current user: public

If you have questions about the server, please let us know.

Query: TM0009 TM0009 281890 Purified-2001-02-14, from T.maritima

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MIGPRDLLNIALRIESTGYSYYKNLTEKTEGETKALFERLAEQERDHSRKFKEILEKYEQDLNPSDEVLGYLEALAEISIFPKLEETPPDDLREAVRRAIEVEKDSIVFYSEILSYVPEKEPVQTIIDEEKKHLRDLLRLEVLast
1 -57.1001vjx_A mol:protein length:157 putative ferritin-like diiron-carboxylate protein TM1526  ali model follow..  31  6IMKVSDILTVAIRLEEEGERFYRELSEHFNGEIKKTFLELADQERIHAEIFRKMSDQENWDEVDSYLAGYAFYEVFPDT--SEILRRKDLTLKEVLDIAISVEKDSIILYYELKDGLVNQKTVKKIIDQEKEHLRKLLEMKR 148
2 -48.2002fzf_A mol:protein length:175 hypothetical protein  ali model follow..  21  19.FSLEELLGMAIKAEIGAREFYKSLAEKIKIELKEKINWLAEEEKKHEALLRKLYSQMFPGKEVVFPKEHIGPELQPV----ARELEKVQDIIDLIRWAMKAEEIAAEFYLKLEEMVKEKRLMRYLADMERGHYYTLRAEYE 159
3 -46.8002oh3_A mol:protein length:167 COG1633: Uncharacterized conserved protein  ali model follow..  16  3GYTLAEFLAHAIALETEAAERYVELADMMEADTATVFRDMARFSTLHGDEIKQRSRALELPKLMSWQ----YRWKTPPEVGDENDIHYLMTPYHALRYARDNEIRGMEYYKEAAANSADKRLGADFAAEEAEHVVALDKWIE 147
4 -43.9003q4n_A mol:protein length:193 Uncharacterized protein MJ0754  ali model follow..  18  16..EEKEGLIEMREEEKLARDVYLTLYNKWK---LQIFKNIAESEQTHMDAVKYLLEKYNIPDPVKNDSIGVFSNPKFEELYKKLVEKGDKSEVDALKVGATIEDLDIADLEKWINKTDNKFVYENLMKGSRNHMRAFVRMLN 155
5 -43.7003q4o_A mol:protein length:196 Uncharacterized protein MJ0754  ali model follow..  18  21..EEKEGLIEMREEEKLARDVYLTLYNKWK---LQIFKNIAESEQTHMDAVKYLLEKYNIPDPVKNDSIGVFSNPKFEELYKKLVEKGDKSEVDALKVGATIEDLDIADLEKWINKTDNKFVYENLMKGSRNHMRAFVRMLN 160
6 -34.8004r42_A mol:protein length:236 Alr3090 protein  ali model follow..  15  20..RFAQLLLEQFGGELSAALQYWVQSFHVENAIKDMLQDIAIEEFSHLEMVGKLIEAHTKNVDQTEAYKSTLFAVRGMNAWTASYLNEGGDVVRDLRANIAAEAGARQTYEELIKLSPDKQTLVHLLTREISHTQMFMKALD 175
7 -32.2002e0z_A mol:protein length:345 Virus-like particle  ali model follow..  15  19..ELMEILRLAIIAELDAINLYEQMARYSEDEVRKILLDVAREEKAHVGEFMALLLNLDPEQVTGGFEEVKELTGIEAHINDNKKEESNVEYFEKLRSALLDGVNKGRSLLKHLPVTRISFRVDIIKFEDGVRVVKQEYK.. 163
8 -29.4003sid_A mol:protein length:180 Symerythrin  ali model follow..  18  25..NTDANAASSIEVEMECDCMYPTFAEIARPEIGAMFDAIAKEEGMHAQLLTKLYSELEVKDSAETLEAKRLVSTIESQ--IDAVASDSRGLRRALETALEVETIESQTYPAFAKLAAEATAFEAIVKSETKHANWVKRALE 174
9 -28.6002hz8_A mol:protein length:115 De novo designed diiron protein  ali model follow..  16  31.QELARLIQEIVKAEKQAVKVYKEAAEKARNPKRQVIDKILEDEEKHIEWLKAASKQGNAE................................................................................. 91
10 -27.1004di0_A mol:protein length:144 Rubrerythrin  ali model follow..  15  12..KTEENLKYAFAGESQANRRYLYFASKADVDIAALFRSTAEGETGHAHGHLEYLEAVGDPA---------------------TGLPFGTSRQNLQSAIAGETHEYTDMYPGMAKTARDANWFETLAKAERSHANRYTKALD 140
