current user: public

If you have questions about the server, please let us know.

Query: TM0004 TM0004 281885 Purified-2004-07-19, from T.maritima

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30
# Score Template Links and tools%idFirst MKDLYERFNNSLEVWKLVELFGTSIRIHLFQLast
1 -3.820IDP90412 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_657 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  36  50.....SRFPMALEVWELHVQHVISLLKQQF. 74
2 -3.400IDP00881 gene: ydfZ; putative cytoplasmic protein STM1509 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  28  3...TYDRNRNAITTGSRVMISGTG....... 23
3 -2.620IDP00204 putative membrane protein YPO1702 [Yersinia pestis CO92]  ali follow..  20  378......RLITWIGRWSMLDLFVIALMMSLIN 402
4 -2.340IDP05278 hypothetical protein BA_5456 [Bacillus anthracis str. Ames] BA_5456 [Bacillus anthracis str. Ames]  ali follow..  26  9.KKVYKKWLQTIQTWK............... 23
5 -2.050IDP05033 hypothetical protein BA_1260 [Bacillus anthracis str. Ames] BA_1260 [Bacillus anthracis str. Ames]  ali follow..  29  15........DKGPDVNAASEWGGTTI...... 31
6 -1.720IDP92783 hypothetical protein [Vibrio cholerae O1 biovar El Tor] AGG09406 [Vibrio cholerae O1 biovar El Tor]  ali follow..  16  40.KEYFDELTHNRPIYSLIE............ 57
7 -1.710IDP95007 Set165a_015 [Vibrio cholerae O1 biovar El Tor]  ali follow..  16  30.KEYFDELTHNRPIYSLIE............ 47
8 -1.600IDP00864 putative cytoplasmic protein STM1268 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  22  4......RLNWSEKKEQAVDSAESSFKVY... 25
9 -1.590IDP91347 hypothetical protein VV1_3162 [Vibrio vulnificus CMCP6] VV1_3162 [Vibrio vulnificus CMCP6]  ali follow..  28  17............DIWHLER............ 23
10 -1.510IDP01021 gene: yaaY; putative cytoplasmic protein STM0044 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  26  42MKSIFFMFHQGNRRLTLTAVQGILLRFSLF. 71

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.