current user: public

If you have questions about the server, please let us know.

Query: TM0002 TM0002 281883 Purified-2001-08-29, from T.maritima

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst MSPEDWKRLICFHTSKEVLKQTLDDAQQNISDSVSIPLRKYLast
1 -5.700sp|Q12766|HMGX3_HUMAN HMG domain-containing protein 3 OS=Homo sapiens GN=HMGXB3 PE=2 SV=2  ali   25  9.....YNRLMDFLTSREIVNRQIHDIVQSCQPGEVV..... 39
2 -5.480tr|F8VX55|F8VX55_HUMAN Uncharacterized protein OS=Homo sapiens GN=TFCP2 PE=4 SV=1  ali   27  22...........FDASLSGIGQELGAGAYSMSDVLALPIFK. 50
3 -5.480sp|Q12800|TFCP2_HUMAN Alpha-globin transcription factor CP2 OS=Homo sapiens GN=TFCP2 PE=1 SV=2  ali   27  22...........FDASLSGIGQELGAGAYSMSDVLALPIFK. 50
4 -5.450sp|A6NFK2|GRCR2_HUMAN Glutaredoxin domain-containing cysteine-rich protein 2 OS=Homo sapiens GN=GRXCR2 PE=3 SV=1  ali   11  20.PIIDFGKIIIYTNNLKIIRTPMDKRDF............. 46
5 -5.360sp|Q9NZI7|UBIP1_HUMAN Upstream-binding protein 1 OS=Homo sapiens GN=UBP1 PE=2 SV=1  ali   27  19...........FDASLSGIGQELGAGAYSMSDVLALPIFK. 47
6 -4.610sp|O75037|KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens GN=KIF21B PE=1 SV=2  ali   36  4.............VSAECLGPPLDISTKNITKSLA...... 25
7 -4.040sp|Q9H8M5|CNNM2_HUMAN Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=1 SV=2  ali   12  1VGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVY 41
8 -3.770sp|Q13459|MYO9B_HUMAN Myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3  ali   20  16......KKLVAAASPSAMLSQSLDLSDRHRATGAAL..... 45
9 -3.760sp|P14316|IRF2_HUMAN Interferon regulatory factor 2 OS=Homo sapiens GN=IRF2 PE=1 SV=2  ali   30  66................QVVEVTTESDEQPVSMSELYPLQ.. 88
10 -3.690sp|Q9NQG6|MID51_HUMAN Mitochondrial dynamic protein MID51 OS=Homo sapiens GN=SMCR7L PE=1 SV=1  ali   8......EKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSF 42

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.