11 -26.8002clb_A mol:protein length:188 DPS-LIKE PROTEIN  ali model follow..  22  25..KLVDKLVKATAAEFTTYYYYTILRMHLTGGLKEIAEDARLEDRLHFELMTQRIYELGGGLPRDIRQLADISACSDA-----YLPENWKDPKEILKVLLEAEQCAIRTWKEVCDMTYGKDLAQRILQEEIEHEAWFLELLY 168
12 -26.3002qqy_A mol:protein length:149 Sigma B operon  ali model follow..  19  10..ELIEGLNEDLAGEYSAIIMYNHNAATVSGVLKPFFESEISDEQGHALYLAEKIKTLGGTPT-----------------TIPLRVKQAEDVREMLEYARQSEYETIKRYEKRKEQAANVVKLEDMIADETNHMEELDRLLN 142
13 -25.6005n5e_e mol:protein length:99 PFC_05175  ali model follow..  18  20..ELMEILRLAIIAELDAINLYEQMARYSEDEVRKILLDVAREEKAHVGEFMALLLNLDPEQ................................................................................ 80
14 -25.6001j30_A mol:protein length:144 144aa long hypothetical rubrerythrin  ali model follow..  17  8..KTAENLKQGFIGESMANRRYLYFAKRADEEIAGLLRSIAEGETAHAFGHLDFIRQGGLTDPATD--------------------KPIGTLEQMIESAIAGETEWTQMYPGFAKVAREAEWFETLARAEKSHAEKFQNVLK 138
15 -25.1005k53_A mol:protein length:262 aldehyde deformylating oxygenase  ali model follow..  14  46..AYSRINAIVIEGEQEAHDNYLTLAELL-ADKKAELVGLSKMENRHMKGFQACGRNLKVT----PDMAFAKQFFSELHKNFQTAAAQGQIVTCLLIQSLIIECFAIAAYNIYIPVADDRKITEGVVKEEYSHLN....... 175
16 -24.6005uxi_A mol:protein length:234 Aldehyde decarbonylase  ali model follow..  13  21..AYSRINAIVIEGEQEAHENYITLAQLL-PESHDELIRLSKMESRHKKGFEACGRNLAVTP----DLQFAKEFFSGLHQNFQTAAAEGKVVTCLLIQSLIIECFAIAAYNIYIPVADDRKITEGVVKEEYSHLN....... 150
17 -24.0005uwz_A mol:protein length:243 Aldehyde decarbonylase  ali model follow..  16  21..AYSRINAIVLEGEREAHANYLTLAEML-PDHAEALKKLAAMENRHFKGFQSCARNLEVTP----DDPFARAYFEQLDGNFQQAAAEGDLTTCMVIQALIIECFAIAAYNVYIPVADARKVTEGVVKDEYTHLN....... 150
18 -24.0004quw_A mol:protein length:231 Aldehyde decarbonylase  ali model follow..  12  20..AYSRINAIVIEGEQEAFDNYNRLAEML-PDQRDELHKLAKMEQRHMKGFMACGKNLSVT----PDMGFAQKFFERLHENFKAAAAEGKVVTCLLIQSLIIECFAIAAYNIYIPVADARKITEGVVRDEYLHRN....... 149
19 -23.9002ib0_A mol:protein length:170 CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN  ali model follow..  13  21..ADNAALCDALAVEHATIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARGVTAPIAAAGYQLPMQV--------------SSAADAARLAVRMENDGATAWRAVVEHAETRVFASTALTESAVMATRWNRV.. 147
20 -23.7004z5s_A mol:protein length:231 Aldehyde decarbonylase  ali model follow..  17  20..AYSRINAIVIEGEQEAYSNYLQMAELL-PEDKEELTRLAKMENRHKKGFQACGNNLQVN----PDMPYAQEFFAGLHGNFQHAFSEGKVVTCLLIQALIIEAFAIAAYNIYIPVADDRKITEGVVKDEYTHLN....... 149
21 -23.6005xx9_A mol:protein length:167 Bacterioferritin  ali model follow..  13  6..EVIEFLNEQLTAELTAINQYFLHAKLQDHKLAKYTRAESFDEMRHAEVLTDRILLLDGLPNYQR-----------------FHVRVGQSVTEMFQADREVELEAIDRLRRGIEVMRAANVFEAILADEEHHIDYLETQLD 139
