 219
549 2.000e-25UniRef50_A0A1P8WG92 Hemoglobin-like protein HbN n=1 Tax=Fuerstia marisgermanicae TaxID=1891926 RepID=A0A1P8WG92_9PLAN  ali  30  7.TLFDRIGGQPAVNDMVDEFYGRVLADPELRPFFDETSVDKLKHMQTEFFAAALDGPMSAGDRDLAKVHQGR----GITRAHVTRFVDHLISVLDERN--AITRRDAMDIVFRIATYSDQV.. 120
550 2.000e-25UniRef50_A0A1Q7UDY3 Uncharacterized protein (Fragment) n=19 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1Q7UDY3_9BACT  ali  27  21PTLYKRLGGREGIRGVVDDFVAFLVADPRVKDRFTPAQVEKLKTNASDQICDATGGPCSYLGKDMKAAHTGMN----ITEADWSATVEDLIKALDKRNVAKKDQQELIGLLAPMK........ 134
551 2.000e-25UniRef50_D8TTN6 Uncharacterized protein n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8TTN6_VOLCA  ali  28  27..LY-RLGGADVVKRIVEAFYRRLYANERLLLFLHDKDVISLRAKQAAFMSWLFGPPNQYSGKNLRIAHLRLIKQRGFSPEDFEVGLVYFADAMRELGSPEAIVSEVMSKMRPFK........ 139
552 2.000e-25UniRef50_I0K8X0 Hemoglobin n=5 Tax=Cytophagales TaxID=768507 RepID=I0K8X0_9BACT  ali  21  30.........EADIAYFLDRFYARVRQNPELGYLFDGVDWPTHLPKIQAFWSSLLLGTNSYQGQPMRP-HFELAQKAPIRPGHFDQWLALFSQTLAECFAGERANERAQSIAAVMQSRLH.... 144
553 2.000e-25UniRef50_W0EUP2 Globin family protein n=2 Tax=Niabella TaxID=379899 RepID=W0EUP2_9BACT  ali  17  4.........RADVERLVNSFYDRVRSNAVIGPIFNDIDWEHHLPKMYSFWSSILLGEQSYSGNPM-VRHIELSRMTAMTETEFSEWLRLFNETIDALFEAEEAKTRAANIARLMLFKIQ.... 118
554 2.000e-25UniRef50_F1VZU8 Hemoglobin-like protein HbO n=12 Tax=Proteobacteria TaxID=1224 RepID=F1VZU8_9BURK  ali  19  8..LYDLIGGDARVRELVDRFYDLMDLEPEFARALHPAALDGSRDKLYWFLSGWSGGPDMYIERFGHPRLRARHLPYPIGVSVRDQWMQCMAFALQDIGVEEGLRDRLIATADWMRNR...... 128
555 2.000e-25UniRef50_A0A2N8GHG1 Group 1 truncated hemoglobin (Fragment) n=1 Tax=Pseudomonas sp. FW305-BF6 TaxID=2070673 RepID=A0A2N8GHG1_9PSED  ali  42  3.......................VLKDKTVSHFFEHTDMEKQRKHQAKFLSFALGGPNQYSGRSMAKAHEGM----NIQPEHFNAIAKHLHDALAHFGVSESDIDQALT.............. 84
556 3.000e-25UniRef50_A0A2D6BUQ5 Uncharacterized protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2D6BUQ5_9DELT  ali  19  9.SPYLRLGKEEGIRRLVELFYQYMSELPEAATIMHAEDISPMEDKLTVFLTGWMGGPERYRERFGRVIIPAAHEPYPIGSAERDQWLLCMRHALDAVEAEPDLIEMLMPAFTQMA........ 124
557 3.000e-25UniRef50_C1AVS0 2-on-2 hemoglobin n=53 Tax=Actinobacteria TaxID=201174 RepID=C1AVS0_RHOOB  ali  14  11.TFYEAVGGAETFRKLTARFYEEVAKDDIVRPLYPEEDLGPAERRMRMFLEQYWGGPHTYSDERGHPRLRMRHHPFKIGPIERDAWLRCMHTAIASIDLDDAHRKALREYMDMAA--ASMVN. 132
558 3.000e-25UniRef50_A0A2K3CTK3 Uncharacterized protein n=2 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A0A2K3CTK3_CHLRE  ali  24  52TPLLARVGGIDNVKRVVEGFYRRLYADERMDKYLSGFDMPYLRAKQSAFM-GWLFGPAPYSGKHLRTVHLKMIKQQGFSPEDFEVGMDYFEESMKELGAPETIISEVMSKIRPFK........ 167
559 3.000e-25UniRef50_A0A1R2AWI8 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2AWI8_9CILI  ali  30  2.SVFERVGGTPAVTALIDNFYVKIMASPLVTPTFAGRDISVIKAHSVAYFSSALGSGVAYEGRTILQSHTGL----GVTEEQYNAVAAMLVATMNEMNISADIQAEIVRVATSI--KAEIVG. 116
560 3.000e-25UniRef50_UPI000D93B21E group III truncated hemoglobin n=1 Tax=Deinococcus yavapaiensis TaxID=309889 RepID=UPI000D93B21E  ali  23  6GTLYDRMGGARSVEKLVHAFYDQAARDPVLSPVFPGAWWARHLTKMVRFWTSVSGGPPYYHGSPVLA-----HDGFGIEARHFDAWLTLWHDVLFD-SLEEDVARELLVRATRMRH....... 122
561 3.000e-25UniRef50_A0A0E3ZX93 SEC-independent protein translocase TATC n=19 Tax=Bacteroidetes TaxID=976 RepID=A0A0E3ZX93_9BACT  ali  24  10..........EAVRFLVDSFYKKVQADSLIGPIFTNVDWSKHLPKMYAFWESLILGNNAYDGHPFRP-HLIINQKHTLTIEHFERWLQLFSATLSENFTGESARQRATQIALVWNNKLEYIN. 126
