current user: public

If you have questions about the server, please let us know.

Query: TM0016 TM0016 281897 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MRMSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQEGGIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEGLast
1 -34.200IDP02723 gene: nuoI; NADH dehydrogenase subunit I [Francisella tularensis subsp. tularensis SCHU S4] FTT0039 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  23  20LKVTGKHFFTRKV--TVQYPDEKTNRFRGLHALRRYENGEERCIACKLCEVVCPALAITINSTESYEMDLFKCIFCGYCEESCPVDSIVETNILEYHFEE. 129
2 -32.100IDP02246 gene: rnfB; Iron-sulfur cluster-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0649c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  27  76...................................AKIDESMCIGCEKCLLACPVDAIVGAKKLMHTIIEAECTGCELCVEPCPMDCISLVDLAADKQPN. 140
3 -31.100IDP06075 gene: nuoI; NADH dehydrogenase subunit I [Helicobacter pylori J99] NP_223907 [Helicobacter pylori J99]  ali follow..  26  38LGLTIKEFFSPSV--TIHYPMEQLPRYRAVHHLQRLDSGSERCIGCGLCEKICTSNCIRIITHKSYTINLGRCIYCGLCAEVCPELAIVMGNRFENASTQ. 148
4 -30.200IDP00452 electron transport complex protein RnfB YPO2245 [Yersinia pestis CO92]  ali follow..  33  110...................................AFIDEANCIGCTKCIQACPVDAIIGATRAMHTVLSDLCTGCDLCVAPCPTDCIEMIPVATTTANW. 174
5 -30.000IDP90516 gene: oorD; 2-oxoglutarate-acceptor oxidoreductase subunit OorD [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0535 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  23  7...............................KDTPVWVDEHRCKACNICVSYCPAGVLAMRDDMIEVVHPESCIGCTECEIHCPDFAIMVAKRDEFKFAK. 82
6 -25.300IDP00453 putative iron-sulphur protein YPO2969 [Yersinia pestis CO92]  ali follow..  33  138........................................NTYIYCDSCADYCEKQALIWQANQPPTLVTELCDGCGECVFRCPARILEMQ.......... 188
7 -24.900IDP06055 ferredoxin [Helicobacter pylori J99] NP_222983 [Helicobacter pylori J99]  ali follow..  31  1..................................MSLLVNDECIACDACREECPSEAIEEGDP-IYSIDPDRCTECPRCVSVCPVDAILPDPNNAESKEE. 72
8 -23.900IDP91439 ferredoxin [Vibrio vulnificus CMCP6] VV1_0471 [Vibrio vulnificus CMCP6]  ali follow..  28  1..................................MALLITDKCINCDMCDPECPNGAISMGDKI-FEIDPNLCTECKTCQSVCPITKCIITDPNHIETEEQ 72
9 -23.200IDP01812 ferredoxin [Francisella tularensis subsp. tularensis SCHU S4] FTT1764c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  29  1..................................MPFVVTESCIKCGDCVEVCPVDCFYEGPNMLV-INPDECIDCALCEPECPVNAIKSSDDLSENEE.. 66
10 -20.900IDP01518 formate dehydrogenase, iron-sulfur subunit VC1512 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  27  56.........................................ACMHCTDCMAVCPADCFVHTEDGIVLHNKDLCIGCGYCLFACPFGAPQFPKQAAFGER.. 115
11 -20.400IDP00983 gene: phsB; thiosulfate reductase electron transport protein STM2064 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  19  48..........................EQASNALTHFQFVRVSCQHCENCVSVCPTGASYRDENGIVQVDKSRCIGCDYCVAACPFHVRYLNPQTGVADK.. 122
12 -20.400IDP01308 iron-sulfur cluster-binding protein VC1516 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  28  412..................................TIECQTSDCTLCMSCVAVCPTRALHLAGDSALRFIEQDCVQCGLCVKACPEQVLSATPQLNWNK... 476
13 -19.700IDP00930 putative hydrogenase protein STM0612 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  21  41..........................DKDIYPHEERAFYSLACNHCEHCVAACPVEAYTKREDGVVVHNPERCIGCKNCIRNCPYGAPRFNEETRKAEK.. 115