22 -23.4001nf4_A mol:protein length:179 bacterioferritin  ali model follow..  19  11..KVIEVLNKARAMELHAIHQYMNQHYSLDDELAANMKLIAIDEMRHAENFAERIKELGGEPTTQKE----------------GKVVTGQAVPVIYESDADQEDATIEAYSQFLKVCKEARLFERIIEEEQAHLTYYENIGS 144
23 -23.3001mft_A mol:protein length:53 Four-helix bundle model  ali model follow..  22  2.....DYLRELYKLEQQAMKLYREASEKARNPKKSVLQKILEDEEKHIEWLETIN....................................................................................... 52
24 -23.2001jgc_A mol:protein length:161 bacterioferritin  ali model follow..  20  6..KVIEFLNAALRSELTAISQYWVHFRLQEDKMAKKSREESIEEMGHADKIIARILFLEGHPNLQKL----------------DPLRIGEGPRETLECDLAGEHDALKLYREARDYCAEKNIFESLITDEEGHVDFLETQIS 139
25 -23.1003gvy_A mol:protein length:161 Bacterioferritin  ali model follow..  19  6..KVIEYLNAALRSELTAVSQYWLHYRLQEDSIAHKSRKESIEEMHHADKLIQRIIFLGGHPNLQRL----------------NPLRIGQTLRETLDADLAAEHDARTLYIEARDHCEKKMLFEELIADEEGHIDYLETQID 139
26 -23.1004kvr_A mol:protein length:244 Aldehyde decarbonylase  ali model follow..  13  34..AYSRINAIYIEGEQEAHDNYIAIGTLL-PDHVEELKRLAKMEMRHKKGFTACGKNLGVEA----DMDFAREFFAPLRDNFQTALGQGKTPTCLLIQALLIEAFAISAYHTYIPVSDPRKITEGVVKDEYTHLN....... 163
27 -23.1004pgi_A mol:protein length:250 Aldehyde decarbonylase  ali model follow..  13  34..AYSRINAIVIEGEQEAHDNYIAIGTLL-PDHVEELKRLAKMEMRHKKGFTACGKNLGVK----ADMDFAREFFAPLRDNFQTALGQGKTPTCLLIQALLIEAFAISAYHTYIPVSDPRKITEGVVKDEYTHLN....... 163
28 -23.0003bkn_A mol:protein length:161 Bacterioferritin  ali model follow..  14  6..DVLKLLNEQLTSELTAINQYFLHSKMQDNELAEHTRAESFEEMRHAETITDRILLLDGLPNYQRL----------------FSLRVGQTLREQFEADLAIEYEVLERLKPGIVLCREARLLEQILADEETHIDYLETQLQ 139
29 -22.9003fvb_A mol:protein length:182 Bacterioferritin  ali model follow..  14  21..KVIERLNEALFLELGAVNQYWLHYRLLNDRLAKKEREESIEEMHHADKLIDRIIFLEGFPNLQTV----------------SPLRIGQNVKEVLEADLKGEYDARASYKESREICDKKQLFDELLADEEGHIDFLETQLD 154
30 -22.8001bcf_A mol:protein length:158 BACTERIOFERRITIN  ali model follow..  16  6..KVINYLNKLLGNELVAINQYFLHARMFKNRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQD-----------------GKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSRDMMIEILRDEEGHIDWLETELD 139
31 -22.8002wtl_A mol:protein length:173 BACTERIOFERRITIN  ali model follow..  16  10..DVLRLLNEQLTSELTAINQYFLHSKMQDNELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRI----------------GSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREAVLLEKIVADEEEHIDYLETQLE 143
32 -22.7001za0_A mol:protein length:275 POSSIBLE ACYL-[ACYL-CARRIER PROTEIN] DESATURASE DESA2 (ACYL-[ACP] DESATURASE) (STEAROYL-ACP DESATURASE)  ali model follow..  15  64..TITDACEILLILKDNLAGHHRELVEHFEDWWGRWLGRWTAEEHLHAIALREYLVVTREVDPVANEDVR-------VQHVMKGYRAEKYTQVETLVYMAFYERCGAVFCRNLAAQIEEAGLIDRIARDEVRHEEFFANLVT 201