562 3.000e-25UniRef50_D8UFV6 Uncharacterized protein n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8UFV6_VOLCA  ali  39  5ATLHAKLGGAAAVAATVDIFYKKLMGDPDLAPFFHGVDMVTLIAKQNRFLAYAFGATSHYHGKDIVMGHAHLIINRGLNLSHFDKVAGHFVDSLKEMGVTQELIDDAAGVL............ 115
563 3.000e-25UniRef50_A0A095SWH0 Hemoglobin-like protein n=6 Tax=Flavobacterium TaxID=237 RepID=A0A095SWH0_9FLAO  ali  19  8.........RKDIEKLVNAFYEKIKTDEVIGYLFANVNWELHLPKMYNFWENILFYTANYEGNPMAK-HKALHEKSTMTKAHFQHWIDVFNKTVDALYEAEEIKNRAMNIATAMMYK...... 120
564 3.000e-25UniRef50_A0A258SZ91 Group 1 truncated hemoglobin n=6 Tax=Nitrosomonadales TaxID=32003 RepID=A0A258SZ91_9PROT  ali  19  29ATLFERIGGIPVLTVVVSETIDSAAQHPKLERTFKGIKLATLKESVVNQLCVLSGGDCKYEGETMKNSHADL----KITTAEFELFVQAMRDSLNRH-VATREKNELLKLLAPMKR--DIVHQ 144
565 4.000e-25UniRef50_I3BVY1 Globin n=13 Tax=Proteobacteria TaxID=1224 RepID=I3BVY1_THINJ  ali  16  6ASHYNMLGGEAGIHRLVDRFYDLMDELPEAWELRHPQDLQGSRDKLFKFLSGWLGGPGLYEAEYGHPRLRMRHMPFPVDSQMRDQWLLCINMALDEQVQDNLLKNQLKNVADHMRNR...... 128
566 4.000e-25UniRef50_UPI0009E7B159 group 1 truncated hemoglobin n=1 Tax=Kordiimonas lipolytica TaxID=1662421 RepID=UPI0009E7B159  ali  32  20..........DKLDKVVSRFYDLLVANPLISEFFKDPDVNALKRKQVWFFSSLLMETNQGTHDYMRQAHKGLVMKRKLTDEHFDALLECLVQALDESELTPDEAKTIVQSAEHL--RDAVLYR 130
567 4.000e-25UniRef50_C7PCY5 Globin n=10 Tax=Bacteroidetes TaxID=976 RepID=C7PCY5_CHIPD  ali  20  17..........EDVRQLVYTFYDKVRADALLGPVFEGSDWEPHLQIMCNFWSTMLLYSGKYRGDPMSK-----HMSLPIDPQHFSQWLALFTATLDSLFVADNAKARANNIARIMQ........ 122
568 4.000e-25UniRef50_A0A2P5LMN3 Globin n=443 Tax=Bacteria TaxID=2 RepID=A0A2P5LMN3_9GAMM  ali  14  5.TPYEMIGGEKAVQGLVDRFYFFMDTLPEASAVRHGSSLTSARTKLFKYLSGWLGGPDLYVAEYGHPRLRQRHFPFKIGRQERDEWMLCMTKALQEMPMADALRQDLLSALEQLA--SHMINQ 126
569 4.000e-25UniRef50_H8KRM2 Truncated hemoglobin n=35 Tax=Bacteria TaxID=2 RepID=H8KRM2_SOLCM  ali  22  5PTLYEWVGGNDALEKLTEVFYDKVLKDDLLYPVFKNMS-GNHSKHVAHFIAEVFGGPSLYTQKGSHATMVAHHLGKMLDEQKRQRWIQLLLQSADEIELDPEFRSALVAYLEW-GSRIAVIN. 128
570 4.000e-25UniRef50_E1VJA8 Putative globin n=1 Tax=gamma proteobacterium HdN1 TaxID=83406 RepID=E1VJA8_9GAMM  ali  14  3TTPYELLGGEAGLRKLTHTFYDVMDRLPEAKEVMHDGNLDSIKERLFEYLSGWLGGPQLFRERHGSVCITSQHKKFSIGPAERDQWLMCMDVALDEVGASAETKAMLKEPIYRLA........ 119
571 4.000e-25UniRef50_UPI000D0B8AA1 group 1 truncated hemoglobin n=1 Tax=Halomonadaceae bacterium R4HLG17 TaxID=2081032 RepID=UPI000D0B8AA1  ali  21  50..LYQALGGQTGIAAIVETFLYRLADDDRVVRRFDPRQIDYVQKVLNEQVCMLSGGPCHYSGDSMVRVHKGM----KITEAEYQAVVEDFSYALYRQDVPVPTQQQLLERMAQLH--DGIVG. 163
572 4.000e-25UniRef50_D9QNS8 Globin n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=D9QNS8_BRESC  ali  28  61TAMWEAFHGEAGVSRIVDAFVARNVADPRIAGTFVSHDLIRLRRTLKEQFGYILGGPVTYSGRDMESSHRDL----GLQAADMGALVENLQAAMQAEGISFPAQNRFLAKLAPM--KPDVVTR 177
573 4.000e-25UniRef50_A0A2S9GSQ7 Bacterial-like globin n=2 Tax=Solimicrobium silvestre TaxID=2099400 RepID=A0A2S9GSQ7_9BURK  ali  21  44...FQSFGGKAGISKIIDDFLVIWHADPRISAKLEDADVPHLALLLKEQITHLTGGPGVYSGKDMKTVHDGMN----LRNVDFNALTEDLQHAMDKNDVPSRAQNKLLAKLAPMQH--DIVTK 157
574 4.000e-25UniRef50_Q0KAM9 Truncated hemoglobin n=9 Tax=Bacteria TaxID=2 RepID=Q0KAM9_CUPNH  ali  23  32ASLYDRLGGLKGITIVVDDFIDRLVTNPAINAGRKSSPPPYLKFQVAQLVCEASGGPCKYTGKPMKESHAHLN----ISEREWDVMAEEFKKSLNKFKVPAAEQKELFDIVG--KTKADIVVR 154
575 4.000e-25UniRef50_A0A0M4I881 Sec-independent protein translocase TatC n=19 Tax=Bacteria TaxID=2 RepID=A0A0M4I881_9BACT  ali  22  13.........EADIRLLVDRFYDKVNADALLSPIFNEVHWEKHLPTMYDFWSGLLLGTGRYRGRPFPK-----HLVLPVDSQHFRRWLTLFTETVDAHFVADEAIRKAGNIATIFEYRIH.... 123
