current user: public

If you have questions about the server, please let us know.

Query: TM0013 TM0013 281894 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSLLast
1 -72.6004fek_A mol:protein length:262 Putative diflavin flavoprotein A 5  ali model follow..  14  14IATNTKVLRARSWSRLRFEIEYALERGTTSNSYVI-EGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRAAFPDDNLNIL-PMRGKETLDLGKGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDDNWE-SFKEDQRYYFNCLMAPHAIHVEAALEKISDLQVRLYAVGHGPLVRTS-LIALTQAYADW............. 249
2 -61.7002q9u_A mol:protein length:414 A-type flavoprotein  ali model follow..  17  13MIPGVYWVGIVDWMVRIFH-GYHTDEGSSYNSYFI-DDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKAT--WLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGTVVLDSMYG. 268
3 -59.6004d02_A mol:protein length:479 ANAEROBIC NITRIC OXIDE REDUCTASE FLAVORUBREDOXIN  ali model follow..  15  5VKNNIHWVGQRDWEVRDFHTEYKTLRGSSYNSYLI-REEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGPE------WNFNVVKTGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFQCQRYYANILTPFSRLVTPKITEILNLPVDMIATSHGVVWRDNPTQIVELYLKWAADYTIFYDTMSN. 259
4 -58.8001e5d_A mol:protein length:402 RUBREDOXIN:OXYGEN OXIDOREDUCTASE  ali model follow..  17  6IIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLV-EDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWP--VQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLEAMREYYANIVNPYAPQTLKAIETLVGVAPEFICPDHGVIFRGADQCTFAVQKKPTNKVVIFYDSMWH. 264
5 -58.2001vme_A mol:protein length:410 Flavoprotein  ali model follow..  15  17DDPEIYVLRIDDDRIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIGHDVEIIASNFGKRLLEGFYGIKD---VTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDDSNESVRYLPHVTKYIVTVIGHYKNYILEGAEKLSSLKIKALLPGHGLIWKKDPQRLLNHYVSKKGKVTVIYDSMYG. 271
6 -57.9001ycf_A mol:protein length:398 Nitric oxide reductase  ali model follow..  15  6ITDGIYWVGAVDWNIRYFGPAFSTHRGTTYNAYLI-VDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFN--YTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMEAAKYYANILMPFSNLITKKLDEIQKIAIKTIAPSHGIIWRKD-PGRIIEAYARWAKAVIAYDTMWL. 263
7 -56.1006frn_A mol:protein length:410 F420H2 oxidase (FprA)  ali model follow..  15  8IADGVYWVGVLDWDIRMYHGYT--LNGTTYNAYLVFGDDKVALIDNTYPGTSAQMWGRIKDACREFKIDVIVQNHVEKDHSGALPEIHKKFPEAPIYCTEVAVEGLVKHF-PSLKGAPFKVVKSLESIDLGGKTLTFLEAPLLHWPDSMFTLYAEEGILFSNDAFGQHLCFTQRFDHEIPENILMANQKFYANLITPLSKLVLKKFKEGLLEKIKMIAPSHGQIWTDPMIGAYQDFATGKCKVTIVYDTMHG. 269
8 -54.2006ETB Entity 1(prereleased)  ali follow..  15  5VKNNIHWVGQRDWEVRDFHTEYKTLRGSSYNSYLI-REEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGPE------WNFNVVKTGDTLDIGGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFQCQRYYANILTPFSRLVTPKITEILGLPVDMIATSHGVVWRDNPTQIVELYLKQEDRITIFYDTMYN. 259
9 -53.1002ohh_A mol:protein length:404 Type A flavoprotein fprA  ali model follow..  14  8ISDGVYWTGVLDWDLRNYHGYT--LQGTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDAVGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHY-PSLREAEFMTVKTGDVLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMAARKFYANLITPLSKLVLKKFDEVKELGLLERIQMIAPSHGQTDPMKIIEAYTGWERVTVIYDTMHG. 268
10 -44.5003adr_A mol:protein length:261 Putative uncharacterized protein ST1585  ali model follow..  13  20.............................ATVYVMCGEKLTVMIDAGVS-------NSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQVY-KAKVLVKSGFKKYLTSEDGLKLDQDKVIEVEGNEEFDLGGYRMRLIYTP-GHARHHMSVLV--DDFLFTGDSAGAYFNGVVIPTTPPVIDY----------------KMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQ......... 230
