current user: public

If you have questions about the server, please let us know.

Query: TM0014 TM0014 281895 Purified-2001-01-30, from T.maritima

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MREREIVDKLTSAFFAENTIISFTSQLDEALTRKLRRMQRRIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETAGGFTTINRVINSVITAQRKLKDLKILast
1 -42.100[NT] COG0840 Methyl-accepting chemotaxis protein  ali follow..  22  387...NYSIDQLRELVETINQTAVQVAAAAQETQSTAMHLAEASEHQAQEIAGASAAINEMADQVSANASESSAVAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIADQTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAVISMEQ-ARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQASSAGHISNTMNVIQEITSQTSAGTTATARSIGNLAKMASEMRN... 668
2 -15.500[S] COG1340 Uncharacterized archaeal coiled-coil protein  ali follow..  11  1..................................MTDLLQEFEEKRDILRKAIEEHIKKRDEAAQQSRNYAEQRDQLNAKAHEMRDQVKQKISQKNALIEEVQKIRTEKEEHFQ---KLSELRKEYKKITEEANYASVN-----------QRDIKAKERELQKLIQETMQLPKAEEDKVVQEIKRLSNEIKKMKEDREKQLSENEKVKALLAEIDKEKTLARDLKKRAEEISNQISEISNDINKSLQELDEVRKKADEMHEMAIKYGKESEQEHE... 229
3 -13.400[S] COG1511 Predicted membrane protein  ali follow..  264......SGELTSKMNELLAGLQNVQKGTPNLTNGLDQLNSKVQEGSEKAAKAEKIINALLTKLETAVNNLEKSETAMKEFKKQLTDFENSLKNRDQAFKNVINSTAEQKSQLINSVEKKLPQVDAPDFDQILSQLPTADQLPDIATIKSSLEDVKAQVAQVKAMTSKLYNGAKTIQDAIDRLTEGADKIYNGSQKLTDGQTKLTAGIGEYNKQFAKAKAGSEQLVTGSSQVSGGLFKLLDGSKQVQSGSSKLADGSASLDTGLGKLLDGTGELSS... 540
4 -12.500[U] KOG4809 Rab6 GTPase-interacting protein involved in endosome-to-TGN transport  ali follow..  428.VYRSHSKFMKNKIGQVKQELSRKDTELLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEEKQMSSLKERVKSLQA-------TNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAHEAALEAR.... 700
5 -10.600[S] COG5280 Phage-related minor tail protein  ali follow..  10  1.....MAKKISGITIAIGADTTGVTNGLKDIGKQSNSVNSELRDVERLLKLNPNNVELVAQKLSKQVELTTKKLDGLKGAQADVDRQFKSGDIGEEQYRAFQREVVATEGRLDHYKQSLKDVESSSGEAGNATKVEDVGEAVKGGVLMEAADHLSVVGDKLKEFSGSAQEAFSDVDEGMDKITTTTGKASDEFKTQFDNIEDVGSALGTLSAQFDMSGDTLEKNSKLALQYANINTDVKTSIESAKSAIEAYGLSNKDFSTVLDSVTATSQR...... 292
6 -10.500[S] COG5412 Phage-related protein  ali follow..  10  5..................TLTAKLTADPSGFRAGFQKAQESLANLQSRVNQTGKRVQSIGKSISDLGSKLTRNI--TVPAVGAATALTSITLVKGFDRLVGIDSARAKLKGLGHDAEAIDSIMDSALASVKGTAF-AATTAANAVAAGPPGKELTRYLSLTADTAAIAGTSLGEIGAILNKVTTSGRAYNSELQMLSDLAEEANTTADAIFDMASKGEISTDMLLNAIEKNIGGAESFSAAIANIGADIARIGANFLDAGGKAGGFFSTVKPL..... 275
7 -10.400[U] KOG0946 ER-Golgi vesicle-tethering protein p115  ali follow..  12  647.QHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTS-NEQSSAIVSARDSEQVAELKQELATLKS-SQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDL.. 930
8 -9.500[D] KOG4438 Centromere-associated protein NUF2  ali follow..  11  203............................IVLQEGNSQKKSNISEKTKRLNELKLLVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNKESLNLEDQIEKTEENSFKRLMIVKKEKLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLGIQQ---LKDAAEREKLKSQEIFLNLKTALEKHDGIEKAAEDSYAKIDEKTAELKRKMFKMST... 464
9 -9.140[Z] KOG0980 Actin-binding protein SLA2/Huntingtin-interacting protein Hip1  ali follow..  16  685.......................LEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIREVNESILANCQALMSVIMQLVIASRELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVHLIVAAQEIAASTA--------FVSSRVK--ADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLHAAKKEEMESQVKML-ELEQSLNQERAKLAALRK...................................... 908
10 -9.040[U] KOG0809 SNARE protein TLG2/Syntaxin 16  ali follow..  81.........................DVSEEISVNIQRARTKMAELGK----HAKALMPSFGDGKEDQHNIESLTQEITFLLKKSEKQLQRLSASGPSEDSNVRKNVQR-----SLATDLQLLSMELRKK-QSTYLKRLRQQKEDGMD-------LSRNRYRPEEDDFGDMLNEHQMSKIKKSEEVSVEREKEIQQVVESVNDLAQIMKDLSALVIDQGTIVDRIDYNIENVATTVEDGLKQLQKAERTQRHGGM........................ 297

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.