576 4.000e-25UniRef50_A0A2P8AX52 Group 1 truncated hemoglobin n=67 Tax=Actinobacteria TaxID=201174 RepID=A0A2P8AX52_9ACTN  ali  40  11.SHYERIGGAAAVKAAVELFYDKVLADPDLAGYFTGVNMPEQRRHLALMLAVVLGGPNEYAGRGLAEAHQPL----NIPVAHYVKVGEHLTATLVELGVPADVIADVHVVLGQVQDQ...... 122
577 5.000e-25UniRef50_X1JA85 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1JA85_9ZZZZ  ali  30  6...FEKLGGRPVIEAVTKTFYDKVYKHPWLGKFFQNLHQEHVEKQQVDFMQQALGGPKVYSGQPPVLAHMHIN----ITEELFELRTSLLLESFKENNASPELILRW................ 105
578 5.000e-25UniRef50_A0A178LRW3 Group 1 truncated hemoglobin n=2 Tax=Mycolicibacterium TaxID=1866885 RepID=A0A178LRW3_9MYCO  ali  37  2.SLFDQIGGPSAAAAAVDDFSRRLIADPALTPYFDGVDMRRLKADQRSFIAAALGGQEPHLGRSMRESHAQL----KIQAAHFDRIADHLVETLSDLGVSGAIIEQVGTNLAPLK........ 111
579 5.000e-25UniRef50_UPI0008D34F8B globin n=1 Tax=Aliicoccus persicus TaxID=930138 RepID=UPI0008D34F8B  ali  20  2STLFEKVG-EERLHRMIDTFYGYVSQDEILLKIFP-QNWDEIAYKQKLFQTQFLGGPNLYIQEFGHPMMRARHMPFRITDIEKEAWLKNMRRAMQDVGLEEELQKALMDRYE........... 111
580 5.000e-25UniRef50_A0A059DVP8 Uncharacterized protein n=4 Tax=Hyphomonadaceae TaxID=69657 RepID=A0A059DVP8_9RHOB  ali  23  27.........EALVSRLVDTFYARVREDDLLGPIFQGDDWDPHLAKLKDFWSAIALGTRRYNGRPMPPHLR---LSGRISEAHFARWLGLFRQTVDELMPNPAAADFFYDRA............ 128
581 6.000e-25UniRef50_R4YL30 Globin family protein n=2 Tax=Oleispira antarctica TaxID=188908 RepID=R4YL30_OLEAN  ali  20  75.SLYHDIGGHEGIERIVNIFVQKIAQDKYMLPYFAKSNVTHFKKGFISHLCDAVGGPCKYEGDTMSDIHTGMN----ISKKDFNRIVELLISAMEGADISYQSQNKILKELA--ASRDKII.. 188
582 6.000e-25UniRef50_A0A257CCU8 Group 1 truncated hemoglobin n=2 Tax=unclassified Burkholderiales TaxID=119065 RepID=A0A257CCU8_9BURK  ali  20  71..LYRALGGEQGLNTLVDRFMNGLLADQRMNPFFAKIDHAETRKQLALQFCQVSGGPCERKANN-----RKIHSAMDISRTDFNVLVQVLQQAMDEQAIPFAVQNRLLAQLAPMHR--DIIN. 183
583 6.000e-25UniRef50_L9PJ22 Uncharacterized protein n=5 Tax=Oxalobacteraceae TaxID=75682 RepID=L9PJ22_9BURK  ali  25  31...YRGLGGKEGIKKIVDTFVPMLLADPRIKDSFADFDMVQLNVRLQEQFCEFAGGPCKYTGRDMATVHQDL----KITNAMFNALTEDLQIAMEQNNVPSSVSNKLIAKLAPMQR--AIVT. 156
584 6.000e-25UniRef50_A0A1V5ATM7 Bacterial-like globin n=2 Tax=Methanothrix TaxID=2222 RepID=A0A1V5ATM7_9EURY  ali  29  4.TLYERLGGYDAIAFVVDSLMARLRDDARLARYFAGHGEDRLRQLQVDMICQATGGPCFYLGREMRTVHKGL----GIDGGDWQTMITHLVGVLDSFKVSDAEQKDVLKLLNSI--KNDIVER 122
585 6.000e-25UniRef50_UPI00068BFAF4 group III truncated hemoglobin n=1 Tax=Deinococcus misasensis TaxID=392413 RepID=UPI00068BFAF4  ali  23  6..LYENIGGRPTIEKLVRTFYQNLNQIPEMKRVFAEQWWERHIQKLTDFWTGVLGGPKNFRGSPPVA-----HLGLGLNTDHFNKWLSVWEHTC-EQELPEEAAVFLMQAAGRMR........ 119
586 6.000e-25UniRef50_UPI0009DBF88D group 1 truncated hemoglobin n=1 Tax=Flectobacillus major TaxID=103 RepID=UPI0009DBF88D  ali  33  156TPLYARLGANAGISAVIDDFLGKVAADSRINSFFDPARLAKLRNNLINQVGQASGGTEKYTGLDMKTAHKGM----KITDAHFNALVEDLTASLVKFNVQSKAKIELLTALGSM--RADIVGQ 277
587 7.000e-25UniRef50_X7YXE5 Bacterial-like globin family protein n=54 Tax=Bacteria TaxID=2 RepID=X7YXE5_MYCKA  ali  24  5.TLYERLGGYDAISAVSHDLVDRLQKDPQLGRFWQHRGEDGLKRLLVDFLCAATGGPMYYRGRDMALTHRGM----RISESDWAIFLQHADATLKRFEVPQPEYDEVVAFVQTT--KGEIV.. 121
588 7.000e-25UniRef50_A0A1E4NPX9 Globin n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E4NPX9_9GAMM  ali  27  35PSLYDRLGGLAPISVVVSDFIDVIVPDPVLNRARKRVPAAYLKYQVTALVCQATGGPCRYQGRAMKDSHVQLN----ITEHEWDRMLILFKQVLAEHEVPTHETQELLGIVDST--KADIV.. 155
589 7.000e-25UniRef50_C6WVQ1 Globin n=19 Tax=Proteobacteria TaxID=1224 RepID=C6WVQ1_METML  ali  25  29SSLFERIGGLPVLTLVVSETIDTSASDPKLKRSFDGVKLATLKQSVVDQLCVLTGGNCVYEGETMKNSHRDL----KVTSAEFELFVETFRTSLNKH-VGVKEKNELLKILAPMKR--DIVT. 143