11 -43.6002q0j_A mol:protein length:321 Quinolone signal response protein  ali model follow..  16  5...SSGLVPRGSHMLRLLDDDLCLLGDVQVPVFLLRLGEASALVEGGISRDAELVWADLCRWADPSQVHYWLITHKHYDHCGLLPYLCPRLPNVQVLASERTCQAWKSESACAWDALPVRAVADGEWLELGPRRLQVIEAH-GHSDDHVVFYDVRRRRLFCGDALGEFDEAEGVWRPLVFDDM----------------EAYLESLERLQRLPTLQLIPGHGGLLRGRLAADGAESAYT.............. 253
12 -39.9005iqk_A mol:protein length:271 beta-lactamase Rm3  ali model follow..  11  19LFGNTYYVGM-----------------KGLSSVLVTSPQGHVLIDGGLPESAPKIIANIGALFRIEDVKLILNSHGHIDHAGGLAELQRRS-NALVAASPSAALDLASGEVGPDDPQDMRLARDGGQFNVGPVYLTAHATP-GHTPGGLSWTWQSCDGPRCLNMV---------YADSINAVSRPGFKFSASSEYPNALADLRHSFETLEKLPCDVLISAHPAFVDPQACRAYVAAART.............. 259
13 -39.4005evb_A mol:protein length:271 Metallo-beta-lactamase L1  ali model follow..  11  28IADHTWQIGT-----------------EDLTALLVQTPDGAVLLDGGMPQMASHLLDNMKARVTPRDLRLILLSHAHADHAGPVAELKRRT-GAKVAANAESAVLLARGGSDDPPANADRIVMDGEVITVGGIVFTAHFMA-GHTPGSTAWTWTDTRNGKPVRIAYADSLSAP------------GYQLQGNPRYPHLIEDYRRSFATVRALPCDVLLTPHPGASNWDYAAGARAGAKA.............. 245
14 -39.1001jt1_A mol:protein length:263 FEZ-1, class B3 metallo-beta-lactamase  ali model follow..  12  13IAGNLYYVGTD-----------------DLASYLIVTPRGNILINSDLEANVPMIKASIKKLFKFSDTKILLISHAHFDHAAGSELIKQQT-KAKYMVMDEDVSVILSGGKSDTQSTVDKVLHDGERVELGGTVLTAHLTP-GHTRGCTTWTMKLKDHGKQYQAV------------IGSIGVNPGYKLVDNITYPKIAEDYKHSIKVLESMRCDIFLGSHAPFVDPTGCKNYIEQKAN.............. 251
15 -38.2005aeb_A mol:protein length:272 LRA-12  ali model follow..  11  26IAGNLYYIGT-----------------YDLACYLITTKQGNIIVNTGLAASALQIKNNIKALFKLTDTKILLTTQAHYDHLGAMAEIKKIT-GAKLMADEGDATVMADHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHP-GHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIA-----------KDYAYTLQAMKNLSFDIWVASHASFMDRKGYDESLDKLQK.............. 263
16 -38.2003vpe_A mol:protein length:262 Metallo-beta-lactamase  ali model follow..  13  14IYGNTHYVGTG-----------------GISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMFKLSDVKYILSTHSHEDHAGGISAMQKLT-GATVLAGAANVDTLRTGVSPKSDPAKVRAVADGELVKLGPLAVKAHATP-GHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSD------------HPEVVASLRGSFEAVEKLSCDIAIAAHPAYVDNGACRAIAAAGRK.............. 251
17 -38.1006e0s_A mol:protein length:286 MEM-A1  ali model follow..  14  33VFGSTYYVGV-----------------RGLSAVLIASPQGHILIDGGSPESAPQIAQHIRQLFKLEDVKLILNSHEHFDHAGGISELQRL-SGATVLASVQGEKVLRSGQPSKGDPQNTRAVADGEVVKLGPLAVTARYTP-GHTQGGVSWTWRKSAAMVYADSLNAFAAKPFRYSG--------------SPAYPNALADIKKSIATVAALDCDILISAHPAFIDRQACRQYAERAGV.............. 273
18 -38.1005k0w_A mol:protein length:290 Class B carbapenemase GOB-18  ali model follow..  13  40IAGNLYYVGT-----------------YDLASYLIVTDKGNILINTGTAESFPIIKANIQKLFNYKDIKILLLTQAHYDHTGALQDFKTET-AAKFYVDKADVDVLRTYGVTFKPVTPDKTLKDQDKIKLGNITLTLLHHP-GHTKGSCSFIFETKDEKRKYRVL------------ANMPSVIVDKKFSEVTAYPNIQSDYAYTFGVMKKLDFDIWVASHALFMDKQSYFQNLNDLEK.............. 277
19 -38.0004p62_A mol:protein length:295 Metallo-beta-lactamase AIM-1  ali model follow..  11  46VYGNTWYVGT-----------------CGISALLVTSDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVLSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRTDPQNIVTLADDGVVSVGPLALTAVASP-GHTPGGTSWTWRDCRQMVYADSLTAISDDVYRYSDDAAHPG--------------YLAAFRNTLARVAALDCDILVTPHPPLMDTTACRRYAQGARQ.............. 283