33 -22.6004am2_A mol:protein length:159 BACTERIOFERRITIN  ali model follow..  18  6..KVIEYLNRGLRSELTAVSQYWLHYRMLEDDLAKKWRAESIEEMAHADKFVERILFLEGLPNLQT-----------------DPLRIGQTVKEVLESDLAAEREARALYQEGAAYAASKNLFEELMGDEEHHIDFLETQLD 139
34 -22.6003qb9_A mol:protein length:174 Bacterioferritin  ali model follow..  16  8..DVLRLLNEQLTSELTAINQYFLHSKMQDNELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQR-----------------GSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREAVLLEKIVADEEEHIDYLETQLE 141
35 -22.6004cvp_A mol:protein length:159 BACTERIOFERRITIN  ali model follow..  17  7..KVINYLNKLLGNELVAINQYFLHARMFKNRLNDVEYRESIDEMKHADRYIERILFLEGLPNLQDL----------------GKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSRDMMIEILRDEEGHIDWLETELD 140
36 -22.4005zur_A mol:protein length:158 Bacterioferritin  ali model follow..  14  6..TVIQFLNKQLTNELTAINQYFLHARMLNHKLGKHEYEESIGEMKHADRLIARIFMLDGLPNLQDL----------------HKLLIGEDVPELLACDLKLEQAAHATVREAIAHCESRDLFQDILDDTEEHIDYLETQID 139
37 -22.3005d8x_A mol:protein length:158 Ferroxidase  ali model follow..  14  6..KVIQHLNKILGNELIAINQYFLHSRMWNDRLGAHEYHESIDEMKHADKLIERILFLEGAPNLQDL----------------GKLLIGANTQEMLQCDLNLELKATKDLREAIVHCEQRDLLKDILESEEEHIDYLETQLG 139
38 -22.2001sof_A mol:protein length:156 Bacterioferritin  ali model follow..  14  6..IVIQHLNKILGNELIAINQYFLHARMYEDKLGKHEYHESIDEMKHADKLIKRILFLEGLPNLQEL----------------GKLLIGEHTKEMLECDLKLEQAGLPDLKAAIAYCESRELLEDILESEEDHIDWLETQLD 139
39 -22.2003e2c_A mol:protein length:158 Bacterioferritin  ali model follow..  16  6..KVINYLNKLLGNELVAINQYFLHARMFKNRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDL----------------GKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSRDMMIEILRDERGHIDWLRTELD 139
40 -22.1003is7_A mol:protein length:158 Bacterioferritin  ali model follow..  14  6..KVIQHLNKILGNELIAINQYFLHSRMWNDRLGAHEYHESIDEMKHADKLIERILFLEGLPNLQDL----------------GKLLIGENTQEMLQCDLNLELKATKDLREAIVHCEQRDLLKDILESEEEHIDYLETQLG 139
41 -22.0004tof_A mol:protein length:158 Bacterioferritin  ali model follow..  14  6..KVIQHLNKILGNELIAINQYFLHSRMWNDRLGAHEYHESIDEMKHADKLIERILFLEGLPNLQDL----------------GKLLIGENTQEMLQSDLNLELCATKDLREAIVHCEQRDLLKDILESEEEHIDYLETQLG 139
42 -21.8005k52_A mol:protein length:265 Aldehyde decarbonylase  ali model follow..  13  47...YSRINAIVIEGEDEAANNYVRLAELM-PEQSEELASLAKMEARHKKGFTACGKNLNVT-----DMDFAKKFFSDLHGNFQVAAAAGNIVTCLLIQALIIEAFAISAYNVYIPHADDRKITENVVKDEYLHLN....... 175
43 -21.6001yux_A mol:protein length:202 Nigerythrin  ali model follow..  12  28..STLENLKAAIAGETGAHAKYTAFAKAAREQIARLFEATAAAELIHIGLEYALVAEMEPGYEKPTVAAPSAYS----------------CDLNLISGANGEIYETSDMYPAFIRKAQEEHVFTRAKLAESVHAERYLAA.. 159
