current user: public

If you have questions about the server, please let us know.

Query: TM0016 TM0016 281897 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
1 -33.900[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  42  29..................TLGTTLVNFTGDWRTFMPVIDESKCVKCYICWKFCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREEK...... 105
3 -33.100[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  23  19LVMIFGHAFRKRD--TLQYPEEPVPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAEFFRINFSRCIFCGLCEEACPTTAIQLTPDFEMGEFK. 128
4 -30.300[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  30  109..................................VAVIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPDSW. 174
6 -29.000[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  29  255...................PPGTAAYEKRGIALEVPEWISENCTMCNECAFVCPHAAIRPILTNRIQVSPMDCTGCNLCAETCPAKALVMKPFEEVAAKEN 362
7 -27.200[C] COG1146 Ferredoxin  ali follow..  22  38..................................YPTIDYDKCVTCGICFVTCGRRVFDFDKKEIVARPYNCMVACQTCMNLCPTGAISFPDASY...... 101
8 -26.300[C] COG1145 Ferredoxin  ali follow..  31  278...............................SSYLATVDTSRCIACGICMLRCPMKAIKAKINRPASVDAEKCLGCGVCVPTCPMEAIELVERDE...... 342
9 -22.500[C] COG2440 Ferredoxin-like protein  ali follow..  15  29....................................KVRPHERPSANLLTHICPAKCYELNDKGQVETTSDGCMECGTCRVLCEASG.............. 81
10 -22.500[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  29  3...............................PKIAEVIDYDVCAACGACEAVCPIGAVTVKKAAEKGGGYQVCEGCLTCSRVCPV................ 67
11 -22.100[C] COG1141 Ferredoxin  ali follow..  18  43...............................RQKGVYVDEITCIGCKHCAHVARNTFYIEPDYGRSRVDGDAEEVIQEAIDTCPVDCIHWVDYTELKNLE. 114
12 -20.200[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  25  66.........................................SCNHCDDCTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMTK.. 125
13 -19.600[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  33  50.........................................LCHHCEDCAVVCPVNAITRVDG-AVQLNESLCVSCKLCGIACPFGAIEFSGSRP...... 104
14 -19.500[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  23  159...............................EDRLKLDGLYECILCACCSTSCPSYWWNGDRNLEDPFRLYRCHTIMNCAQACPKGL.............. 241
15 -19.200[C] COG1148 Heterodisulfide reductase, subunit A and related polyferredoxins  ali follow..  25  573.............SGAAARAAIPMVKGEVEIEPIVAVTDSDVCGGCEVCIELCPFGAISIEEG-HANVNVALCKGCGTCVAACPSGAMDQQ.......... 649
17 -19.000[C] COG0348 Polyferredoxin  ali follow..  22  222......................................HRQQCDNCMDCYNVCPEPQLHAKKSESPLVLSKDCISCGRCIDVCPEKVFIFTTRFNHSVNHS 289
18 -18.900[R] COG3383 Uncharacterized anaerobic dehydrogenase  ali follow..  30  143.....................................YDPDQCILCGRCVEACQQETLSIDWERSQPANLSSCVSCGLCATVCPCNALM............ 207
19 -18.800[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  24  554.......................WSRARRREGKIVTYKVTEDCTLCMECVNTCPA---LIFDGEKVSIDQSLCVGCAVCAKICPNRAIKPAKSN....... 623
20 -18.600[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  22  178..................................EKLDGLYECILCACCSTSCPSYWWNGDAKLQDPFSLYRCHTIMNCTRTCPKGL.............. 257
21 -18.400[R] COG4624 Iron only hydrogenase large subunit, C-terminal domain  ali follow..  13  11.....................................FFADLPKDNKKCIKIGSPLALSLSD----------CLACSGCVSADEAGALSEDLSFVLDLSP. 63
22 -18.400[C] COG1600 Uncharacterized Fe-S protein  ali follow..  29  195.......................................EEGCGKCVACMTICPTGAIV----EPYTVDARRCIGCDDCQLICPWN............... 261
23 -18.400[Y] KOG2439 Nuclear architecture related protein  ali follow..  10  15........................................SPALACVKPTQVSGGKKDNVDQLEKVSITLSDCLACSGCITSSEEILLSSQSHSVFLKN.. 85
24 -17.700[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  20  405......................................LASECTDCGWCQRVCPNSLPVMDSKLEEMAIEELCYTCGRCEQECERN-IPIVSMVTKAGER. 475
25 -17.500[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  23  311.........................................RCIRCGACLNTCPAYRQILGGYEEFKDLPSACSLCTACNQVCPVKILLLKHRRHIAESGM 394
26 -16.900[C] COG1140 Nitrate reductase beta subunit  ali follow..  20  166........................KAMYSQFENTFMMYLPRLCEHCLACVATCPSGAIYKEEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSEK.. 243
27 -16.600[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  24  36.....................................LSVQACYQCGTCTGSCPSGRRTLVDEVIKSDELWMCTTCYTCYERCPRGV.............. 99
28 -16.600[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  30  373......................................PEQSCIRCGLCVDACPAGLLPQEHEKARNHNLFDCIECGACAYVCPSN-IPLVQYYRQEKAE. 442
29 -16.300[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali follow..  29  45....................KPQILKAEDFIASKKARIMPEKCSSCGLCYDLCRFGAVVAEDG--YYVDEKKCEGCAFCFNVCPERAIEMENVK....... 116
30 -14.900[S] COG3592 Uncharacterized conserved protein  ali follow..  17...............................ADVDIYFNTNICAHSGNCVKGNA-ELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGALQYIEK........ 77
31 -13.900[R] COG1453 Predicted oxidoreductases of the aldo/keto reductase family  ali follow..  26  296..........................................CTGCQYCMP-CPSGVLSGAVSGGKPGMASQCVQCGQCLEKCPQH-IDIPTILESVAE.. 378
32 -13.400[C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)  ali follow..  21  148.....................................HEMNRCIACYRCVRYYKDYA-VYGAHDNVYFGRPESEFSGNLVEICPTGVFT............ 209
33 -13.400[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  41  4...................................AILNKDKC-RCSECEKYCPDETIVFEDDGKPVISEELCVGCGICINKCPFDAIMII.......... 67
34 -12.500[C] COG1726 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA  ali follow..  14  370......................................GERAMVPIGAYERVMPLDLAAGDTDSAQALGCLELDDLALCTFVCPGKN-LLRQALDKIEKEG 446
35 -11.600[C] COG0247 Fe-S oxidoreductase  ali follow..  18  269..................................SQLLDLYACVECGRCTNMCPATGTSLIGDVITEEEIWACTTCRNCEDQCPVMNEHVDKIIDLRRY.. 397
36 -11.500[C] KOG2282 NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit  ali follow..  19  171.....................................TIMTRCIQCTRCIRFASEIA-TTGRGNDMQVGTYMSELSGNIIDICPVGALT............ 232
37 -11.300[C] KOG2415 Electron transfer flavoprotein ubiquinone oxidoreductase  ali follow..  20  555..............................................GPEQRFCPAGVYEFGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPE....... 607
38 -10.100[C] COG2221 Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits  ali follow..  13  162.EESLPAKLRIFVSGCPAMCAGGTAIDIAIVGQWGAPPKAKVTESQIFLVQVCPTGAHTLRDKVKLVLLGEKCINCARCKENCDAFDYDPENV........ 272
39 -9.100[S] KOG4376 Uncharacterized conserved protein  ali follow..  20  10.................................................MVYCPYNKEHKMLRKKLQQHILKCR-----LMVCPFNSSHLIPEPQFFQH.. 62

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.