current user: public

If you have questions about the server, please let us know.

Query: TM0009 TM0009 281890 Purified-2001-02-14, from T.maritima

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MIGPRDLLNIALRIESTGYSYYKNLTEKTEGETKALFERLAEQERDHSRKFKEILEKYEQDLNPSDEVLGYLEALAEISIFPKLEETPPDDLREAVRRAIEVEKDSIVFYSEILSYVPEKEPVQTIIDEEKKHLRDLLRLEVLast
1 -17.500sp|Q99807|COQ7_HUMAN Ubiquinone biosynthesis protein COQ7 homolog OS=Homo sapiens GN=COQ7 PE=1 SV=3  ali follow..  16  49...VDRIIRVDHAGEYGANRIYAQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVR-------PTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMELQLIKKFRDEELEHHDIGLDHDA 190
2 -14.600sp|P02794|FRIH_HUMAN Ferritin heavy chain OS=Homo sapiens GN=FTH1 PE=1 SV=2  ali follow..  13  16..DSEAAINRQINLELYASYVYLSMSYYFDRDFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQD--------------IKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNIETHYLNEQVKAIKELGDHVT 154
3 -14.100sp|Q9BXU8|FHL17_HUMAN Ferritin heavy polypeptide-like 17 OS=Homo sapiens GN=FTHL17 PE=2 SV=1  ali follow..  14  16..NCDAAINSHITLELYTSYLYLSMAFYFNRDFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHD--------------IRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGLESHYLHEQVKTIKELGGYVS 154
4 -13.400sp|Q8N4E7|FTMT_HUMAN Ferritin, mitochondrial OS=Homo sapiens GN=FTMT PE=1 SV=1  ali follow..  13  75..DSEAAINRQINLELYASYVYLSMAYYFSRDFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQD--------------IKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGLETYYLNEQVKSIKELGDHVH 213
5 -13.100sp|P02792|FRIL_HUMAN Ferritin light chain OS=Homo sapiens GN=FTL PE=1 SV=2  ali follow..  13  12..DVEAAVNSLVNLYLQASYTYLSLGFYFDRDVSHFFRELAEEKREGYERLLKMQNQRGGRALFQD--------------IKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTLETHFLDEEVKLIKKMGDHLT 150
6 -10.800sp|P0C7X4|FHL19_HUMAN Putative ferritin heavy polypeptide-like 19 OS=Homo sapiens GN=FTHL19 PE=5 SV=1  ali follow..  12  1..................MAFYFDQDDAALEHFDRYFLRQSQEKREHAQELMSLQNLRGGRICLHD--------------IRKPEGQGWESGLKAMECTFHLEKNINQSLLELHQLARENGLENDFLNQQAKTIKELGGYLS 117
7 -10.100sp|Q9Y6W3|CAN7_HUMAN Calpain-7 OS=Homo sapiens GN=CAPN7 PE=1 SV=1  ali   12  7ERDAVQFARLAVQRDHEAVFYYKEAAQALAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDLERAHFLVTQ------AFDEDEKENVEDAIELYTEAVDLCLKTSYETADKVLQNKLKQLARQALDRAEALSE 152
8 -10.100sp|P31350|RIR2_HUMAN Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens GN=RRM2 PE=1 SV=1  ali follow..  11  127...ISHVLAFFAASDG-NENLVERFSQEVQIEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERV----EGIFFSGSFASIF--TFSNELISRDEGLHCD....... 271
9 -9.970sp|Q7LG56|RIR2B_HUMAN Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens GN=RRM2B PE=1 SV=1  ali follow..  11  116............................QVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVA--EGVFFSGSFALMPGLTFSNELISRDEGLHCD....... 233
10 -8.730sp|Q96LX7|CCD17_HUMAN Coiled-coil domain-containing protein 17 OS=Homo sapiens GN=CCDC17 PE=2 SV=2  ali   1.....EMEAQSRALQLRGEELSRRLQVVACTRLEQEIRELQAEAGRTRGALEVLGARIQELQAEPGNPLSSRREAELYSPVQKANPGTLAAEIRALREALQVEASALELQRSQTRRGRAGATSGELPVVEAENRRLEAEILA 162

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.