current user: public

If you have questions about the server, please let us know.

Query: TM0009 TM0009 281890 Purified-2001-02-14, from T.maritima

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MIGPRDLLNIALRIESTGYSYYKNLTEKTEGETKALFERLAEQERDHSRKFKEILEKYEQDLNPSDEVLGYLEALAEISIFPKLEETPPDDLREAVRRAIEVEKDSIVFYSEILSYVPEKEPVQTIIDEEKKHLRDLLRLEVLast
1 -50.700[S] COG1633 Uncharacterized conserved protein  ali follow..  20  15LKGIEEAIALAIDREKEAREFYLQQAGLMENPFKELYEELAAEEMKHLGYLENYRDKKELPEI-STEVPSGQSFSPEFDASRTKVGEITLGDAGILLAAMRHERKSEDFYSEMAKRVEDKKFFEMLSRYERGHYEVIDSYLE 159
2 -41.400[S] COG4902 Uncharacterized protein conserved in archaea  ali follow..  21  49..EEANSLLYMIEEEKLARDVYLKLYNETG---LIIFDRIAQSEQRHMDAVLMLIEKYNLTAPDTLNEIGVFENEELQNLYNELVEMGSQSVVDALKVGALIEEIDIKDLEEWLSKVDNKVVFENLMDGSKNHLRAFTKVLA 188
3 -28.000[R] COG2406 Protein distantly related to bacterial ferritins  ali follow..  19  18..KLLELLIKNAAAELTTYYYYTILRANLIGTIKEIAEVARIEDRNHFEALVPRIYELGGKLPDC------MKEFHDLSACPPARLPDKPTVQEILRVLVAAERCAVKGYTEICNMTAGKDLSLAILNEEIEHESWFSEFLG 160
4 -23.700[P] COG2193 Bacterioferritin (cytochrome b1)  ali follow..  14  6..KVIERLNEALFLELGAVNQYWLHYRLLNDKLAKKERAESIEEMQHADKIIDRIIFLEGHPNLQT-----------------APLRIGQNVKEVLEADLAGEYDARTSYKKSRDICSEMKLFEALLIDEEGHIDFLETQLE 139
5 -22.100[S] COG1814 Uncharacterized membrane protein  ali follow..  18  8..KLVEVARKAALDEYKEYVTYSVLARVERNKRRAVLERLAEQEREHFQFWNKFAGVKPPAWRFR-------------YAYFMAFLRLILGVTFVAKLMERGEEAIARYKSAEPLLSGPREALRRIIKDEEEHERALIAQLD 137
6 -20.200[C] COG1592 Rubrerythrin  ali follow..  18  1.MGTLENLVKAFIGESMARNRYTFYAKVAKDEIQRVFLETAENEKEHAENLLKFIQQLRGD--------------NAAIKVEAEAPLVWGTTVENLKAAIEGEHENSEMYPQFADEAEKEDRLRAIGKAEEHHERRYRRLLA 138
7 -20.100[S] COG3461 Uncharacterized conserved protein  ali follow..  16  17..RDFVRALNSLKEEIEAVAWYHQRVVTTKDEVRKILEHNRDEEMEHAAMLLEWLRRNMPG................................................................................. 76
8 -20.000[P] COG3546 Mn-containing catalase  ali follow..  11  35..............ELAAACRYFQGLSDDDAGRREMLMDIATEELSHLEIIGSLVGMLNKGAKGELAEGTENEAELYRSLWTAAYIDTIGEVTADLRSNIAAEARAKIIYERLINLTDDKDTLSFLMTREVAHQLSFEKALY 193
9 -15.700[H] COG2941 Ubiquinone biosynthesis protein COQ7  ali follow..  16  43...LDSVIRVDQAGELGANQIYK-ILQFTDPKVAPTIQHMWDQEKYHLATFDNYVLKNRVR-------PTFLRPFWDIAGFALGAGTALLGTKAAMACTEAVETVIGGHYNDQLRETAHRSHLAEFRDDELEHLNTAVE... 185
10 -15.700[R] KOG4061 DMQ mono-oxygenase/Ubiquinone biosynthesis protein COQ7/CLK-1/CAT5  ali follow..  16  43...LDSVIRVDQAGELGANQIYK-ILQFTDPKVAPTIQHMWDQEKYHLATFDNYVLKNRVR-------PTFLRPFWDIAGFALGAGTALLGTKAAMACTEAVETVIGGHYNDQLRETAHRSHLAEFRDDELEHLNTAVE... 185
11 -15.600[S] COG2833 Uncharacterized protein conserved in bacteria  ali follow..  14  81..GRIALMHALAHIELNAIDLALDIVARFAVSFFDGWMKVADDEARHFTLLRNRLKSLGAD-----------DMPAHDGLWQSAHQTRNDLEARLAVVPLILEARGLDVTPSLLEKMIEAAILNIIYNDEKTHVA....... 215
12 -15.500[P] COG1528 Ferritin-like protein  ali follow..  13  5..AIAEKLNEQINLEFYSSNVYLQMSAWCAHHAAAFLLRHADEEMEHMQKLFNYVSETSGMPLLGK---------------IEAPKNDYKTLKEIFEITLEHEKFVTSKINELVEVTFAHKFLQWYVAEQHEEEMLFNSIID 139
13 -14.300[S] COG3396 Uncharacterized conserved protein  ali follow..  14  30..TLIRQIGQHAHSEIVGMLPEGNWITRAPTRRKAILLAKVQDEAGHGLYLYSAAETLGCARE-----DIYQKMLDGRMKYSSIFNYPTLSWADIGVIGWLVDGAAIVNQVALCRTSYGARAMVKICKEESFHQR....... 160
14 -13.800[FJ] COG4445 Hydroxylase for synthesis of 2-methylthio-cis-ribozeatin in tRNA  ali follow..  11  93FAFRQGPEPDFVALHKQISKSAMPQTDDPWGQLIDRMVLLIKEELHHFWQVREVMQARN-------PYVKITASRYAKGMLKAVRTHEPLTLIDKLICGAYIEARSCERFAALAPWLDEDTFYLSLLRSEARHYQDYLAL.. 229
15 -12.200[S] COG3685 Uncharacterized protein conserved in bacteria  ali follow..  15  1MATANEHLRDAHAMEEQAITMLTSQSSRLENELKTRIDRHLQETKDQAAMLERCLERLDGGTSSIKDISGKIVAFGQGLS----GLFVSDEVVKGTLASYTFEHMEIASYRILIAAAETKRVCESILQQEIAMAEWLAQN.. 148
16 -9.970[F] KOG1567 Ribonucleotide reductase, beta subunit  ali follow..  11  116............................QVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVA--EGVFFSGSFALMPGLTFSNELISRDEGLHCD....... 233
17 -9.320[R] COG3687 Predicted metal-dependent hydrolase  ali follow..  14  137...ATHVLNVLHMLLPAGEEFFVRVFKKTDDQLRLDVQGFIGQEAMHSQAHSGVVDHFDAQGVDVTAFTNQIRWLFEKLLGESPRRSPRRQYSWLVSFIAAIEHYTAVMGEWILNSPQ-LDMLRWHGAEEVEHKAVAFDTM. 291
18 -9.180[M] COG5577 Spore coat protein  ali follow..  3.LASHELHDLLIVSCVNSITNMAMFRNMVQDDLKNILNSHFPAHIQDYNMKVEFVKKAQVPNLNVMLQNFTSSPANSFPPIAPRTDVQKMNDREIATAYLLTLKRAGREYAWSAMEMSNRQFLKDAFTMSCNHAYDVWQW.. 154

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.