44 -21.4002vzb_A mol:protein length:170 PUTATIVE BACTERIOFERRITIN-RELATED PROTEIN  ali model follow..  23  17..SLIDQLNAALSEEWLAYYQYWVGALVVEGDVQGEFEEHAEEERHHAQLIADRIIELEGVPVLDPKKWFELARC-------KYDSPTAFDSVSLLNQNVSSERCAILRYQEIANFTNGKDIAKHILAEEEEHEQDLQDYLT 158
45 -21.1003k6c_A mol:protein length:95 Uncharacterized protein NE0167  ali model follow..  16  18..RDMHRAIISLREELEAVDLYNQRVNACKDKLKAILAHNRDEEKEHAAMLLEWIRRCDPA................................................................................. 77
46 -20.9005ux2_A mol:protein length:234 Aldehyde decarbonylase  ali model follow..  13  14..AYSRINGVVIVGEGLANRHFQMLARRI-PADRDELQRLGRMEGDHASAFVGCGRNLGVV----ADLPLARRLFQPLHDLFKRHDHDGNRAECLVIQGLIVECFAVAAYRHYLPVADARPITAAVMNDESEHLD....... 143
47 -20.5001jku_A mol:protein length:266 pseudocatalase  ali model follow..  16  35..............ETTGMMSYQGWASTGAEKYKDLLLDTGTEEMAHVEMISTMIGYLLEDAPFGPEDLKRDPSLATGAAWNAGYVTSSGNLVADMRFNVVRESEARLQVSRLYSMTEDRDMLKFLLARETQHQLQFMKAQE 190
48 -19.3003r2h_A mol:protein length:154 Bacterioferritin  ali model follow..  13  6..EVIDYLNTLLTGELAARDQYFIHSRMYEDKLYERLNHEMEEETQHADALLRRILLLEGTPR-----------------MRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKLKAQLADTEEDHAYWLEQQLG 139
49 -19.0002cwl_A mol:protein length:302 manganese-free pseudocatalase  ali model follow..  10  36..............EMSTLMNYMYQSKKALKPYYDLIANIATEELGHIELVAATINSLLAKNPGKDLEEGVDPESAPLGFAKDEYVFTSGNLILDLLHNFFLEVAARTHKLRVYEMTDNREMIGYLLVRGGVHAAAYGKALE 197
50 -18.6001b71_A mol:protein length:191 PROTEIN (RUBRERYTHRIN)  ali model follow..  15  8..RTEKNILTAFAGESQARNRYNYFGGQAKKQISDIFAETADQEREHAKRLFKFLEGGDLEIVAA------------------PAGIIADTHANLIASAAGEHHEYTEMYPSFARIAREERVFASIAVAEEFHEKRFLDFAR 140
51 -18.6005da5_A mol:protein length:116 Rru_A0973  ali model follow..  12  23.....HRAIVSVMEELEAVDWYDQRVDASTDPLTAILAHNRDEEKEHAAMTLEWLRRNDAK................................................................................. 79
52 -17.5005n5f_A mol:protein length:98 encapsulated ferritin  ali model follow..  10  22.....HRALVTLIEELEAVDWYQQRADACSEPLHDVLIHNKNEEVEHAMMTLEWIRRRSPV................................................................................. 78
53 -17.5001oq4_A mol:protein length:363 Acyl-[acyl-carrier protein] desaturase  ali model follow..  11  93..DYFVVLVGDMITEEALPTYQTMLNTASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDM------RQIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQERATFISHGNTARQAKEAQICGTIAADEKRHETAYTKIVE 241