590 7.000e-25UniRef50_K9HGA2 Cyanoglobin Hemoglobin-like protein HbN n=2 Tax=Caenispirillum TaxID=414051 RepID=K9HGA2_9PROT  ali  33  3.TLYARLGGPAAVARLVFDFYDRVLKHERLAAFFATTDMARLVDHQARFLGSVMGGPAAQSDGRLREVHAGL----DIRPEDFDAMLGLLQEALQAHAVAPADVEHVMAEMR--RRRPLIV.. 116
591 7.000e-25UniRef50_J9HQW3 Putative hemoglobin n=2 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9HQW3_9SPIT  ali  27  61SSLYERIGGYEGCLKIVEGMYAKTFNDPDLADFFRKSDKGHQVQKMTLFFVYTTGGKEDWEGKSMKE----MHQGKGIGSHQFEKMVGHIRHTMLEIGLMEELIDELIERLDLLK........ 171
592 7.000e-25UniRef50_UPI000A04A54A group 1 truncated hemoglobin n=3 Tax=Cellvibrionaceae TaxID=1706371 RepID=UPI000A04A54A  ali  24  36..LYQALGGAKGVDAIVYELIVRIADDERVVDRFHNVDISRFKAGLETYICSVANGPCDYTGDSMQVVHAGHQY----TDTEFNTIVQLLIEAMEAEGVPTVTQNRLLARLAP--DYEAIVYQ 150
593 8.000e-25UniRef50_A0A2G3JXE2 Uncharacterized protein n=1 Tax=Janthinobacterium sp. BJB412 TaxID=1871178 RepID=A0A2G3JXE2_9BURK  ali  21  32.STFRGLGGKAGIQAIVATLIPLATADARIREQFVDTDLKQLAERLVEQLCEFSGGPCRYTGKYKDRDMASAHVDLKISNAQFNALTEDLQLAMAAHGVANAVQNKLIAKLAPM--RRDIVT. 150
594 8.000e-25UniRef50_A0A090LWE8 Globin n=232 Tax=Bacteria TaxID=2 RepID=A0A090LWE8_STAAU  ali  22  3TTPYDIIG-KEALYDMIDYFYTLVEKDERLNHLFPG-DFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMAFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTAN--HMVN. 120
595 8.000e-25UniRef50_A0A1H6WXE1 Hemoglobin n=8 Tax=Cyclobacteriaceae TaxID=563798 RepID=A0A1H6WXE1_9BACT  ali  14  12........GEEKIHQLVDHFYEEVERTPDLRKLYP-KDLEPARQRLYWFLLHVFGGPATYLEKRGHPMLRRRHFQWAIDPEMRDRWLGCMGKALDQIPMEAEAREAMSTYFYRAAQ--HMVNR 123
596 8.000e-25UniRef50_D3DFC2 Cyanoglobin family protein n=3 Tax=Bacteria TaxID=2 RepID=D3DFC2_HYDTT  ali  30  30.SPFERLGGEAGIRKVVDDAVPCLATDPNIGIFFRGDSLERIKVCLTKQLCAAAGGPCTFTCRPMRAAHQGMVGPKGIANDDVDSFKACVQKSMQKNGVPDDLQQAVLNILES--QRNDVV.. 169
597 9.000e-25UniRef50_A0A1U9Z0X4 Hemoglobin-like protein yjbI n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A1U9Z0X4_9RHIZ  ali  20  8.TLYEAIGGADAVERLVRRFYELMDTLPEAARAIHPAELSGSEAKFRDYMTGYLGGPPVYVEKHGHPRLRMRHMPAPIGPEERDEWLLCFRRALEETVPDIRLRAVIMKLAYHMQNRS..... 130
598 9.000e-25UniRef50_UPI00026C97B7 hypothetical protein n=1 Tax=Sphingomonas echinoides TaxID=59803 RepID=UPI00026C97B7  ali  32  206.SWYERIGGDATITAIVDVYYRNILADSFVASLFQAPDTEAQRLRLKSFVSMAFGGPHPSTGQDLHRVGDRLASGMVFTEPHFDRVVEILKQTLESLLVHEEAIRQAMAAVEATRH--DILAR 325
599 1.000e-24UniRef50_J2JSI6 Hemoglobin like protein n=55 Tax=cellular organisms TaxID=131567 RepID=J2JSI6_9FLAO  ali  23  7.........REDIEHLVNSFYAKVVKDETIAFFFNDVDWDKHLPKMYSFWETILFGQMSYKGNPM-AVHFPINQVEAMEKKHFDKWLELWRNTIEENFIGENAIYKSENIARLMAHKMEM... 122
600 1.000e-24UniRef50_A0A257UT36 Uncharacterized protein n=2 Tax=Acidiphilium TaxID=522 RepID=A0A257UT36_9PROT  ali  25  45TSHYQEFGGAPGMSSMVNDFVNRVTSDPRIRAYFTHTNIPALKAALTNQFCNLEGGDCPFD-MNMHTVHQSL----GVTQAAFNALANDLTITMDNHHVPMDAQNNLLAKLAAME--PQVVTK 160
601 1.000e-24UniRef50_A0A0H4VTS2 SEC-independent protein translocase TATC n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A0H4VTS2_9BACT  ali  16  12.........EEDIKTLVDTFYGHVNQDDLLSPVFNEVDWEHHLPKMYQFWSTVLFGSMAYKGQPFPK-----HFSMPIDRTHFTRWIALFNQTVEELFMADQARQKATSIANIFQMK...... 120
602 1.000e-24UniRef50_A0A254VUR3 Uncharacterized protein (Fragment) n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254VUR3_9CYAN  ali  27  8.TLYERIGGRPVVEDAIGRFYDRVFGDPHLAPWFRGVTLSKLRAMQVELFTAALDGPATYSDQALHDAHAGR----GIGDRQVSQFLEHLLATLLEMGIEADDADQVVHRIAMLA........ 117