20 -38.0004ad9_A mol:protein length:289 BETA-LACTAMASE-LIKE PROTEIN 2  ali model follow..  20  31............................GTNTYLVGTGPRRILIDTGEPAI-PEYISCLKQALTEFAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTP-GHTDDHMALLLEEENAIFSGDCILGEGTT-----------------------VFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAKIQQYISHRNIREQQILTLFR.... 230
21 -37.9006auf_B mol:protein length:300 Beta-lactamase-like protein  ali model follow..  13  43IYGNTWYVGT-----------------CGIASILVTSDDGHVLIDSGPADAAPLVLANIRKLFDPADVRWILTSHEHHDHAGSIAELQKAT-GAQIAAVASARQVLESGKPSADDPHVARVLVDGDSVTLGRLALTVRETP-AHSPGSASWTWQACDEAFTCRMIAYADSATTISADDYRFSDHPDRI-----------ARIRTGLSRIAQLPCDILVTPHPPLVNAQACAAYSQAAGS.............. 276
22 -37.4003lvz_A mol:protein length:294 Blr6230 protein  ali model follow..  13  43LIDNIYYVGT-----------------DGIAVYVIKTSQGLILMDTAMPQSTGMIKDNIAKLFKVADIKLILNTHAHLDHTGGFAEIKKET-GAQLVAGERDKPLLEGEDLAFPAVKVDRAVKEGDRVTLGDTTLTAHATP-GHSPGCTSWEMTVKDGKEDREVLFFCSGTVALNRLVGQPT------------YAGIVDDYRATFAKAKAMKIDVLLGPHPPFIKPGELVTYATSLSE.............. 278
23 -37.2005n5g_A mol:protein length:253 Beta-lactamase VIM-1  ali model follow..  15  29IADGVWSH---------IATQSFDGAVYPSNGLIVRDGDELLLIDTAGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEAEGNEIPTHSLEGLSSSG--DAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVHELSSTSAGNVADADLAEWPT------------------SVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRS......... 243
24 -36.8005n55_A mol:protein length:266 Class B metallo-beta-lactamase  ali model follow..  16  49IADGVWSH---------IATQSFDGAVYPSNGLIVRDGDELLLIDTAGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRKA--GVATYASPSTRRLAEAEGNEIPTHSLEGLSSSG--DAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLALSRTSAGNVADADLAEWPT------------------SVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVTAHKNRS......... 263
25 -36.8004awy_B mol:protein length:303 METALLO-BETA-LACTAMASE AIM-1  ali model follow..  11  46VYGNTWYVGTC-----------------GISALLVTSDAGHILVDAATPQAGPQILANIRALFRPEDVRAIVFSHEHFDHAGSLAELQKAT-GAPVYARAPAIDTLKRGLPDRTDPQNIVTLADDGVVSVGPLALTAVASP-GHTPGGTSWTWRSCEQMVYADSLTAISDDVFRYSDDAAHPG--------------YLAAFRNTLARVAALDCDILVTPHPPLMDTTACRRYAQGARQ.............. 283
26 -36.8006cqs_A mol:protein length:246 Beta-lactamase  ali model follow..  14  36..............................SLVVLIGEKYAVFVDTPTPEATENVLDWINKQYG-NRQFIEINTGYHVDNLGGNDALLHR--NIPIIGSDKTVSLLRERGEATRQLTQIFQLTEGYHFTVGDEPIEVFFPGETHAPDNIVVYFPERKILFGGCMLRVGNGTGNRADA--------------------NMDTWKSSVERLRDFDCVAVIPGHGIRFDPGVIENTISVLP............... 246
27 -36.6005o7n_A mol:protein length:254 Beta-lactamase VIM-2  ali model follow..  15  31IADGVWSH---------IATQSFDGAVYPSNGLIVRDGDELLLIDTAGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGA--AHSTDNLVVYVPSASVLYGGCAI------------------YELSRTSAGNVADADLAEWPTSIERIQQHEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRS......... 245
28 -36.5004gyq_A mol:protein length:243 Beta-lactamase NDM-1  ali model follow..  11  27LAPNVWQHTSY--------LDMPGFGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLI------------------KDSKAKSLGNLGAADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR............ 243
29 -36.5006mgy_A mol:protein length:243 Metallo-beta-lactamase NDM-5  ali model follow..  13  27LAPNVWQHTS---------LDMPGFGAVASNGLIVRDGGRVLLVDTATDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGLVAAQHSLTANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAA------------------SARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR............ 243
