current user: public

If you have questions about the server, please let us know.

Query: TM0004 TM0004 281885 Purified-2004-07-19, from T.maritima

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30
# Score Template Links and tools%idFirst MKDLYERFNNSLEVWKLVELFGTSIRIHLFQLast
1 -5.400sp|Q56UN5|YSK4_HUMAN SPS1/STE20-related protein kinase YSK4 OS=Homo sapiens GN=YSK4 PE=1 SV=1  ali   25  26.SDMFKEINSTANGPGIYEMFGTPVYCHV.. 53
2 -4.690sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3  ali   46  52...IYNRINNDLLMWE............... 64
3 -4.400sp|Q96BY7|ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens GN=ATG2B PE=1 SV=5  ali   46  52...LYNRIFNDLLLWE............... 64
4 -3.880sp|Q13459|MYO9B_HUMAN Myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3  ali   26  4.....ERLASAVELWRGKKLVAAA....... 22
5 -3.650sp|Q8NFD5|ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens GN=ARID1B PE=1 SV=2  ali   29  26..GRVQEFNSGLLHWQL----GGDTTEHI.. 49
6 -3.640sp|Q8NI27|THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens GN=THOC2 PE=1 SV=2  ali   30  75..........SEELWGMFKTFPYQHRYRLY. 94
7 -3.440sp|O14497|ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens GN=ARID1A PE=1 SV=3  ali   20  19..GRVQEFDSGLLHWRI----GGDTTEHI.. 42
8 -3.280sp|Q5T1C6|THEM4_HUMAN Thioesterase superfamily member 4 OS=Homo sapiens GN=THEM4 PE=1 SV=1  ali   17  14LRLLFDQFMKKCESWKRLPSYKRTPTEWI.. 44
9 -3.260tr|C9JT10|C9JT10_HUMAN Uncharacterized protein OS=Homo sapiens GN=ACSL6 PE=4 SV=1  ali   16  14ARTMYQVFRRGLSISGNGPCLGFRKPKQPYQ 44
10 -3.200sp|Q96IK0|TM101_HUMAN Transmembrane protein 101 OS=Homo sapiens GN=TMEM101 PE=1 SV=1  ali   30  22....YWHNTRRVEFWNQMKLLGESVGI.... 44

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24