current user: public

If you have questions about the server, please let us know.

Query: TM0014 TM0014 281895 Purified-2001-01-30, from T.maritima

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MREREIVDKLTSAFFAENTIISFTSQLDEALTRKLRRMQRRIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETAGGFTTINRVINSVITAQRKLKDLKILast
1 -7.750tr|E7EQE5|E7EQE5_HUMAN Uncharacterized protein OS=Homo sapiens GN=DNAH3 PE=4 SV=1  ali   10  214................FNPSFDGCWELIRDSFLEIIKNSNGIPKVESVLFPELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCK-DNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYEDIKLNSTLFLWPDQIEDIFDNSRNLLLHKRDQAEM...... 480
2 -6.620sp|Q8TD57|DYH3_HUMAN Dynein heavy chain 3, axonemal OS=Homo sapiens GN=DNAH3 PE=2 SV=1  ali   273...DGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATTVNAEEKLVSDFLIQTFKVFQKNQVGPCK-DNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYQIEDIFDNSRNLLLHKRDQAEDLIKRCSEFELRLEGYH.... 568
3 -6.560sp|Q15111|PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens GN=PLCL1 PE=1 SV=3  ali   7................................................................................LKTIDDIFKIAVHPLREAIDMRENMQNAIVSIKELCPPIASLKQCLLTLSSRLITSDNTPSVSL----VMKDSFPYLEPL-GAIPDVQKKMLTAYDLMIQESRFLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIENMKQIQLAC............... 186
4 -6.350sp|Q5T1A1|DCST2_HUMAN DC-STAMP domain-containing protein 2 OS=Homo sapiens GN=DCST2 PE=2 SV=2  ali   9......................................................................................................................................LLLLPQAF-----SRQGRTLLVLQGPCANTLRNFTRASEAVACGAELALNQTAEVLQRAKQLVSALNKIKAIARKTKEVADRVRKFFRSIMDGVKHIARALRNVWQWLLHIGDVCNSE.......................... 129
5 -6.230sp|Q6ZR08|DYH12_HUMAN Dynein heavy chain 12, axonemal OS=Homo sapiens GN=DNAH12 PE=1 SV=2  ali   12  152...............TFQDLEDNVLSLVERIAEALQNVQTIPSWLSGTSTPVNLDTELPEHVLHWAVDTLKAAVHRNLEGARKHYETYVEKDGTAVENIETFQTEDHTFDEYTEFIEKFLSLASEIMLLPQWIHYTMVRLDCEDLKTGLTNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELILRIQESKR....................................................... 364
6 -6.160sp|Q9UPR0|PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens GN=PLCL2 PE=1 SV=2  ali   1.............................................................................TLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCSSVANLMQCMLAVSPRFLGPDNTPLVVL----NLSEQYPTMELQ-GIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAA............... 183
7 -5.610sp|Q96EV8|DTBP1_HUMAN Dysbindin OS=Homo sapiens GN=DTNBP1 PE=1 SV=1  ali   3....................................................................................................................................................SAGSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADL-----------ESMTANLTHLEASFEEVENNLLHLEDLCGQ........................... 98
8 -5.470sp|Q0VDD8|DYH14_HUMAN Dynein heavy chain 14, axonemal OS=Homo sapiens GN=DNAH14 PE=2 SV=3  ali   60...............AYQNIIVNLLTIIGNSMGLVNAYSHKFIKYCTMTEKAKIMSMKISSMGELTSKEFEAILNRFRNYFRHIVNMAIEKR--IGIFNVVVESSLQQLECDPTEIEEFLEHFIFLNAISSKIS--KLEKEFLTMSQ------YSVAKHHQIHISEEQIAIFQVLLLKFSQLKSSMKLSKINKD------TAITKFRDNLEACISGLHVDVGNLKAKIRT................................................ 259
9 -5.440tr|D6RID1|D6RID1_HUMAN Uncharacterized protein OS=Homo sapiens GN=DTNBP1 PE=4 SV=1  ali   25..............................................................................................................................................................AALHRRAKDCASAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADL-----------ESMTANLTHLEASFEEVENNLLHLEDLCGQ........................... 106
10 -5.430sp|Q9NSG2|CA112_HUMAN Uncharacterized protein C1orf112 OS=Homo sapiens GN=C1orf112 PE=1 SV=1  ali   10  11LEQTFFSQVLPKTVKLFDDMMYELTSQARGLSSQNLEIQTTLRNILQTMVQLLGALTGCVQHICATQESIKSTFVHCKNSESVYSGCLHLVSDLLQALFKEAYSLQKQLMELLDMVDDILNMVIVIHSLLDICSVIS---SMDHAFHANTWKFIIKQSLKHQSIIKSQLKHKDIITSLCEDILFSFHSCLQLAEQMTQSDAQDNADYRLFQKTLKLCRFFANSLLHYAKEFLPFLSDSCCTL.................................... 274

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24