30 -36.4002uyx_A mol:protein length:228 BETA-LACTAMASE II  ali model follow..  14  22LNKNVWVH---------TELGSFNGEAVPSNGLVLNTSKGLVLVDSSDDKLTKELIEMVEKKFQ-KRVTDVIITHAHASRIGGIKTLKER--GIKAHSTALTAELAKKNGYEEPL----GDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLV------------------KSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK............... 228
31 -36.2005jqj_A mol:protein length:245 Metallo-beta-lactamase type 2  ali model follow..  12  29LAPNVWQHTS---------LDMPGFGAVASNGLIVRDGGRVLMVDTATDAQTAQILKWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPREGVVAAQHSLTFAAT-EPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLI------------------RDSKAKSLGNLDEADTEHYAASVRAFGAAKASMIVMSHFAPDSRAAITHTARMADKLR............ 245
32 -36.2002yz3_A mol:protein length:266 Metallo-beta-lactamase  ali model follow..  15  49IADGVWSH---------IATQSFDGAVYPSNGLIVRDGDELLLIDTAGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGA--AHSTDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPT------------------SIERIQQHEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNRS......... 263
33 -36.2004uwo_B mol:protein length:266 METALLO-BETA-LACTAMASE VIM-26  ali model follow..  15  49IADGVWSH---------IATQSFDGAVYPSNGLIVRDGDELLLIDTAGAKNTAALLAEIEKQIG-LPVTRAVSTHFHDDRVGGVDVLRAA--GVATYASPSTRRLAEAEGNEIPTHSLEGLSSSG--DAVRFGPVELFYPGAAHSTDNLVVYVPSANVLYGGCAVLELSSTSAGNVADADLAEWPT------------------SVERIQKHEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRS......... 263
34 -36.2001znb_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  15  16LSDKVYTYVS---------AEIEGWGMVPSNGMIVINNHQAALLDTPNDAQTETLVNWVADSLH-AKVTTFIPNHWHGDCIGGLGYLQKK--GVQSYANQMTIDLAKEKGLPVPE----HGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCML------------------KDNQATSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGDYGGTELIEHTKQIVNQYIEST......... 229
35 -36.1003rkk_A mol:protein length:237 Beta-lactamase NDM-1  ali model follow..  11  21LAPNVWQHTSY--------LDMPGFGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAAN-EPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLI------------------KDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR............ 237
36 -36.1004tyf_A mol:protein length:231 NDM-4  ali model follow..  11  15LAPNVWQHTSY--------LDMPGFGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGLVAAQHSLTANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLI------------------KDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR............ 231
37 -36.0001a7t_A mol:protein length:232 METALLO-BETA-LACTAMASE  ali model follow..  16  35...........................VPSNGMIVINNHQAALLDTPNDAQTEMLVNWVTDSLH-AKVTTFIPNHWHGDCIGGLGYLQRK--GVQSYANQMTIDLAKEKGLPVPE----HGFTDSLTVSLDGMPLQCYYLGGGHATDNIVVWLPTENILFGGCML------------------KDNQTTSIGNISDADVTAWPKTLDKVKAKSARYVVPGHGNYGGTELIEHTKQIVNQYIEST......... 229
38 -36.0005ZIO Entity 1(prereleased)  ali follow..  11  26LAPNVWQHTSY--------LDMPGFGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAAN-EPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLI------------------KDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR............ 242
39 -36.0003l6n_A mol:protein length:219 metallo-beta-lactamase  ali model follow..  15  2VKDFVIEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPEKVQYQSLMDTIKKRHN-LPVVAVFATHSHDDRAGDLSFFNNK--GIKTYATAKTNEFLKKDGKATST----EIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLV------------------KSNSATDLGYIKEANVEQWPKTINKLKAKKATLIIPGHDEWKGGGHVEHTLELLNK.............. 218
