current user: public

If you have questions about the server, please let us know.

Query: TM0013 TM0013 281894 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSLLast
1 -59.300IDP02653 anaerobic nitric oxide reductase flavorubredoxin [Salmonella typhimurium LT2] STM2840 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  5VKNNIHWVGQRDWEVRDFHGTYKTLRGSSYNSYLI-REEKNVLIDTVDHKFSREFVQNLRSEIDLADIDYIIINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGHHHHPEWN--FKVVKTGDTLDIGGKQLIFVETPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDERLFNDEVDQTELFQCQRYYANILTPFSRLVTPKITEILNLPVDMIATSHGVVWRDNPTQIVELYLKWATDYTIFYDTMSN. 263
2 -38.300IDP02048 putative Zn-dependent hydrolase [Salmonella typhimurium LT2] STM3737 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  50ITEGVWYVGTK-----------------NLSSILLTTPAGHILIDAGLDESAPQIKANIEAAFRLTDVRYLLNSHARLDQAGGMARLKAWS-GAQLVASQPNADQMARGGRQDPPVTTDKIIHHQESIILGGITVTALFTP-GHLPGSTSWRLRNGKTLIYADSLATPDYLLINNKNYPD-----------------LVTDIQSSFKTLAAQHVDIFIANKGAFFDSNGLQQYVERSRQ.............. 282
3 -36.700IDP06557 beta-lactamase II [Erythrobacter litoralis HTCC2594] YP_458405 [Erythrobacter litoralis HTCC2594]  ali follow..  15  46LAEGVWMHTTY--------LDLMGFGPIPSNGLLVVNGDNTILVDTATDEQTEQIVAWASMVLA-KPVRAAVVTHAHQDKMGGMAALHGA--NIATWAHPLSNELAPEEGLVPARNAITANGWATGEAAQSLAPLRLYYPGGAHTRDNITVGLPELGIAFGGCMIKAGDASNLGNLADADTAAYAQ------------------SVRNFAAADARTIAMSHSPPEGRKAIERTLDLAEEL............. 261
4 -35.900IDP00052 gene: bla2; beta-lactamase II BA_3500 [Bacillus anthracis str. Ames]  ali follow..  14  50LNKNVWVH---------TELGYFNGEAVPSNGLILNTSKGLVLVDSSDDKLTKELIEMAEKKFK-KSVTDVIITHAHADRIGGIKTLKER--GIKAHSTTLTAELAKKNGYEEPL----GDLQAITKLKFGNMKVETFYPGKGHTEDNIVVWLPQYNMLVGGCLV------------------KSASAKDLGNITDAYVNEWSTSIENVLKRNINFVVPGHGEVGDKGLLLHTLDLLK............... 256
5 -35.100IDP06554 beta-lactamase [Hirschia maritima] WP_026296771 [Hirschia maritima]  ali follow..  17  49LGDGVWIHTS--------YKIVMPWGNVLTNGLIIERGNHTVLIDTANDEQTAEILDWAEITLK-KPVQASIHTHAHSDKMGGMKALHSR--GVVTYASKLTNKLALERGLDQAQS---QLDLSEIGDQIEWNGLSVLYPGGGHSEDNIVVNDFTTRILFGGCMI------------------RPGMTKSLGNTGDANLKYWSKAVENAANANSNIVVPSHGKPAGREILKNTATIARPQFKA.......... 262
6 -34.900IDP06558 beta-lactamase [Hirschia baltica ATCC 49814] YP_003061440 [Hirschia baltica ATCC 49814]  ali follow..  17  50LGTGVWMHTGY--------KVVPPWGNIRTNGLIIERGDYSVLVDTANDAQTAEIVAWAKDTLQ-KPIRASIHTHAHSDKMGGMDALHML--GVETFATDLTNRLAIERGLMPAKN---VLNISEIGSQIEWEGLTILYPGGGHSEDNIVVNEGVNNILFGGCMI------------------RPGMTTSLGNIDDANLGYWSKAVENAANADSQIVIPSHGKPAGREILKNTAYIARPK............. 260
7 -34.500IDP06560 gene: blaFIM-1; metallo-beta-lactamase FIM-1 [Pseudomonas aeruginosa] AFV91534 [Pseudomonas aeruginosa]  ali follow..  15  46ITQGVWMHTS--------MKHMENWGHVPSNGLIVEKGDFSILVDTADDPQTAQIIEWSKDTLK-KPIRWAVFTHAHDDKMGGVAALRQQ--GIVTYAAADSNRMAPQNGLTPAEHDLIF---DSEHSTSVLHPLVIFDPGPGHTRDNIVVGLPEQGIVFGGCLI------------------RPSGSTSLGNTADADLAHWKTAVLAVAQREAQQIIPSHGPMAGRELFELTAQLAEKASIPS......... 260
8 -34.400IDP92008 mutant IMP-1 metallo-beta-lactamase [synthetic construct] ACU65240 [synthetic construct]  ali follow..  18  30LDEGVYVHTS--------FEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERG-YKIKGSISSHFHSDSTGGIEWLNSR--SIPTYASELTNELLKKDGKVQATNSF-----SGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILYGGCFI---------------------KPYGLGNLGDANIEAWPKSAKLLKSKKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN. 246