603 1.000e-24UniRef50_A0A1I1L1Y0 Hemoglobin n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1I1L1Y0_9RHOB  ali  17  32.........EPTLTTLVHSFYDRIQQDPMLGPIFAATDWPPHLDRMVAFWSSVALMTGRYHGAPVPK-----HMHLPVDDSHFDHWLSLFEDTARKVCTPEHVIERAHRIARSLR........ 137
604 1.000e-24UniRef50_A0A1E3VX81 Globin n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A1E3VX81_9RHIZ  ali  17  1..MFARIGGADGVARLVETFYGRMDTLPEARTIMHAPDLSATKEVLRRYLGEWMGGPKLYSAERGHPRLRSRHIRFRIGKAERDAWLTCMRQALDETVADAALRDELYEAMAKLAN....... 116
605 1.000e-24UniRef50_A0A2H0QAB6 Globin n=1 Tax=Bdellovibrionales bacterium CG11_big_fil_rev_8_21_14_0_20_38_13 TaxID=1973928 RepID=A0A2H0QAB6_9PROT  ali  21  22.STYHDFGEKKGIEKVVDDLFVYLLKDERTKESFQRLNLDKTKEGLSNFICVTLEGPCKYEGQSMKRAHKG----QEITERQFYGMVENMQKAMNKNNIPQRAQNKLLGKLAAMH--KDIIG. 136
606 1.000e-24UniRef50_A0A150GRR5 Uncharacterized protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150GRR5_GONPE  ali  29  58..LLERIGGHDAVKRVVEAFCRKLYADERLVPFLQGRDIVYMRAKLSNF-TTWLFGPSPYTGKHMRNAHLRLIKERGFTPEHFERGIAYFHEA--------NLVNEALAKLRPFK........ 163
607 1.000e-24UniRef50_A0A2K8YVI3 Sec-independent protein translocase TatC n=6 Tax=Spirosoma TaxID=107 RepID=A0A2K8YVI3_9BACT  ali  25  10..........EAVRFLVDSFYEKVQADAFIGPVFTDVDWTKHLPKMYAFWESLILGNNAYDGHPFRP-HLIINQQHTLTIDHFDRWLKLFSATLSENFTGEEVRQRATQIALVWANKLEYLN. 126
608 1.000e-24UniRef50_B7RWE6 Protozoan/cyanobacterial globin family protein n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=B7RWE6_9GAMM  ali  19  6.TPYQLLG-EDGIHALTNAFYDIMDELPEVARAMHAQDLTPMKQKLAMYLTGWMGGPPRYADKYGTVCMTEPHEPYHIGPEQRDQWLLCMDKALEKTNASEELVEMLFRIADAVRNRD..... 127
609 1.000e-24UniRef50_UPI0003FC3CA6 group 1 truncated hemoglobin n=2 Tax=Novosphingobium TaxID=165696 RepID=UPI0003FC3CA6  ali  20  37...YTEFGGKDGLTALMDDAMNRWLVNPRTRPFFEHADQARIKHLLVQQFCVVLNGPCTYEGRSMAESHRGLQ----VTEGAFYALVEELQIAMNQRHIPFPAQNRLLAALAPMH--KDIVTK 150
610 1.000e-24UniRef50_M5RR10 Globin n=4 Tax=Planctomycetaceae TaxID=126 RepID=M5RR10_9PLAN  ali  20  6PELFDRMGGAEALSAIVKDMYERIFKDPELAPFFQNVQTDRLRKMQYEFLASAFQGPVNYTGAELTAIHHNR----GIHAGHFAKFCSHFADAARAHGAREADVDQALGQLATYKDKI..... 119
611 1.000e-24UniRef50_A0A0R0MNY5 Uncharacterized protein n=1 Tax=Curvibacter sp. PAE-UM TaxID=1714344 RepID=A0A0R0MNY5_9BURK  ali  24  209PALWAELGDGRVVRQVLEAFYARVYEDERLRHFFEGVTLDRSIDKQFSFLKQCMTGEKVYMGDRPRNAHHWMI----ISNELFDYRQQLMEETLRSHGLSAEQIARWTRYEEVF--RPDMV.. 323
612 1.000e-24UniRef50_A0A2C9DDY4 Uncharacterized protein n=14 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2C9DDY4_9RHIZ  ali  17  16.TLYEAIGGEPTVDRLTRRFYELMDTLPEAARAIHPESLEGSREKLFMYLTGWLGGPQLFVQKHGAPMLRARHLPFSIAEEERDGWLVCFNQALDETVANERVREMIRENVTHMQNR...... 137
613 1.000e-24UniRef50_C1N9B0 Predicted protein (Fragment) n=1 Tax=Micromonas pusilla (strain CCMP1545) TaxID=564608 RepID=C1N9B0_MICPC  ali  47  1TTLFERVGGEDALTAAVDLFYEKNLADDRIASMFEGADMDALKKHQFNFMRVAFGGDASYGGRGIFAAHKNLMLEKGLDERHFDCVAENLVATLREL.......................... 98
614 1.000e-24UniRef50_C5KVP4 Myoglobin, putative n=1 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5KVP4_PERM5  ali  45  17..................RFYKKNLSDDRIKEVWAKTDMNKLKDHQRSFLTYVFGGSNNYTGRSMRAAHAG----YNITDAQFDAVVENLTNTMKELGIAQEYVDQVNAIAKSEH--DDVVG. 114
615 1.000e-24UniRef50_A0A257WHP1 Hemin transporter n=2 Tax=PVC group TaxID=1783257 RepID=A0A257WHP1_9BACT  ali  16  8STVFDQFG-AAGLARLVAAFYRQVPQDDLLGPLYPPEDLAGAEERLCDFLIFRCGGSSRYLETRGHPRLRMRHGPFVIGSAMRNRWVALMDRALDEVAFPPDADAELRRFLHDTA........ 121
616 1.000e-24UniRef50_A0A0D5BQ31 Group 3 hemoglobin ctb-like protein n=62 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0D5BQ31_ELIMR  ali  21  7.........REDIESLVNKFYQKIQTDNKIGLFFNDVDWSKHLPKMYDFWESILFGQMTYKGNPMR-MHFPVNEIKAIEKEHFEHWIKLWTETVEENFSADLAIYKANNIASLMAYKMEMARR 125
