current user: public

If you have questions about the server, please let us know.

Query: TM0003 TM0003 281884 Purified-2001-12-06, from T.maritima

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst METVKAYEVEDIPAIGFNNSLEVWKLFPASSSRSTSSSFQLast
1 -4.200sp|P25054|APC_HUMAN Adenomatous polyposis coli protein OS=Homo sapiens GN=APC PE=1 SV=2  ali   30  287.DMPRVYCVEGTPI.......................... 299
2 -3.820sp|Q9Y4R7|TTLL3_HUMAN Tubulin monoglycylase TTLL3 OS=Homo sapiens GN=TTLL3 PE=1 SV=2  ali   25  269............PQIDMEGDRNIWIVKPGAKSRGRG.... 292
3 -3.810sp|A8MUN3|YQ048_HUMAN Putative uncharacterized protein ENSP00000381830 OS=Homo sapiens PE=5 SV=1  ali follow..  32  47.........KDVPGAGEVLFMCSWRIFPVASASPSSS... 74
4 -3.770sp|O95988|TCL1B_HUMAN T-cell leukemia/lymphoma protein 1B OS=Homo sapiens GN=TCL1B PE=1 SV=1  ali follow..  47  87......................VWQLYPGRKYRAADSSF. 103
5 -3.600sp|O15297|PPM1D_HUMAN Protein phosphatase 1D OS=Homo sapiens GN=PPM1D PE=1 SV=1  ali   27  72....KAQEIERTPPTNFKRTLEESNSGPLMKKHRRNG... 104
6 -3.560sp|Q5VVJ2|MYSM1_HUMAN Histone H2A deubiquitinase MYSM1 OS=Homo sapiens GN=MYSM1 PE=1 SV=1  ali   17  38TQASETLAVRGFSVIGWYHSHPAFDPNPSLRDIDTQAKYQ 77
7 -3.540sp|O43676|NDUB3_HUMAN NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 OS=Homo sapiens GN=NDUFB3 PE=1 SV=3  ali follow..  15  16LPDYRQWKIEGTPLETIQKKLEAWRYMGGFAKSVSFSD.. 65
8 -3.530sp|P56279|TCL1A_HUMAN T-cell leukemia/lymphoma protein 1A OS=Homo sapiens GN=TCL1A PE=1 SV=1  ali follow..  47  75......................MWQLYPDGRYRSSDSSF. 91
9 -3.520sp|Q8TEQ8|PIGO_HUMAN(removed signalp:1-22) GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=2 SV=3  ali   37  107...........LAASILRRHLMVWKVF............. 122
10 -3.450sp|O95996|APC2_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens GN=APC2 PE=1 SV=1  ali   3.KALQKLAAQEGP-LSLSRCSSLSSLSSAGRPGPSEGG.. 38

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.