9 -34.200IDP92009 mutant IMP-6 metallo-beta-lactamase [synthetic construct] ACU65237 [synthetic construct]  ali follow..  20  30LDEGVYVHTSFE--------EVNGWGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVER---YKIKGSISSHFHSDGTGGIEWLNSR--SIPTYASELTNELLKKDGKVQATNSF-----SGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFI---------------------KPYGLGNLGDANIEAWPKSAKLLKSKKAKLVVPGHSEVGDASLLKLTLEQAVKGLNES......... 238
10 -33.200IDP06556 beta-lactamase [Haliangium ochraceum DSM 14365] YP_003270512 [Haliangium ochraceum DSM 14365]  ali follow..  13  65LGEGVWMHTSW--------KDVPPWGPVMSNGLIVADGEGSFLIDTANDEQTAAILDWAERELG-RPVRGAVFTHAHEDKMGGVGTVRAR--GIRTYALALSNQLAAEGGVMPAEA---SLRLEAGGEPQTLGPVQVFYPGGGHTRDNIVVAVD-GGVLFGGCLI------------------RPGGTNSLGNTADADLDHWDEAVSAVAKRDRSVVIPSHGPPGGRELLDQTIQLVQSDEK........... 276
11 -32.200IDP95146 hypothetical protein KP1_2907 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002919622 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  11  30......................QEKGLFAVNSTLVSGPHEAVLFDAQSVKDGEKLVEMIKKN---KPLSRIVITSGDPDFYFGLEPLVKAFPQAEVVATPEVVKHIAAMKDGAPTQVYVPQALEANSFTIDGEKVTIMQ----PHDYAAFVWIRANKTILGGTGVAWGMHLWTADTQTPA-----------------SRQQWRNTLDQMIALHPQRVIPGHYLGTPPSAVRFTKTYLQQFEQAL......... 244
12 -31.500IDP01951 metallo-beta-lactamase family protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0809c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  18  11...........................YETNCYILFTPKGEFIIDPGTDA--LLFIKKHV------NPLAILNTHGHYDHIWDNAKVKKEY-NIPIYIHKNDAFMLHDDFNQGYDSSDAFLVDNEDILNICGVDFKFHFLP-GHTPGCTMIEIVGKNIMFSGDFLFYRSIGRWDFPYS-------------------DANLMKQSLEKVMTYKEDFLLPGHGQ.............................. 180
13 -28.800IDP02779 gene: gloB; hydroxyacylglutathione hydrolase [Francisella tularensis subsp. tularensis SCHU S4] FTT1405c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  16...............................QYLLYDKSHAIVIDPLKSDIFAEFIAKNK------QLEAILITHKHGDHIAGVKKLLAIYLNAKVYAYT-----------GNDLFKPDIYVKDGSFINLGFTSFRVMYIP-GHIDDHVCFLFEQERALFCGDTLFNAGVGGVQAESA-------------------DINQLYDSLVKITKLDGDIPYPAHDYWLGNLDFALSIL.................. 184
14 -23.200IDP95145 beta-lactamase domain protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002919788 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  18  54...........................IAIGAYLIRGRGNTVLVDTGTGGANGELIANLARLVGPEEIDAILLTHAHPDHIGGLAAGTPAYPNATVFLPTRESAYWLATSTFDNASRRVLANCAAQISGVDDEEIRPCPLP-GHTPGHYRLEAGDTSLLIWGDIVHFPSIQSAR-----------EASVAFDVDPEQARRTREILLRQAAS-ERWLIAGMH................................ 257
15 -22.900IDP95150 hypothetical protein KP1_2431 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002919177 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  12  51...........................LSIHSWVVQTPYDLIVIDTATGNGRERYLENLRAAVNPEDVTLVLLTHLHTDHVGWNTVWQDLFPNARYLCSAKELSRVKNSEVIEAGQLETVDVATRPRVGGR---IDFIPTP-GHSPDHLVLAAGDDYACFSGDLLHSPIQ------------AHPQWNSAFCGDPRQAEVSRREMMAWGAS-HHAQWFTGHGWLEKDKQ........................ 274
