current user: public

If you have questions about the server, please let us know.

Query: TM0009 TM0009 281890 Purified-2001-02-14, from T.maritima

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MIGPRDLLNIALRIESTGYSYYKNLTEKTEGETKALFERLAEQERDHSRKFKEILEKYEQDLNPSDEVLGYLEALAEISIFPKLEETPPDDLREAVRRAIEVEKDSIVFYSEILSYVPEKEPVQTIIDEEKKHLRDLLRLEVLast
1 -4.410PB007740 Q89YT2_BACTN/1-193 PB007740; Pfam-B_7740;  ali follow..  39............QMMQMQTNQMVRALMLDDATAAKFTPIYEKYLKELRECRMMNFKPRA-------RKDAAQGTEANTAKETPKPVMTDAEIAKMLKDQFAQSRKMLDYYNEFSKILSQKQIMKIYQQEKSNMNKFRKEF.. 163
2 -3.770PB177066 Q891G9_CLOTE/1-159 PB177066; Pfam-B_177066;  ali follow..  3VLSLKEVKLLMNDTQKNDLFYIEFIGRKTKNRRSIIVQKLGKKELIRQLDIAEANHCLSFEQVSDEIIEYF--------------QEGDFHTVESCKYNVPSVQAIGKVY---------HRLIISIISEQDNLVDVLFEVF. 126
3 -3.350PB039305 _Gut.Meta.Jp.0057508_ gi|162726131|dbj|BAAY01002830.1||2 (- 1092:1581~0 complete)  ali follow..  13  19..................................................................................................TMTVMESSVRFSKGVTEALGCPAYVKLLVNDKQKKIAV...... 56
4 -3.160HGC00593 gi|162858151|dbj|BABB01011554.1|1.0 TMP00709;  ali follow..  20  9......................................................................................................DVLVKKFFSENRIDVPDDGFSRRVMRRLPDRTRRISRLWT 48
5 -3.130PB012954 Q5LF97_BACFN/1-383 PB012954; Pfam-B_12954;  ali follow..  25  328.IPDKKRLIIEIQ-ERNGGRHFLRKQQETEDEADKILRRIA..................................................................................................... 383
6 -2.870PB030138 Q7MX14_PORGI/1-113 PB030138; Pfam-B_30138;  ali follow..  15  21....................YYDQRRDELEKRIERIRREVEQEEQA................................................................................................ 46
7 -2.860PB033130 gi|160880323|ref|YP_001559291.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]gi|160428989|gb|ABX42552.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]  ali follow..  10  11ILNYAEFASVTIRAVKDGFFAEAMGHVRTQEEITLILNDNLLSKDWVTDSWEMC-REQQATNRSKLREAKLLRENRIESYYDEALAENVPDAKEILHLAKGNFMEIYRFLTVDGNNVDSNQLLKTLKVKDYKDVSVLED... 190
8 -2.610PB025553 _HOMD.0078651_ pint_c_1_4510 Prevotella intermedia 17 [1755134 - 1755736] ORF  ali follow..  16  19MWQIEDIIR-VYGCSLTRIRKE-DYTDEQKEEEEDWFGDLVRRENGHLQINKVVMQALT................................................................................... 87
9 -2.590PB069407 _HOMD.0084606_ pint_c_2_12 Prevotella intermedia 17 [3585 - 4295] ORF  ali follow..  11  216IFIIYEIFAIGVRMREE............................................................................................................................. 232
10 -2.500HGC00311 gi|163635536|dbj|BABG01000737.1|2.0 TMP00178;  ali follow..  12  1.....................................................................................MAKPKNLEQLRAEKEQVETQLAQEQHKLKRLENRKKYLEKGERQKRTH......... 48

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.