54 -17.2004etr_A mol:protein length:153 Putative uncharacterized protein  ali model follow..  12  11..DTLDVLNDLLQTSKDGEAGFHACAEDLRDQLKAAMLEQSRDCAAAADELERIVLELGGKPKDSTSFAGDLHRRWVD-----KSLVTGKDEEAVLNECERGEDVAKHRYQAALEKSLPHQVIERQYQGVLRHHDRVRALR. 149
55 -17.1005l8f_A mol:protein length:116 Rru_A0973  ali model follow..  23.....HRAIVSVMEALEAVDWYDQRVDASTDPLTAILAHNRDEAKEAAAMTLEWLRRNDAK................................................................................. 79
56 -16.8003oj5_A mol:protein length:189 Ferritin family protein  ali model follow..  14  10..KFHALMQEQIHNEFTAAQQYVAIAVYFDSELAKHFYSQAVEERNHAMMLVQHLLDRDLRVEIPG---------------VDTVRNQFDRPREALALALDQERTVTDQVGRLTAVARDEQFMQWFLQEQIEEVALMATLVR 144
57 -16.6002uw1_A mol:protein length:338 PLASTID DELTA4 MULTIFUNCTIONAL ACYL-ACYL CARRIER PROTEIN DESATURASE  ali model follow..  10  68..DYFVVLVGDMITEEALPTYMSMLNRAEPSAWAMWTRAWTAEENRHGDLLNKYLYLSGRVDM------RKIEKTIQYLIGSGMDIKSENSPYLGFIYTSFQERATFISHANTAKLAQHAHICGSIASDEKRHATAYTKIVE 216
58 -16.6004zlw_A mol:protein length:168 Ferritin  ali model follow..  10  4..ELLDLFNRQVTQEFTASQVYLSASIWFDQNMAAYMLAESAEEREHGLGFVDFANKRNIP-------------IELQAVPAPVSCAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHFLNPFHLQQVNAEDKIGSILA 140
59 -16.5003qz3_A mol:protein length:184 Ferritin  ali model follow..  10  14..AMVEHLNEQINLEFFSSNLYLQMSAWCEDKAAEFLRAHAVEEMQHMQRLFTYVSETGALPILGA---------------IAAPRHDFASLGEVFRETYQHEQKITQQINKLAHVAFTSQFLQWYVAEQHEEEKLFKGILD 148
60 -16.3004zkh_A mol:protein length:169 Ferritin  ali model follow..  10  4..ELLDLFNRQVTQEFTASQVYLSASIWFDQNMAAYMLAQSAEEREHGLGFVDFANKRNIP-------------IELQAVPAPVSCAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHFLNPFHLQQVNEEDKIGSILA 140
61 -15.7001krq_A mol:protein length:167 ferritin  ali model follow..  14  5..EVVKLLNEQINKEMYAANLYLSMSSWCYENAGAFLFAHASEESDHAKKLITYLNETDSHVELQE---------------VKQPEQNFKSLLDVFEKTYEHEQFITKSINTLVEHMLTHKFLQWYVSEQHEEEALFRGIVD 139
62 -15.6004xgs_A mol:protein length:165 Ferritin  ali model follow..  11  5..EMIEKLNEQMNLELYSSLLYQQMSAWCSYHAAAFLRRHAQEEMTHMQRLFDYLTDTGNLPRINT---------------VESPFAEYSSLDELFQETYKLEQLITQKINELAHAAMTNQFLQWYVSEQHEEEKLFKSIID 139
63 -15.6004mud_A mol:protein length:235 Ring oxydation complex/ phenylacetic acid degradation related protein  ali model follow..  10  18..TLVNIIELRADFELAMVEQYSPWLVNAPTDSRLFVAKLVSDELNHGWQLVRLLEEFKVKDV-----IERISNARLGIHKLEVSNLPLFNWEDVIAFTFLVDGAGLYQLKILKDCSFESTLASSMIKEEESHIF....... 148
64 -15.5002jd6_0 mol:protein length:174 FERRITIN HOMOLOG  ali model follow..  14  5..RMLKALNDQLNRELYSAYLYFAMAAYFEDLFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDE---------------IPKPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKFLEWFINEQVEEEASVKKILD 139