16 -21.600IDP00649 metallo-beta-lactamase family protein SACOL0046 [Staphylococcus aureus subsp. aureus COL]  ali follow..  20  9.........................KHLSQASYLIGCQKEAMIIDPI--RDLSSYIRVADEE----TITHAAETHIHADFASGIRDVAIKL-NANIYVSGESDDTLGYKNMPNHTH----FVQHNDDIYVGNIKLKVLHTP-GHTPESISFLAQVPMGLFSGDIFVGDIGRPDLLEKAVKVEGSSEIG----------AKQMFKSIESIKDLPDYIIWPGHGA.............................. 197
17 -21.200IDP95171 metal-dependent hydrolase-like protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002917278 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  14  2.............KIDVLGCGSAFSCTQNTSARVIDADNKQWLIDCG-----PTVPRALWQRGEVNDIDAIYFTHVHPDHCTGLTALLSRQKPVIIYCQPAQQPVLMQLAALADLGFTIDWQECREAWTWQDWQIRTAPTQHELSNRAIRITIAGQTLFYSGD---GRPTADSIALMAGAGLAFQECASVAALDDDASHGDFPSCLMLFRTLQLPAMGLYHCEDASLSALKQACQPWPGLFVSRD........ 238
18 -19.700IDP05312 metallo-beta-lactamase superfamily exported protein [Clostridium difficile 630] CD0895 [Peptoclostridium difficile 630]  ali follow..  17  74..............................DCILVEIGNKVIMIDTGEDKNGKQIVDRLKEK-GINTLDYLILTHLDKDHIGGVDSVLSSVKVKNIIQANYSKQYDEYIDSLKKADIEPVLLKDNMNIVINSAEINIHPASKSKYESSTNISYGAYKFLFAGDAFINGNTLKYDFVKMPHHGRYDKLTETFLESISPQYAVITGVLKILERLNIKTFLTSNGEVV............................ 292
19 -18.500IDP02708 hypothetical protein lmo0291 [Listeria monocytogenes EGD-e] lmo0291 [Listeria monocytogenes EGD-e]  ali follow..  14  22.........................SGSSGNATLVETGDQKILIDCG---SGKKMEGLFAQVRDMNDLDAILITHEHSDHIKGLGVLARKY-KLPIYANAKTWKAMDNM-IGEVSSDQKFQFDMETVKNFGSMQVESFGVSHAIEPMFYIFHKGNKKFVMITDTMKGHIAGADAYLFESNHDVEMLRMGRYPWNVKRSNEDAAIAMSEVITDQTKRIYLGH................................ 230
20 -18.400IDP91933 VicX protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001964 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  13.........................SGSSGNSFYLETSKKKLLVDAG---SGKKITSLLAEIRKPEDLDAILITHEHSDHIHGVGVLARKYGMDLYANEKTWQAMENSKYLGKVDSSQKHIFEMGKTKTFGDIDIESFGVSHAVAPQFYRFMKDDKSFVLLTDTMAGIVENADGYLIEANHDVEILRSGSYAWRLKQSNEDGAEAMIRTLGNRTKKIYLGH................................ 223
21 -16.100IDP02348 S-layer protein, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA2803 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  13  219..........................EQGDATFIKSPSGETILIDGGNNGKGKVVANYLKGL-GFQTIDYMIATHPDADHVGGLDEVLYAINVKNVYAPKVTQTFKDFLTAVANKGLTIKEAKSGVTLPINGLNSQFLAPVKEYGNDLLKVTHGSKSFLFTGDA--------ESKSEKDMVATYGSGLKSDVLKPGHHGSKTSSSQPFLDAVKPSIAIISAGA---GHPTQETLAKLNAMSVKV......... 437
22 -15.100IDP95096 putative recombination protein with metallo-hydrolase domain [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002918703 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  15  563..............................LAMVIERHGKALLYDTGPAPQGDSGQQVIIPWLRWHQLQGIMLSHEHLDHRGGLDSVLQAWPQAWVRSPLGWAHHLP--------------CHRGERWQWQGLNFQALWPLPGSTAKGVRIDDGRSSILLTGDI---------------------------------ERQAEQAMISRYRHLTSTLIVPHHGS--NTSSSALLVRRVDGAAALASARYNAWRM 748
23 -12.000IDP04416 ribonuclease Z [Bacillus anthracis str. Sterne] BAS4049 [Bacillus anthracis str. Sterne]  ali follow..  16  2.............EFVFLGTGAGVPSKGRNVSAIALQRGQTWLFDCGEATQHQILHTSVR----PRRIEKIFITHLHGDHIFGLPGLLGSRTPLTVYGPKGIKQFIESVSTTHVKYPLEIVEITEEGTVFEDNEFHVETKRLSHGIECFGYRIIEKVITILGDTSRELAQDADVLVHEATFAAEDE-----QQAYDYFHSTSKQAASIALQANAKRLILTHSSRYQGDTYKELLKEARELFSNTEIATDLKSF 303

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.