617 1.000e-24UniRef50_A0A2A6AVM9 Hemoglobin-like oxygen-binding protein n=1 Tax=Alteromonas pelagimontana TaxID=1858656 RepID=A0A2A6AVM9_9ALTE  ali  15  20ATPYEAIGGEESVKLLANRFYDIMESDPLASDLLHPKPLDRIRHIFFLYLTMWLGGPDDYQQLQGHPRLRARHLPFAVTPDLKAQWMYCMRKAMMQTVTDIALADKLLSTLDSLA--DHMIN. 141
618 1.000e-24UniRef50_D9QFN8 Globin n=31 Tax=Bacteria TaxID=2 RepID=D9QFN8_BRESC  ali  22  5PSLYDWLGGRDALVTLTTEFYRRVALDEVLSPVFAHMDAD-HPDHVADFIGEVLGGPALYDPSDGHVRMIGHHLNRHLNEAQRRRWFDLLLTTADDVHLDPEFRSAFVGYLEW-GSRLAVIN. 127
619 1.000e-24UniRef50_A0A1Y6BTM5 Hemoglobin n=2 Tax=Bacteria TaxID=2 RepID=A0A1Y6BTM5_9NEIS  ali  21  39TSLYDRLGGLKGITVVVDDFIDRLVKNPAISAGRKSSPAPYLKFQVSQLVCEVSGGPCKYTGKTMKESHAHLN----ISEQEWDVMAMEFKRTLNKFKVPEAEQKELFDIVG--KTKGDIVAR 161
620 1.000e-24UniRef50_D8TTN4 Uncharacterized protein n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8TTN4_VOLCA  ali  26  55..LFQRVGGLGVVKQIVEGFYRRLYSDPTLLVYLHDKEMVYLRARQTAFMAWLFGPPNPYGGKNLRVAHLKLIKQRGFCPEDFELGMEYFTAAMRELEVPELTIREVMSKVRPFK........ 168
621 1.000e-24UniRef50_A0A1B4Y4B1 Globin family protein n=1 Tax=Mycobacterium ulcerans subsp. shinshuense TaxID=1124626 RepID=A0A1B4Y4B1_MYCUL  ali  38  14.SIYDKIGGYEAIEAVVEDFYVRVLADDQLGGFFTGTNMNRLKDKQAEFFVAALGGPEPYTGAPMKQVHQGRRNHHG.............................................. 89
622 1.000e-24UniRef50_A0A1Y5EW23 Uncharacterized protein n=1 Tax=Cycloclasticus sp. 44_32_T64 TaxID=1856282 RepID=A0A1Y5EW23_9GAMM  ali  25  4.TLFKRIGGLETLQKVHRIFYDKAYSHEWLKLYFTDKPQTLLEDQQTDFMAQLIGGPKRYAGKTPRMAHQHIH----ITEDLFTLRQRLLKESLEEFGLAEHLIKEWLMADTALKR....... 114
623 1.000e-24UniRef50_UPI0009FB0908 group 1 truncated hemoglobin n=1 Tax=Aquabacterium parvum TaxID=70584 RepID=UPI0009FB0908  ali  22  35PPLFQQLGGVEGIQAVSSAMLQRMSTDPRTKRTFDGINLRTLSASLAAHLCKVADGPCVYEGETMRNAHADL----GLGGSEFETTVQMLRDELDRAGVPQGAKNELLRRLAP--SRRDIVT. 150
624 1.000e-24UniRef50_A0A257NDW0 Hemoglobin (Fragment) n=1 Tax=Methylococcaceae bacterium NSO1 TaxID=1917483 RepID=A0A257NDW0_9GAMM  ali  44  1.........................NDDLVSHFFKDTDMERQRLKQKSFLAMAFGGPDQYSDLDMRTAHKPLIEKYGLSDVHFNRIMEIFKETLTELNISANELQRMMEILESM--RDAVLNR 96
625 1.000e-24UniRef50_A0A1C0U3K7 Group 2 truncated hemoglobin YjbI n=45 Tax=Bacteria TaxID=2 RepID=A0A1C0U3K7_9GAMM  ali  15  6PTLFEWMGGREVLMKLMATFYAKVEKDELLAPMFSRMSSD-HPEHVAIWLEEVLGGEPNYTARGGFKGMISKHRGRNIQPEQRKRWVDLMMECADEVNLPPEFRSAFAAYIEWGSRRAQ.... 126
626 1.000e-24UniRef50_A0A2D8RCM5 Group 1 truncated hemoglobin n=1 Tax=Hahellaceae bacterium TaxID=2048971 RepID=A0A2D8RCM5_9GAMM  ali  20  40..LYRALGGLEGIEGIADQFLFRLSGNDKIVHFWQNTNIERFRTQFVSHLCELSGGPCRYEGDSMADVHRGM----DIRQSHFNSVAETLALAMEDQGIPTAAVNALLARLAPLH........ 148
627 2.000e-24UniRef50_K2M364 Globin family protein n=40 Tax=Alphaproteobacteria TaxID=28211 RepID=K2M364_9PROT  ali  20  31..........DMIKNIVHGFYAKVRDDDLLGPVFDEKNWDHHLDRMVMFWSSVALATGNYDGRPMQK-----HLPLKITRHHFDRWLQLFAQTLSEFCEEPAARERALRIASSF......... 134
628 2.000e-24UniRef50_B9XPB2 Globin n=3 Tax=Verrucomicrobia TaxID=74201 RepID=B9XPB2_PEDPL  ali  25  84..LFDRLGGEKGITAIVEDATPRILQDPRVNFVFHRDNITMLKKHLVQFISLASGGPSKYEGKGMKSVHAGMN----ISNPEFDAAVGDIKASLDKLQIPNTEQKELLAIVEST--RPEIVT. 217
629 2.000e-24UniRef50_A0A1I1I1V6 Hemoglobin n=1 Tax=Marinospirillum celere TaxID=1122252 RepID=A0A1I1I1V6_9GAMM  ali  14  24...YQAAGGEQGLRKLCQAFYQAMDELPEAARAMHKEDLSELEDKLSLFLCGWLGGPIRYRDKYGPIVIPQAHAHLDIGPEERDAWLKCMQVALDQQNYTQEFKAYMMQSL............ 133