40 -35.9005a5z_A mol:protein length:251 BETA-LACTAMASE NDM-1  ali model follow..  11  27LAPNVWQHTS---------LDMPGFGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAAN-EPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLI------------------KDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRL........... 244
41 -35.8003fcz_A mol:protein length:222 Beta-lactamase 2  ali model follow..  13  8.TGTISISQLNKNVWVHTELGSFNGEAVPSSGLVLNTSKGLVLVDSSDDKLTKELIEMVEKKFQ-KRVTDAIITHAHADRIGGIKTLKER--GIKAHSTALTAELAKKNGYEEPL----GDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGCLV------------------KSTSAKDLGNVADAYVNEWSTSIENVSKRNINAVVPSHGEVGDKGLLLHTLDLLK............... 222
42 -35.7002nze_A mol:protein length:222 Beta-lactamase II  ali model follow..  14  16LNKNVWVH---------TELGSFNGEAVPSNGLVLNTSKGLVLVDSSDDKLTKELIEMVEKKFQ-KRVTDVIITHAHADHIGGIKTLKER--GIKAHSTALTAELAKKNGYEEPL----GDLQTVTNLKFGNMKVETFYPGKGHTEDNIVVWLPQYNILVGGSLV------------------KSTSAKDLGNVADAYVNEWSTSIENVLKRNINAVVPGHGEVGDKGLLLHTLDLLK............... 222
43 -35.7004rl2_A mol:protein length:246 Beta-lactamase NDM-1  ali model follow..  11  30LAPNVWQHTSY--------LDMPGFGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAAN-EPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLI------------------KDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR............ 246
44 -35.7002y87_A mol:protein length:265 METALLO-B-LACTAMASE  ali model follow..  15  48IGDGVWSH---------IATQKLGDTVYSSNGLIVRDADELLLIDTAGAKNTVALLAEIEKQIG-LPVTRSISTHFHDDRVGGVDVLRAA--GVATYTSPLTRQLAEAAGNEVPAHSLKALSSSG--DVVRFGPVEVFYPGAAHSGDNLVVYVPAVRVLFGGCAV------------------HEASRESAGNVADANLAEWPATIKRIQQREAEVVIPGHGLPGGLELLQHTTNVVKTHKVRP......... 262
45 -35.6005mmd_E mol:protein length:229 Metallo-beta-lactamase 1  ali model follow..  16  13IDNGVFLHKS---------SRVEGWGLVSSNGLVVISGGKAFIIDTPWSESDTEKLVDWIRSKK-YELAGSISTHSHEDKTAGIKWLNGK--SITTYASALTNEILKREGKEQARSSF-----KGNEFSLMDGFLEVYYPGGGHTIDNLVVWIPSSKILYGGCFIRSLESSGLGYTGEAKIDQWPQ------------------SARNTISKEAKIVVPGHGKIGDFELLKHTKVLAEKASNKA......... 224
46 -35.3002ynt_B mol:protein length:233 GIM-1 PROTEIN  ali model follow..  18  12IEDGVYLHTSF--------KNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLAREGKPVP-----THYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEWEALGYVGDASISSWAD------------------SIKNIVSKPIQMVVPGHGKVGSSDILDHTIDLAESASNKL......... 223
47 -35.2005ev6_A mol:protein length:230 Beta-lactamase IMP-1  ali model follow..  20  14LDEGVYVHTS---------EEVNGWGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVER---YKIKGSISSHFHSDSTGGIEWLNSR--SIPTYASELTNELLKKDGKVQATNSF-----SGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFI---------------------KPYGLGNLGDANIEAWPKSAKLLKSKKAKLVVPSHSEVGDASLLKLTLEQAVKGLNES......... 222
48 -35.1001m2x_A mol:protein length:223 class B carbapenemase BlaB-1  ali model follow..  13  1...DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPGEDKFKSFTDEIYKKHG-KKVIMNIATHSHDDRAGGLEYFGKI--GAKTYSTKMTDSILAKENKPRAQ----YTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQ------------------SVHNIQQKGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQ......... 219
49 -35.1004f6h_A mol:protein length:236 Beta-lactamase  ali model follow..  19  12LDEGVYVHTSF--------EEVNGWGVVPKHGLVVLVNAEAYLIDTPTAKDTEKLVTWFVER---YKIKGSISSHFHSDSTGGIEWLNSR--SIPTYASELTNELLKKDGKVQATNSF-----SGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFI---------------------KPYGLGNLGDANIEAWPKSAKLLKSKKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSNW 229
