current user: public

If you have questions about the server, please let us know.

Query: TM0016 TM0016 281897 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MRMSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQEGGIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEGLast
1 -34.100sp|O00217|NDUS8_HUMAN(removed signalp:1-19) NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Homo sapiens GN=NDUFS8 PE=1 SV=1  ali follow..  30  49LGMTLSYLFREPA--TINYPFEKSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTET. 158
2 -22.200sp|Q12882|DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP+] OS=Homo sapiens GN=DPYD PE=1 SV=2  ali   34  192...............................EQVVAMIDEEMCINCGKCYMTCNDQAIQFDPETHLPTITDTCTGCTLCLSVCPIDCIKMVSRTT...... 259
3 -21.900sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2  ali   20  96.....................................VNRNLSIYDGPEQRFCPAGVYEFVPGFRLQINAQNCVHCKTCDIKDPSQNINWV.......... 154
4 -20.500sp|Q9H6Q4|NARFL_HUMAN Cytosolic Fe-S cluster assembly factor NARFL OS=Homo sapiens GN=NARFL PE=1 SV=1  ali follow..  12  18....................................IGPSQECIKPVKVEKRAGSGVAKIRRLEKAKVSLNDCLACSGCITSAETVLITQQSHEELKKV.. 97
5 -19.600sp|Q9UHQ1|NARF_HUMAN Nuclear prelamin A recognition factor OS=Homo sapiens GN=NARF PE=1 SV=1  ali follow..  15  2.........................................KCEHCTRKECSKKTKTDDQENLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRV.. 79
6 -19.500sp|P21912|DHSB_HUMAN(removed signalp:1-15) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens GN=SDHB PE=1 SV=3  ali follow..  22  163..................................EKLDGLYECILCACCSTSCPSYWWNGDKKLQDPFSLYRCHTIMNCTRTCPKGL.............. 242
7 -15.700sp|P28331|NDUS1_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens GN=NDUFS1 PE=1 SV=3  ali   18  20....................................KTIMTRCIQCTRCIRFASEIA-TTGRGNDMQVGTYMSELSGNIIDICPVGALT............ 82
8 -12.000sp|Q16134|ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens GN=ETFDH PE=1 SV=2  ali   21  254.............................................DGPEQRFCPAGVYEFGDGFRLQINAQNCVHCKTCDIKDPSQ............... 299
9 -10.300sp|P28331|NDUS1_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens GN=NDUFS1 PE=1 SV=3  ali   18  170....................................KTIMTRCIQCTRCIRFASEIA-TTGRGNDMQVGTYMSELSGNIIDICPVGALT............ 232
10 -10.000sp|P06213|INSR_HUMAN(removed signalp:1-27) Insulin receptor OS=Homo sapiens GN=INSR PE=1 SV=4  ali   20  221......................................DPTKCVACGRCVETCPPPYY--HFQDWRCVNFSFCQDLNKCIPECPSGYTMNSSN........ 298
11 -9.780sp|Q5VZL5|ZMYM4_HUMAN Zinc finger MYM-type protein 4 OS=Homo sapiens GN=ZMYM4 PE=1 SV=1  ali   19  190.........................................SCSGCKKCSTLCLTGYTVPPARPPPPLTKKTCSSCSFCSQSC.................. 271
12 -9.340sp|Q15303|ERBB4_HUMAN(removed signalp:1-25) Receptor tyrosine-protein kinase erbB-4 OS=Homo sapiens GN=ERBB4 PE=1 SV=1  ali   28  248......................................GPDNCTKCPNCVEKCPDGLQGANSFIFKYADPDECHPCPNCTQGC.................. 300
13 -9.220sp|Q6UXX9|RSPO2_HUMAN(removed signalp:1-21) R-spondin-2 OS=Homo sapiens GN=RSPO2 PE=1 SV=2  ali follow..  27  27......................................KDNGCSRCGECLHSCPSGYYGHRAPDMNRCSKDFCTKCGRCFDECPDG............... 110
14 -9.200sp|P18084|ITB5_HUMAN(removed signalp:1-24) Integrin beta-5 OS=Homo sapiens GN=ITGB5 PE=1 SV=1  ali   20  1..........................................CEKCPTCPDACS--------------TKRDCVECLLCHSLCRDEVITWVDTIVKDDQEA 55
15 -9.160sp|P14616|INSRR_HUMAN(removed signalp:1-23) Insulin receptor-related protein OS=Homo sapiens GN=INSRR PE=2 SV=2  ali   20  219......................................DPRACVACGACLWACPPGTYQYESWRERCASLHSVPGRGSCLAQCPSGFTRNSSSIFCHKCEG 299
16 -9.140sp|P04626|ERBB2_HUMAN(removed signalp:1-22) Receptor tyrosine-protein kinase erbB-2 OS=Homo sapiens GN=ERBB2 PE=1 SV=1  ali   28  226......................................KHSDCLACGICELHCPALVTYNTDTFESMPNPESCVACGSCTLVCPLHNQEV........... 300
17 -9.130sp|Q12882|DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP+] OS=Homo sapiens GN=DPYD PE=1 SV=2  ali   255..................................TSTSMIRRAFEAGWGF----------------ALTKTFSLDKDIVTNVSP................. 288
18 -9.090sp|Q96RL1|UIMC1_HUMAN BRCA1-A complex subunit RAP80 OS=Homo sapiens GN=UIMC1 PE=1 SV=2  ali   21  198......................................SSSNQVSCPLCDQCFPPTKI--------ERHAMYCNGCYLCKSLVPFREYQ............ 276
19 -9.020sp|P21860|ERBB3_HUMAN(removed signalp:1-19) Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens GN=ERBB3 PE=1 SV=1  ali   18  220......................................QDTDCFACGACVPRCPQPQLEPNPHTKYQYGGVCVASCTSCVRACPPDKMEVDKN........ 296

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.