current user: public

If you have questions about the server, please let us know.

Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSELast
1 -77.400IDP06186 gene: porG; pyruvate flavodoxin oxidoreductase subunit gamma [Helicobacter pylori J99] NP_223752 [Helicobacter pylori J99]  ali follow..  43  1......MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILNHERFMQPDYVLVIDPGLVFINIFANEKEDTTYIITSYLNKEELKKPELKTRKVFLVDCLKISMETLKRPIPNTPMLGALMKVSGMLEIEAFKEAFKKVLGKKLTQEVIDANMLAIQRAYEEVQ... 186
2 -62.800IDP06151 gene: oorC; 2-oxoglutarate-acceptor oxidoreductase subunit OorC [Helicobacter pylori J99] NP_223257 [Helicobacter pylori J99]  ali follow..  18  2......EAQLRFTGVGGQGVLLAGEILAEAKIVSGGYGTKTSTYTSQVRGGPTKVDILLDKDEIIFPYAKEEIDFMLSVAQISYNQ-FKSDIKKGGIVVIDPNLVTPTKED--EEKYQLYKIPIISIAKDVGNIITQSVVALAITVELTKCVEENIVLDTMLKKV----PAKVAETNKKAFEIGKKHALEA. 181
3 -38.000IDP90660 pyruvate ferredoxin/flavodoxin oxidoreductase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1476c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  18  412..GDESTIECLFYGLGADGTVANKNSIKIIGDKTDFYAQAYFAYDSKKSGGYTRSHLRFSKKPIRSTYLVSTPHFIACSVAAYLEIYVLAGIRKGGTFLLNSIWNAEETIRQLEKEVNFYIINATKLARDIGLGNRTNTIMQSAFFKLAKIIPQKYMKELAYKSYSKK-GDAIVEMNYKAIDVGADGLVKVE 615
4 -7.930IDP01907 gene: solA; N-methyltryptophan oxidase [Salmonella typhimurium LT2] STM1160 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  2......KYDLIIIGSGSVGAAAGYYA-----TRAGLKVLMTDAHMPPHQQGSHHGDTRLGEGEKYVPLVLRAQTLWDELSTHN-----EPIFVRSGVVNLDSAFLANVARSAQQWQLNVERLDATALMTRWPEIRVPDNYI-GLFEADSGFLRSELAITTWLRLAREAGCAQLFNSPVSHIHHDDNGVT... 182
5 -7.840IDP92081 thymidylate kinase, putative [Toxoplasma gondii ME49] TGME49_106970 [Toxoplasma gondii ME49]  ali follow..  10  1MAAFTPK--VVFEGIDRSGKSTQARLAYERLTKEGHAAELIRFPDRTTPIGQVLDRFLANASWSSDGQHPQVPPLLFAANRWEAQARILRALGEGRTVLVD........................................................................................... 108
6 -7.370IDP05177 gene: mqo; malate:quinone-oxidoreductase [Bacillus anthracis str. Ames] BA_2974 [Bacillus anthracis str. Ames]  ali follow..  13  1MSNMQQKTDVILIGAGIMSATLGSLLKELAPEWEIKVFEKLASAGEESSNEWNNAGT-GHSALCELNYTSEKSDGSIDISKAVKVNEQFQLSRQPHMSLVQGEKNVEFLKNRFEALSKEFSDAPETLKKLIMEGRTSNEPMAATKIDSGTDVNFGALTRMLFDYLKTKDVELNYKHSVENIKR......... 213
7 -6.870IDP01909 putative hydrogenase maturation protease [Salmonella typhimurium LT2] STM1536 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  1......MAEVTILGLGGFGVRAAEKLFEQYADNEKVDVVDGGTQG------------------LALLPWLQQTEKLLIMDA------IDFGMAPGSLAMFRDEQVPAYLTAKKLSLHQTSFSEVLALLQLTGGQL-SEIVLIGVQPE-----CLDDYGGSLTPQVKAQLMPAVYLAQEVLAQWGITASSAAL 163
8 -6.710IDP02330 gene: ilvC-1; ketol-acid reductoisomerase [Bacillus anthracis str. `Ames Ancestor`] GBAA1419 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  19........KVAIIGYGSQGHAHAQNLRD-----NGFDVVVG-----LRKGKSWDKAKEDGFSVYTVAEAAKQADVVMILQPEVYEEEIAPNLQAGNSLVFAHGFNVHFDQVKPPVNVDVFLVAPKGPGHLVRRTFSEGGAVPALFAVYQD.......................................... 155
9 -6.580IDP90877 oxidoreductase, zinc-binding dehydrogenase family [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1548c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  189........SVAVAGFGGLGMMAV-----KYAVKMGAKVSVFARNENKKADALAMGVSSFYTSCDKNAVKERFDLIISTIPTPYNPAIYLDLLKFGGEMALPPHEVAPSISVITFVHKAGKKVYGSLIGGIAETQEMLDFSLKHGIYPETELITPQEIDKAYENLTSGKAKFRYV.................. 352
10 -6.460IDP04177 shikimate kinase [Vibrio cholerae O1 biovar El Tor str. N16961] VC2629 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  1...MAEKRNIFLVGPMGAGKSTIGRHLAQQL---HMEFIDSDTVIEERTGADIEEGFRKREEAVINDLTEQQGIVLATGGGSVISKENRNRLSARGIVVYLETTIEKQLARTNRDKKRLQTDCPREVLEQLAEDRNPLYEEIADITVRTDDQSAKVVANQIVKMLEEHI....................... 173

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 9 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10.