current user: public

If you have questions about the server, please let us know.

Query: TM0001 TM0001 281882 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst MVYGKEGYGRSKNILLSECVCGIISLELNGFQYFLRGMETLLast
1 -1.010HGC00579 gi|163284429|dbj|BABD01026259.1|2.0 TMP00679;  ali follow..  20  147..FGRKRKTAAKRIQNEDTDTGILKGN.............. 171
2 -0.640HGC01215 gi|162843249|dbj|BABA01001460.1|3.0 TMP01713;  ali follow..  13  1...................LVGVFCVEGFSVDVFIVHIREI 22
3 -0.607PB067216 JCVI_PEP_1096676511767 /source_dna_id=JCVI_ORF_1096676511766 /offset=0 /translation_table=11 /length=256 /full_length=256  ali follow..  69YIPGYASTDLRRQAVSLAEATDSLSQIISYNERYIERIRMV 109
4 -0.569HGC00518 gi|162728471|dbj|BAAY01000490.1|2.0 TMP00574;  ali follow..  11  57..........KKTLSIPGWLNDAAESAHINFSSVLQ..... 82
5 -0.459PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali follow..  17  164.........AGENLPFFK----IDNAFAEEYKRFLL..... 186
6 -0.366HGC00106 gi|162841414|dbj|BABA01003295.1|1.0 TMP01000;  ali follow..  3....DGDFVKLSNLTIGYTLPIRNNKYMKSLRVYVSGNNLF 39
7 -0.351PB162020 _JGI.0344610_ 2004040329 [Human Gut Community Subject 8]  ali follow..  13  67...GKKATFGNNITLTPDECRTLKDYAVSSFA......... 95
8 -0.262PB037276 Q24TM0_DESHY/1-190 PB037276; Pfam-B_37276;  ali follow..  18  64.........VKKFLQIDYCIEGCYEVEYQNGTVSFLGEGDL 95
9 -0.185PB069407 _HOMD.0084606_ pint_c_2_12 Prevotella intermedia 17 [3585 - 4295] ORF  ali follow..  13  2....NKRLNLYCTILLCIMSAVILYSFYAVSKDMVSGFTA. 37
10 -0.171PB007740 Q89YT2_BACTN/1-193 PB007740; Pfam-B_7740;  ali follow..  17  130....EKYYNEFSKILSQKQIMKIYQQEKSNMNKFRKEFD.. 164

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.