65 -15.5003bve_A mol:protein length:181 Ferritin  ali model follow..  13  13..DIIKLLNEQVNKEMNSSNLYMSMSSWCYTHAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTS---------------ISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKFLQWYVAEQHEEEVLFKDILD 147
66 -15.5005u1b_A mol:protein length:189 MtrE protein,Ferritin chimera  ali model follow..  13  27..DIIKLLNEQVNKEMNSSNLYMSMSSWCYTHAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTS---------------ISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKFLQWYVSEQHEEEVLFKDILD 161
67 -15.5004ztt_A mol:protein length:166 Bacterial non-heme ferritin  ali model follow..  11  6..EMIEKLNEQMNLELYASLLYQQMSAWCSYHAAAFLRRHAQEEMTHMQRLFDYLTDTGNLPRINT---------------VESPFAEYSSLDELFQETYKHEQLITQKINELAHAAMTNQFLQWYVSEQHEEEKLFKSIID 140
68 -15.3001eum_A mol:protein length:165 FERRITIN 1  ali model follow..  11  5..EMIEKLNEQMNLELYSSLLYQQMSAWCSYHAAAFLRRHAQEEMTHMQRLFDYLTDTGNLPRINT---------------VESPFAEYSSLDELFQETYKHEQLITQKINELAHAAMTNQFLQWYVSEQHEEEKLFKSIID 139
69 -15.3003kx9_A mol:protein length:173 Ferritin  ali model follow..  11  7..KMVEALNRQINAEIYSAYLYLSMASYFDSIFSNWMRVQWQEELMHAMKMFDFVSERGGRVKLYA---------------VEEPPSEWDSPLAAFEHVYEHEVNVTKRIHELVEMAMQEKFLQWYVAEQVEEEASALDIVE 141
70 -15.1001z6o_M mol:protein length:191 Ferritin heavy chain  ali model follow..  17  20..SCRNSMRQQIQMEVGASLQYLAMGAHFSKDFAQLFFDAASEEREHAMKLIEYLLMRGELTNDVSSLLQVRPPTRSS-----------KGGVEALEHALSMESDVTKSIRNVIKACEDDSLTGDFLEEQYKGQRDLAGKAS 165
71 -15.0001s3q_A mol:protein length:173 ferritin  ali model follow..  11  7..KMVEALNRQINAEIYSAYLYLSMASYFDSIFSNWMRVQWQEELMHAMKMFDFVSERGGRVKLYA---------------VEEPPSEWDSPLAAFEHVYEHEVNVTKRIHELVEMAMQEKFLQWYVAEQVEEEASALDIVE 141
72 -15.0003kxu_A mol:protein length:191 Ferritin  ali model follow..  13  12..DVEAAVNSLVNLYLQASYTYLSLGFYFDRDVSHFFRELAEEKREGYERLLKMQNQRGGRALFQD--------------IKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTLETHFLDEEVKLIKKMGDHLT 150
73 -14.9005ls9_A mol:protein length:173 Ferritin, putative  ali model follow..  11  7..KMVEALNRQINAEIYSAYLYLSMASYFDSIFSNWMRVQWQEELCHAMKMFDFVSERGGRIFLQD---------------IKKPDSEWESPLAAFEHVYEHEVNVTKRIHELVEMAMQEKFLQWYVAEQVEEEASALDIVE 141
74 -14.8005oba_A mol:protein length:197 Ferritin heavy chain  ali model follow..  13  16..DAEAAINRQINLELYASYVYLSMSCYFDRDFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQD--------------IKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNIETYYLSEQVKSIKELGDHVT 154
75 -14.7005jkk_A mol:protein length:183 Ferritin heavy chain  ali model follow..  15  16..DSEEAINRQINLELYASYVYLSMSYYFDRDFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQD--------------IQKPDEDDWESGLNAMEEALELEKNVNQSLLELHKLATDKNIETHYLNEQVKAIKELGDHVT 154

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.