|
current user: public |
|
Query: TM0003 TM0003 281884 Purified-2001-12-06, from T.maritima |
. 10 . 20 . 30 . 40 | |||||||
# | Score | Template | Links and tools | %id | First | METVKAYEVEDIPAIGFNNSLEVWKLFPASSSRSTSSSFQ | Last |
1 | -5.280 | sp|O14497|ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens GN=ARID1A PE=1 SV=3 | ali | 16 | 23 | ...............EFDSGLLHWRIGGGDTTEHIQTHFE | 47 |
2 | -4.720 | sp|Q2M243|CCD27_HUMAN Coiled-coil domain-containing protein 27 OS=Homo sapiens GN=CCDC27 PE=2 SV=2 | ali | 40 | 1 | ................FMSKMELRRVFPQFSTRATSMS.. | 28 |
3 | -4.460 | sp|Q8NFD5|ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens GN=ARID1B PE=1 SV=2 | ali | 25 | 30 | ...............EFNSGLLHWQLGGGDTTEHIQTHF. | 53 |
4 | -4.180 | tr|B1P2N7|B1P2N7_HUMAN Numb isoform 7 OS=Homo sapiens GN=NUMB PE=2 SV=1 | ali | 22 | 37 | .....PYPAPNVPVVGITPSQMVANVFGTAGH........ | 63 |
5 | -4.180 | sp|P49757|NUMB_HUMAN Protein numb homolog OS=Homo sapiens GN=NUMB PE=1 SV=2 | ali | 22 | 37 | .....PYPAPNVPVVGITPSQMVANVFGTAGH........ | 63 |
6 | -3.920 | sp|Q2VWA4|SKOR2_HUMAN SKI family transcriptional corepressor 2 OS=Homo sapiens GN=SKOR2 PE=1 SV=2 | ali | 18 | 1 | .KGPRSYPVIPVPSKGSFGGV---GLFPHPYTFPAAAA.. | 42 |
7 | -3.730 | sp|Q14157|UBP2L_HUMAN Ubiquitin-associated protein 2-like OS=Homo sapiens GN=UBAP2L PE=1 SV=2 | ali | 28 | 15 | ........TEEWGTEDWNEDLSETKIFTASNVSSVP.... | 42 |
8 | -3.690 | sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 | ali | 18 | 33 | ........FTKMAIYGYRHPLELWSLKEEDRSQMVVQQLL | 67 |
9 | -3.660 | sp|Q9NYP8|CU062_HUMAN Uncharacterized protein C21orf62 OS=Homo sapiens GN=C21orf62 PE=1 SV=2 | ali | 26 | 20 | .SAFKSYSIENVTSIANN-DFSYFRTFPMPSNKSYVVTF. | 58 |
10 | -3.480 | tr|C9J713|C9J713_HUMAN Uncharacterized protein OS=Homo sapiens GN=RSRC1 PE=4 SV=1 | ali | 33 | 12 | VKEIEAIESDSFVQQTFRSSKEVKKLF............. | 38 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7. |