630 2.000e-24UniRef50_A0A1W9JC70 Uncharacterized protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1W9JC70_9PROT  ali  22  46...FEAFGGKEGLVKIMDDFMIGLVADPRTKPFFDNNKQTFIKAMLVEQMCELMNGGCKYPGRDMKASHANM----KVNREGFNALVEQFQFAMDKHNVPFSAQNKLLAKLAPMYR....... 154
631 2.000e-24UniRef50_A0A1H7CLL6 Hemoglobin n=6 Tax=Deinococcus TaxID=1298 RepID=A0A1H7CLL6_9DEIO  ali  18  23PTLFDRIG-EEALRRVLWQFYARVMDDPDLAPVFPGAGWPLHIARLEGFWRAVTHGPSAYRGQPG-PAHQGL----GICSAQFDRWLALWEETLQGQ-LPPAEAGDLLQLARRMR........ 137
632 2.000e-24UniRef50_A0A0L8AHI3 Uncharacterized protein n=9 Tax=Cytophagales TaxID=768507 RepID=A0A0L8AHI3_9BACT  ali  16  7.TLYERIG-EENILKLVDDFYAELEQDELIRKMYPE-DLLPAKNRLKLFFIQALGGRQTYTDERGHPMLRRRHFQWEIGTEEATHWLKHMHAALEKASFHEPEKDAFWEYVYGAAQ--HMVNK 124
633 2.000e-24UniRef50_A0A2A2YCL5 Hemin transporter n=6 Tax=Bacteria TaxID=2 RepID=A0A2A2YCL5_9BACT  ali  11  12........GKDGIARMVSAFYRRVKSDDLIGPMYPDDDWEGSEERLREFLWFRLAQDPTYILKRGHPRLRMRHGPFRIDIAARDRWVSLMSAAMEETGVSGPVREWLEQIADFMRNQAEM... 127
634 2.000e-24UniRef50_B1Y5Y0 Globin n=16 Tax=Proteobacteria TaxID=1224 RepID=B1Y5Y0_LEPCP  ali  23  4.SLYERLGGEDRIQRLVTDIVDNHLRNPLIRTRFEDAERAVIERHVTEFFCMGSGGPQAYTGKDMLTTHKGMN----ISEQELIAAIDDIVAAMAKHGYGDTERNEVVAILYSL--KGDVV.. 120
635 2.000e-24UniRef50_A0A1Q3PWC9 Uncharacterized protein n=1 Tax=Actinobacteria bacterium 69-20 TaxID=1895696 RepID=A0A1Q3PWC9_9ACTN  ali  16  15.SFYDEVGGRPVFETIVDRFYEIAIADPTLRPLFAMSHAATVRRRITAFFVQYWGGPRDYSRERGNPRLALRHSHFRLGRAEYDAWLAAMRQALEVQELTAEQRAVFYDYLVAAAAR...... 130
636 2.000e-24UniRef50_C7QDF4 Antibiotic biosynthesis monooxygenase n=105 Tax=Actinobacteria TaxID=201174 RepID=C7QDF4_CATAD  ali  21  106PTMFDWLGGAKALERLTDVFYDHVLADEVVGPLFAHMD-PAHPHHVALWLGEVFGGPSRYTAERGGYHHMTQHLGKAITEPQRRRWTNLLMDAADEVDLPPEFRAAFASYIEW.......... 220
637 2.000e-24UniRef50_A0A1M5Y1J0 Hemoglobin n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1M5Y1J0_9GAMM  ali  26  2TSLYERLGGSDGITRIASDLVDIHLNNPRISSRYVDSDVAALKHGAATFFIAGTGGPAVYGGKDMRTTHRGMN----IDAEEFMAVLDDALQALQKNEVGQREQEEVLFVLYSMR........ 112
638 2.000e-24UniRef50_D2S2I8 Globin n=1 Tax=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) TaxID=543526 RepID=D2S2I8_HALTV  ali  31  2............ITAVVDEFYDRIMADEQVADYFDDGDMQKQRAHQAQFISSVTGGPVKYSGGEMKTIHADM----GITPSDFQAIATHFDGALVEFDVNEDDRQAVLEEIAS--SQEAIVT. 105
639 2.000e-24UniRef50_A0A0Q8BT02 Globin n=10 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0Q8BT02_9RHIZ  ali  17  9.TLYKDLGEEEGVRNLVETFYDVIEQDPDAHELHRGHGVAHSREEQFNYLSGFFGGPSRYVQKHGHSRLTEIHEHVPIGPAMRDLWLRCMEKAMATVGIEGELKQQVMRAAETSRNRD..... 133
640 2.000e-24UniRef50_UPI0009DEA104 group 1 truncated hemoglobin n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=UPI0009DEA104  ali  23  38PALLKAFHGEAGIRRITADALQRYQHDPRIADIFKGHDLVRLEKELGDHTCWLLGGPCVYSGRNMREAHRNL----GLQARDMDALVENLQAAMDKEGVPFSAQNRLLAKLAPMKR--DVVER 154
641 2.000e-24UniRef50_A0A2G2EAU4 Globin n=2 Tax=Crocinitomicaceae TaxID=1853230 RepID=A0A2G2EAU4_9FLAO  ali  17  3.TLYSKIG-PESLKKLVDTFYDIVFDESSISHLFTN-DRSTIRDKQYRFLTQFLGGPQLYNSEYGHPRMRMRHAPHAIDEAARIEWLRCMKLAISKMDFEAELGEALYQVAAHMQNR...... 120
642 2.000e-24UniRef50_A0A2E0RMW4 Hemoglobin-like protein n=19 Tax=root TaxID=1 RepID=A0A2E0RMW4_9ACTN  ali  17  11PSLFSRAGGAEFFDRLVAAFYRGVADDEVLAPLYPDADFGPAERRLSLFLQQYWGGPTTYLEERGHPRLRMRHFPFHVGPLERDRWLVHMAAAVEEVCIAAELMGYFVPVAEHMRN....... 135
643 2.000e-24UniRef50_A0A0A2MMV6 Hemoglobin-like protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A0A2MMV6_9FLAO  ali  20  8.........RKDIEKLVDAFYEKVKTDTVIGYLFNDVNWNNHLPKMYDFWENILFHNGNYNGNPM-VVHQELHKKSTMTQQHFQHWITLFKTTVDELFSAEEIKDRAFNIANALMEK...... 120
