current user: public

If you have questions about the server, please let us know.

Query: TM0004 TM0004 281885 Purified-2004-07-19, from T.maritima

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30
# Score Template Links and tools%idFirst MKDLYERFNNSLEVWKLVELFGTSIRIHLFQLast
1 -3.590[P] COG3303 Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit  ali follow..  34  1MK-IYLRF-----VWILIIILNFLLNLFI.. 23
2 -3.270[D] COG2917 Intracellular septation protein A  ali follow..  21  134..NIYIAFWLPQNIWVNFKVFGLTALTLIF. 161
3 -2.740[UW] COG5295 Autotransporter adhesin  ali follow..  12  1MNKIFKVWNPATGNYTVTSETAKS....... 25
4 -2.740[S] COG2995 Uncharacterized paraquat-inducible protein A  ali follow..  12  346......EVVEFVGRWSMIDVFVIAVLSALVR 370
5 -2.540[R] COG2346 Truncated hemoglobins  ali follow..  24  24.VTLYEAIGGDATVRALTRRFYELMD..... 48
6 -2.380[S] COG3360 Uncharacterized conserved protein  ali follow..  50  2..........SEHVYKKIELIGSS....... 15
7 -2.320[O] KOG3259 Peptidyl-prolyl cis-trans isomerase  ali follow..  19  130MQKPFEDASFALRTGEMSGPVFTDSGIHIIL 160
8 -1.830[S] COG2322 Predicted membrane protein  ali follow..  19  163..........TMPLWLYVSLTGVLVYLMISP 183
9 -1.820[S] COG4818 Predicted membrane protein  ali follow..  27  28.............FFLLLERKNKFVRFHAMQ 45
10 -1.800[R] KOG4264 Nucleo-cytoplasmic protein MLN51  ali follow..  31  220....HDKFREDEQAPKLIALYGYDIR..... 245

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.