|
current user: public |
|
Query: TM0002 TM0002 281883 Purified-2001-08-29, from T.maritima |
. 10 . 20 . 30 . 40 | |||||||
# | Score | Template | Links and tools | %id | First | MSPEDWKRLICFHTSKEVLKQTLDDAQQNISDSVSIPLRKY | Last |
1 | -4.390 | IDP04003 50S ribosomal protein L18 [Bacillus anthracis str. Sterne] BAS0126 [Bacillus anthracis str. Sterne] | ali follow.. | 28 | 30 | .......RLNVFRSNQHIYAQVIDDVNGVTLVSAS...... | 57 |
2 | -3.860 | IDP04117 gene: spa13; spa13, component of the Mxi-Spa secretion machinery [Shigella flexneri] CAC05825 [Shigella flexneri] | ali follow.. | 20 | 41 | ......KHIIQYQSERILLKGRIEEIQKDIDEANAS..... | 70 |
3 | -3.590 | IDP90768 gene: argG; argininosuccinate synthase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0665c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819] | ali follow.. | 24 | 323 | ...........FSPERMMLQALIDESQIHANGRVKLELYK. | 351 |
4 | -3.370 | IDP05356 conserved domain protein [Bacillus anthracis str. Ames] BA_3897 [Bacillus anthracis str. Ames] | ali follow.. | 24 | 16 | ............ETTTIPLKNPINKNFKNGSGTHTFPIKKH | 44 |
5 | -3.140 | IDP90545 gene: fabG; 3-ketoacyl-(acyl-carrier-protein) reductase [Yersinia pestis CO92] YPO1599 [Yersinia pestis CO92] | ali follow.. | 25 | 98 | MKDDEWQDIIVFRLSKAVMRAMMKKRFGRIITIGSV..... | 139 |
6 | -3.140 | IDP90557 gene: fabG; 3-ketoacyl-(acyl-carrier-protein) reductase [Vibrio cholerae O1 biovar eltor str. N16961] VC2021 [Vibrio cholerae O1 biovar El Tor str. N16961] | ali follow.. | 30 | 102 | MKEEEWSDIMIFRLSKAVLRGMMKKRQGRIINVGSV..... | 143 |
7 | -3.140 | IDP91252 gene: fabG; fabG [Listeria monocytogenes] NT01LM1948 [Listeria monocytogenes EGD-e] | ali follow.. | 22 | 102 | MKEDEWDDVITFLCTKAVSRTMMKQRAGKIINMASV..... | 143 |
8 | -3.100 | IDP02724 gene: fabG; acetoacetyl-CoA reductase [Bacillus anthracis str. `Ames Ancestor`] GBAA1330 [Bacillus anthracis str. `Ames Ancestor`] | ali follow.. | 33 | 103 | LNREDWERVIVFNTTSAVLPYITEAEEGRIISISSI..... | 144 |
9 | -3.060 | IDP91297 gene: fabG; 3-ketoacyl-(acyl-carrier-protein) reductase STM1195 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] | ali follow.. | 25 | 98 | MKDDEWNDIIVFRLSKAVMRAMMKKRCGRIITIGSV..... | 139 |
10 | -3.060 | IDP91290 gene: fabG; 3-ketoacyl-(acyl-carrier-protein) reductase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] SPA1656 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] | ali follow.. | 25 | 98 | MKDDEWNDIIVFRLSKAVMRAMMKKRCGRIITIGSV..... | 139 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40. |