644 2.000e-24UniRef50_A0A1I0GUW8 Hemoglobin n=2 Tax=Marinobacter segnicrescens TaxID=430453 RepID=A0A1I0GUW8_9ALTE  ali  21  9.TLYNRLGGQDGIDKLVDRIVDLHLQNDVAGPRYQALSEERACAKVKEFLAAGSGGPVEYTGRSMLETHTGMN----VSSAEFVAVVDDIMQAMNEMDYPRPVCDEVLGIAYSL--KEEIVHK 127
645 2.000e-24UniRef50_A0A2E2B5V4 Hemin transporter n=3 Tax=PVC group TaxID=1783257 RepID=A0A2E2B5V4_9BACT  ali  14  14........GQQGITDLVAAFYKQVPGDDILGPMYPSDEMDAAEARLRDFLIFRLGGPQTYIEQRGHPRLRMRHMPFAIDVNARNRWIALMTNALDEIEISAKDRELMLAFFEHLAT--FMINR 126
646 2.000e-24UniRef50_A0A0M6ZUL3 SynHb n=19 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M6ZUL3_9RHOB  ali  32  5..LFDKYGGFKSVSRVVMAFYDKILDSDQVGDYFDDIDMPKLIDHQTKFISSLLGGPVSYSDERLRRAHASL----DLTHEDFDEVSRLLSETLAEHDFTPQDIDTVISEIE--ARRTCILS. 118
647 3.000e-24UniRef50_A0A257WR18 Uncharacterized protein n=2 Tax=Planctomycetales TaxID=112 RepID=A0A257WR18_9BACT  ali  36  82PTLYERLGGAAAIKAVVDEFVGLAAADEKVNFFRKGTDVDKLKMHLVNLIGQLTGGPEKYTGRDMKSSHAGM----KITGAEFDALAADLIAALDKFKVPQAEKDELIKIVAST--KADIV.. 205
648 3.000e-24UniRef50_A8J8S5 Predicted protein n=1 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A8J8S5_CHLRE  ali  24  89.....RVGGLDVVKKVVELFYRKLYADPQLIKYLHDQDPMHLRAKQSMFVSWLFGPPNPYTGKSVRIAHLRIIKQRGFSPEDFDLGMKYFEEAMTELGAPEVLRGEVMRRM--LPYKDAI... 202
649 3.000e-24UniRef50_W4MFB0 Hemin transporter n=15 Tax=Bacteria TaxID=2 RepID=W4MFB0_9BACT  ali  12  31........GEDGLTRLISAFYQQVPQDDILAPMYPEADLAGAERRLRDFLIFRFGGPSHYIEQRGHPRLRMRHALFPIDQSARNRWVSLMEHAIDQAAFPAPVATALRAFFRDVA........ 137
650 3.000e-24UniRef50_UPI000B3DBFD1 group 1 truncated hemoglobin n=3 Tax=Bacteria TaxID=2 RepID=UPI000B3DBFD1  ali  25  13.TLYERLGGYPGIRRIVDGTVAAHMQNPTIKDRFQPDRVEEIKQHTCMFFSQGSGGPQSYEGRSMTEIHSGM----EIDDAEYDAAVDDIVTTMQALGYDTETREDVLVILKSL--KADII.. 131
651 3.000e-24UniRef50_A5EIY2 Putative globin family n=11 Tax=root TaxID=1 RepID=A5EIY2_BRASB  ali  17  20ATPYELIGGEAGVRRLADRFYAIMDEEPDARRAMHDADLGPIRQLLFEFLSGWLGGPALYFERAEHRCIMSAHRPYAIGDAERDEWMTCMRRAMFDCDITGDMYDLLDRAFLRMAN....... 137
652 3.000e-24UniRef50_A0A069E8N8 Globin n=3 Tax=Hyphomonadaceae TaxID=69657 RepID=A0A069E8N8_9RHOB  ali  28  28.........EALVSRLVDTFYARVREDDLLGPVFLGENWDPHLAKLKDFWSAIALGTRRYDGRPM-PAHLRL--SDTITDAHFRRWLGLFRETVDELMPNPAAADFFYDRA-SMIGR...... 134
653 3.000e-24UniRef50_D2QM53 Globin n=4 Tax=Bacteria TaxID=2 RepID=D2QM53_SPILD  ali  21  10..........EAVRFLVDSFYEKVQVDPFIGPIFTDVDWSHHLPKMYAFWESLILGNNAYNGHPFRP-HLIVNQKHTLTIDHFERWLQLFTATLSEKFMAEQVRQRATQIALVWNNKLEYIN. 126
654 3.000e-24UniRef50_A0A1P8YBX7 Bacterial-like globin family protein n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A1P8YBX7_9NOCA  ali  18  10.SLFEHVGGREGLHRLVATWYPRVLADPLLHPLF-GAGSPSHIDHLTDFLAEVFGGPTVYTDQGGFPALLEAHRGKQISEEQRQRFVDLFLTAADDAGLPSDFRTALLDYLR........... 122
655 3.000e-24UniRef50_A0A2M8U9X1 Globin n=2 Tax=Rhizobium TaxID=379 RepID=A0A2M8U9X1_RHISP  ali  13  7.TLYEAIGGDETVRALCHRFYELMDTLPEAAHAIHPPSLKDSEEKLYEYLTGYLGGPPIYMEKRGHPMLRRRHMVAEIGPEERDEWFLCFRQALDETVEHEKLREIIWAPIEKLGY....... 123
656 3.000e-24UniRef50_UPI0005D1C574 group III truncated hemoglobin n=1 Tax=Acidobacterium ailaaui TaxID=1382359 RepID=UPI0005D1C574  ali  18  13.........EEQIAALVDTFYTRVRQDALLGPVFAHVEWAPHLEKMRAFWSSLVLASGRYKGNPM---MAHLMIAPRIGAQHFERWLSLWRQTAAEIF-PQQIASIFVRKAESMAER...... 119
657 3.000e-24UniRef50_A0A1I5DF72 Hemoglobin n=2 Tax=Flavobacterium TaxID=237 RepID=A0A1I5DF72_9FLAO  ali  24  9.........RANIELLVNTFYDKVKQDATLGYLFNDVNWQVHLPKMYDFWEVVLFAKGSFKGNPM-MVHRQLHEKSALSEAHFDHWLVIFKETVDELFEGENAENSATNIAGNLMYK...