|
current user: public |
|
Query: TM0004 TM0004 281885 Purified-2004-07-19, from T.maritima |
. 10 . 20 . 30 | |||||||
# | Score | Template | Links and tools | %id | First | MKDLYERFNNSLEVWKLVELFGTSIRIHLFQ | Last |
1 | -1.320 | PB007011 gi|160888195|ref|ZP_02069198.1| hypothetical protein BACUNI_00603 [Bacteroides uniformis ATCC 8492]gi|156862330|gb|EDO55761.1| hypothetical protein BACUNI_00603 [Bacteroides uniformis ATCC 8492] | ali follow.. | 25 | 142 | ........SRSFEYYLLLHF........... | 153 |
2 | -0.624 | PB002104 Q72PH8_LEPIC/1-220 PB002104; Pfam-B_2104; | ali follow.. | 50 | 99 | .........NLIEFW................ | 104 |
3 | -0.518 | PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013; | ali follow.. | 18 | 31 | ........AELAGIWQLCH............ | 41 |
4 | -0.465 | PB007740 Q89YT2_BACTN/1-193 PB007740; Pfam-B_7740; | ali follow.. | 11 | 130 | .EKYYNEFSKILSQKQIMKIYQQEKSNM... | 156 |
5 | -0.448 | PB019827 gi|67919427|ref|ZP_00513005.1| conserved hypothetical protein [Chlorobium limicola DSM 245]gi|67782966|gb|EAM42367.1| conserved hypothetical protein [Chlorobium limicola DSM 245] | ali follow.. | 11 | 213 | ...IYVYEDDLPLVFNSTGFNGRGKAFFI.. | 238 |
6 | -0.383 | PB053244 _HOMD.0087087_ pint_c_2_2642 Prevotella intermedia 17 [158005 - 157583] (REVERSE SENSE) ORF | ali follow.. | 21 | 105 | ..............WVVILLIATALEVY... | 118 |
7 | -0.358 | HGC00024 gi|162813637|dbj|BABA01031072.1|2.0 TMP01508; | ali follow.. | 6 | 147 | ......KCLRAYFFLNLAFYYT......... | 162 |
8 | -0.049 | HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139; | ali follow.. | 15 | 2 | .....LNFHSKKVMCIQQEIYARMIMYNFVQ | 27 |
9 | -0.043 | HGC01215 gi|162843249|dbj|BABA01001460.1|3.0 TMP01713; | ali follow.. | 38 | 12 | .................VDVFIVHIREICF. | 24 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26; |