14 -19.500IDP00961 gene: ttrB; tetrathionate reductase complex subunit B STM1385 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  29  106..........................................CNHCDNCVPVCPVQATFQREDGIVVVDNKRCVGCAYCVQACPYDARFINHETQTADK.. 164
15 -18.800IDP93838 nrfc protein [Yersinia enterocolitica subsp. palearctica Y11] YP_006003981 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  23  76..........................PVGEFPAVKYQFYRHSCQHCDKCVDVCPTGASYRDATGIVDVNPDLCVGCQYCIAACPYRVRFIHPVTKTADK.. 151
16 -18.500IDP00546 gene: frdB; fumarate reductase iron-sulfur subunit YPO0359 [Yersinia pestis CO92]  ali follow..  25  138...............................AQMAKYHQFSGCINCGLCYAACPQGPAAITLAHRYNLDNRSCTFVGYCSEVCPKHV.............. 219
17 -18.400IDP01082 gene: nrfC; putative formate-dependent nitrite reductase STM4279 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  21  76..........................PQGTFPDVKYRFFRHSCQHCDHCVDVCPTGASFRDASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVSKTADK.. 151
18 -18.400IDP00470 putative iron-sulfur cluster-binding protein YPO0367 [Yersinia pestis CO92]  ali follow..  29  222.......................................EEQCGRCVACMTTCPTGAIV----APYTVDARRCIGCDDCQLICPWN............... 288
19 -18.300IDP01930 gene: narY; nitrate reductase 2 beta subunit [Salmonella typhimurium LT2] STM1578 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  21  165........................KEMYGQFENTFMMYLPRLCEHCLSCVATCPSGAIYKREDGIVLIDQDKCRGWRLCISGCPYKKIYFNWKSGKSEK.. 242
20 -18.300IDP04528 gene: napH; quinol dehydrogenase membrane component [Salmonella typhimurium LT2] STM2257_1_289 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  22  222......................................KREKCNRCMDCFHVCPEPHVLRAEQSPAQVTHRDCMTCGRCVDVCSEDVFTITIRNIIRDASR 288
21 -17.900IDP00543 gene: fdoH; formate dehydrogenase-O, iron-sulfur subunit YPO4057 [Yersinia pestis CO92]  ali follow..  21  86..........................EDEESGKLEWLIRKDGCMHCADCLKACPSEGAIIQANGIVDFQSEHCIGCGYCIAGCPFDVPRMNKDDNRVYK.. 161
22 -17.800IDP01006 putative anaerobic dimethylsulfoxide reductase STM2529 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  32  77.........................................SCNHCADCTKNCPTTAMHKRGDGIVRVDTDKCVGCGYCAWSCPYGAPQLNEQTGQMSK.. 137
23 -17.700IDP91392 hypothetical protein VV1_1289 [Vibrio vulnificus CMCP6] VV1_1289 [Vibrio vulnificus CMCP6]  ali follow..  36  186.......................................EEACGKCQACITSCPTQAIV----DNKVVDARRCIGCDDCQLVCPWN............... 252
24 -17.500IDP00878 putative anaerobic dimethylsulfoxide reductase subunit B STM4306 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  22  65.........................................ACNHCDECVSGCPTGAMHKREDGLVVVDDSVCVGCRYCEMRCPYGAPQFDTQANVMRK.. 125
25 -17.300IDP01474 fumarate reductase iron-sulfur subunit VC2657 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  26  138...............................EQMARYKQFAGCINCGLCYAACPQFGLNPEFLGPAALTLAHCTFVGYCSEVCPKHV.............. 219
26 -17.200IDP04683 iron-sulfur cluster-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA3269 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  307......................................EVLKCIRCGACVNVCPVYRNILEGYEELKELPFASSLCGACTDVCPVKILLIEHRKDVVEQGF 393
