current user: public

If you have questions about the server, please let us know.

Query: TM0004 TM0004 281885 Purified-2004-07-19, from T.maritima

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30
# Score Template Links and tools%idFirst MKDLYERFNNSLEVWKLVELFGTSIRIHLFQLast
1 -4.100sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=2 SV=2  ali   24  276LEALTRELERALEARTARDYFGICI...... 300
2 -4.090sp|P0C7A2|F153B_HUMAN Protein FAM153B OS=Homo sapiens GN=FAM153B PE=2 SV=1  ali follow..  33  376.........NVLKCWDIFNIF.......... 387
3 -4.020sp|Q96JN8|NEUL4_HUMAN Neuralized-like protein 4 OS=Homo sapiens GN=NEURL4 PE=1 SV=2  ali   17  256...ACSGLPPGKEVYAVVDLYGQCVQVSITN 283
4 -4.020sp|Q56UN5|YSK4_HUMAN SPS1/STE20-related protein kinase YSK4 OS=Homo sapiens GN=YSK4 PE=1 SV=1  ali   25  47.SDMFKEINSTANGPGIYEMFGTPVYCHV.. 74
5 -4.010sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2  ali   24  273.....EIFGDALMVLEFLNAFGELFDLQDE. 297
6 -4.010sp|P0C7T5|ATX1L_HUMAN Ataxin-1-like OS=Homo sapiens GN=ATXN1L PE=1 SV=1  ali   37  1MKPVHERSQECLP--KKRDLPVTSE...... 24
7 -3.980sp|Q9Y6V0|PCLO_HUMAN Protein piccolo OS=Homo sapiens GN=PCLO PE=1 SV=3  ali   13  267.ADTRDQFGSSHSLPEVQQHMREESRTRGYD 296
8 -3.900sp|Q56UN5|YSK4_HUMAN SPS1/STE20-related protein kinase YSK4 OS=Homo sapiens GN=YSK4 PE=1 SV=1  ali   25  197.SDMFKEINSTANGPGIYEMFGTPVYCHV.. 224
9 -3.850sp|P54253|ATX1_HUMAN Ataxin-1 OS=Homo sapiens GN=ATXN1 PE=1 SV=2  ali   43  1MKSNQERSNECLPPKK--EIPATS....... 23
10 -3.580sp|Q96JN8|NEUL4_HUMAN Neuralized-like protein 4 OS=Homo sapiens GN=NEURL4 PE=1 SV=2  ali   17  221........DVPQPCHALVDLYGQCEQVTIVN 243

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.