current user: public
If you have questions about the server, please let us know.

Query: TM0002 TM0002 281883 Purified-2001-08-29, from T.maritima

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst MSPEDWKRLICFHTSKEVLKQTLDDAQQNISDSVSIPLRKYLast
1 -5.590sp|Q8WZ82|OVCA2_HUMAN Ovarian cancer-associated gene 2 protein OS=Homo sapiens GN=OVCA2 PE=1 SV=1  ali follow..  11  1MAAQRPLRVLCLAQSERGFREKTGALRKALRGRAEL..... 39
2 -4.720sp|P46379|BAT3_HUMAN Large proline-rich protein BAT3 OS=Homo sapiens GN=BAT3 PE=1 SV=2  ali   22  265..PPEWVPII----QQDIQSQRKVKPQPPLSDAYGMPAKR. 300
3 -4.300sp|Q9BV73|CP250_HUMAN Centrosome-associated protein CEP250 OS=Homo sapiens GN=CEP250 PE=1 SV=2  ali   36  7......EQLQGLSSAKELLESSLFEAQQQNS.......... 31
4 -4.270sp|Q12766|HMGX3_HUMAN HMG domain-containing protein 3 OS=Homo sapiens GN=HMGXB3 PE=2 SV=2  ali   25  127.....YNRLMDFLTSREIVNRQIHDIVQSCQPGEVV..... 157
5 -4.240sp|P27987|IP3KB_HUMAN Inositol-trisphosphate 3-kinase B OS=Homo sapiens GN=ITPKB PE=1 SV=5  ali   33  283.........................EETQGSPRGNLPLRK. 297
6 -4.110sp|A8MYX2|F25DE_HUMAN Protein FAM25D/E OS=Homo sapiens GN=FAM25D PE=2 SV=2  ali follow..  25  100.EPSPWTCLLCVHAMEEVVKEVVGHAKETGEKAIAEAIKK. 139
7 -3.990sp|P46379|BAT3_HUMAN Large proline-rich protein BAT3 OS=Homo sapiens GN=BAT3 PE=1 SV=2  ali   22  115..PPEWVPII----QQDIQSQRKVKPQPPLSDAYGMPAKR. 150
8 -3.770sp|Q86YA3|CD021_HUMAN Uncharacterized protein C4orf21 OS=Homo sapiens GN=C4orf21 PE=1 SV=2  ali   42  2.....................ALDKSNTHISNSLFYPLGK. 20
9 -3.720sp|Q5T5A4|CA194_HUMAN Uncharacterized protein C1orf194 OS=Homo sapiens GN=C1orf194 PE=2 SV=1  ali follow..  18  42...EPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAA. 78
10 -3.650sp|Q9UPA5|BSN_HUMAN Protein bassoon OS=Homo sapiens GN=BSN PE=1 SV=4  ali   32  251............HAYKREEGYILDDSHCVVSDSEAYHLGQ. 278
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 8 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Jaroszewski L, Li W, Godzik A. Comparison of sequence profiles. Strategies for structural predictions using sequence information. Protein Sci. 2000 Feb;9(2):232-41.