27 -17.000IDP00615 gene: sdhB; succinate dehydrogenase iron-sulfur subunit SACOL1160 [Staphylococcus aureus subsp. aureus COL]  ali follow..  23  160...............................KKRQTAYELSKCMTCGVCLEVCPNTKDERLNALMGTGGLQQCGNSQNCVNACPKGI.............. 242
28 -17.000IDP92111 iron-sulfur subunit of succinate dehydrogenase, putative [Toxoplasma gondii ME49] TGME49_015280 [Toxoplasma gondii ME49]  ali follow..  24  219..................................RKLDGMYECILCACCSTSCPSGPAVLMQAFRWIADSRRCHGIMNCTVSCPKGL.............. 298
29 -16.600IDP00512 electron transport complex protein RnfC YPO2244 [Yersinia pestis CO92]  ali follow..  30  373......................................PEQSCIRCGLCVDACPAGLLPQEHEKARNHNLFDCIECGACAYVCPSN-IPLVQYYRQEKAE. 442
30 -16.400IDP91352 electron transport complex protein RnfC [Vibrio vulnificus CMCP6] VV1_3095 [Vibrio vulnificus CMCP6]  ali follow..  29  374......................................YEMECIRCGACAEACPASLLAEEFDKCEELNLKDCIECGACAFVCPSE-IPLVSYYRQAKAE. 443
31 -16.300IDP02074 gene: hybA; hydrogenase 2 protein HybA [Salmonella typhimurium LT2] STM3149 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  24  111.........................................QCMHCVDCVSVCPVSALKKDKTGIVHYDKDVCTGCRYCMVACPYNVPKYDYNNP...... 167
32 -16.100IDP02592 glycolate oxidase, iron-sulfur subunit, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA1308 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  29  23........................................LNCMRCGFCLPTCPTYIQSIEPDEDVENTLNVCLGCRACEPVCPSGV.............. 91
33 -16.000IDP90660 pyruvate ferredoxin/flavodoxin oxidoreductase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1476c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  22  667.................SFEHGTTEYEKRGVGVMVPRWIEANCIQCNQCASVCPHAVIRPFLINDEEMSPLDCTGCELCVHECPTKEKSLVMVPLQEEMDF 778
34 -15.200IDP02194 gene: sdhB; succinate dehydrogenase iron-sulfur subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0075 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  23  133...............................EDRAKLDGLYECILCACCTTSCPSFWWNPDEDLKDPFSLFRCRTIMNCVSVCPKGL.............. 215
35 -14.900IDP01445 gene: sdhB; succinate dehydrogenase iron-sulfur subunit VC2088 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  145........................................YECIMCACCTTSCPSFWWNPDSNLDDAFSVFRCHGIMNCVSVCPKGL.............. 218
36 -13.000IDP06284 ferredoxin [Streptococcus pneumoniae TIGR4] NP_346049 [Streptococcus pneumoniae TIGR4]  ali follow..  19  1.................................MKITLIPERCIACGLCQ-TYSD-VRFYDDPDQLEKEISPSQDILEAVKNCPTRALIGNQEA....... 68
37 -12.500IDP02316 gene: nuoG; NADH dehydrogenase subunit G [Francisella tularensis subsp. tularensis SCHU S4] FTT0037 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  17  149.....................................TDMTRCILCTRCVRFGEEIA-VMGRGDHSAISTYISEISANIIDLCPVGALT............ 211
38 -11.800IDP06171 gene: nuoG; NADH dehydrogenase subunit G [Helicobacter pylori J99] NP_223905 [Helicobacter pylori J99]  ali follow..  30  137....................................LYDPNLCIMCERCVTTCKDNV-RKQKGIISFVGSVPCYDCGECIAVCPVGALS............ 219
39 -9.030IDP00444 putative oxidoreductase Fe-S binding subunit YPO0342 [Yersinia pestis CO92]  ali follow..  23  6....................................VADAESCIGCRSCEVACVVTPRVKVFKGDQCATAVFCHHCAPCASTCPNGAIVELNNRVQVIQE. 85

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.