50 -35.1004exs_B mol:protein length:272 Beta-lactamase NDM-1  ali model follow..  11  54LAPNVWQHTSY--------LDMPGFGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAANVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLI------------------KDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLR............ 270
51 -35.0004wd6_A mol:protein length:233 Metallo-beta-lactamase  ali model follow..  15  12VKENIFLHTS--------YSRVNGFGLVSSNGLVVIDKGNAFIVDTPWSDRDTETLVHWIRKNG-YELLGSVSTHWHEDRTAGIKWLNDQ--SISTYATTSTNHLLKENKKEPA-----KYTLKGNESTLVDGLIEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSLDSEGLGYTGEAHIDQWSR------------------SAQNALSREAQIVIPGHGKIGDIALLKHTKSLAETASNKS......... 223
52 -34.9003spu_A mol:protein length:265 Beta-lactamase NDM-1  ali model follow..  12  28LAPNVWQHTS---------LDMPGFGAVASNGLIVRDGGRVLVVDTATDDQTAQILNWIKQEIN-LPVALAVVTHAHQDKMGGMDALHAA--GIATYANALSNQLAPQEGMVAAQHSLTFAAN-EPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLI------------------KDSKAKSLGNLGDADTEHYAASARAFGAAKASMIVMSHSAPDSRAAITHTARMADKLRKLVPRGSAAAAL 256
53 -34.8004ubq_A mol:protein length:229 Beta-lactamase  ali model follow..  20  32...........................VSKHGLVVLVNTDAYLIDTPTATDTEKLVNWFVER---YKIKGTISSHFHSDSTGGIEWLNSQ--SIPTYASELTNELLKKDGKVQAKNSF-----SGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFV---------------------KPDGLGNLGDANLEAWPKSAKILMSKKAKLVVSSHSEIGDASLLKRTWEQAVKGLNES......... 221
54 -34.7004bp0_A mol:protein length:250 METALLO-B-LACTAMASE  ali model follow..  14  19IDSDVFVVTDR--------------DFYSSNVVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKM--GAETWSSDLTKQLRLEENKKDRIKAAVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMI---------------------KPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL....... 250
55 -34.5005acp_A mol:protein length:250 GIM-1 PROTEIN  ali model follow..  19  29IEDGVYLHTS--------FKNIEGYGLVDSNGLVVLDNNQAYIIDTPWSEEDTKLLLSWATDRG-YQVMASISTHSHEDRTAGIKLLNSK--SIPTYTSELTKKLLAREGKPVP-----THYFKDDEFTLGNGLIELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSHEREGLGYVGDASISSWAD------------------SIKNIVSKPIQMVVPGHGKVGSSDILDHTIDLAESASNKL......... 240
56 -34.1005b3r_A mol:protein length:228 IMP-18  ali model follow..  18  12LEKGVYVHTS---------EEVKGWGVVTKHGLVVLVKNDAYLIDTPTAKDTEKLVNWFIEH---YRIKGSISTHFHGDSTAGIEWLNSQ--SISTYASELTNELLKKDNKVQATNSF-----SGVSYSLIKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFV---------------------KPDGLGNLGDANLEAWPKSAKILMSKKAKLVVSSHSEIGNASLLQRTWEQAVKGLNES......... 220
57 -33.8005ew0_A mol:protein length:234 Beta-lactamase  ali model follow..  12  12FKGPLYIVEDK--------------EYVQENSMVYIGTDGITIIGATTPETAETLYKEIRKVSP-LPINEVINTNYHTDRAGGNAYWKTL--GAKIVATQMTYDLQKSQWGSIVNFTRQGNNK-PGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCIL----------------------KENLGNMSFANRTEYPKTLEKLKELKVDSIIAGHDTPIHDGLIDHYLTLLEKAPK........... 234
58 -33.7002zo4_A mol:protein length:317 Metallo-beta-lactamase family protein  ali model follow..  13  21............................TVNLYLLQGAGEVALVDTATRAARGALELHLAELLCFQDVKTILLTHHHPDHYGLSGFFEGL--GARVFLHEEEFARGHRFWREPEAFAEASWLRDGEALEVAGKRLRVLWTP-GHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFL---------------RSLDRLADLGARVAYAGHFGPIADARLEALLALLDGPKTAWELSLHLFP. 277
59 -32.5001x8h_A mol:protein length:228 Beta-lactamase  ali model follow..  12  8VSGPVYVVEDN--------------YYVQENSMVYFGAKGVTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSI--GAKVVSTRQTRDLMKSDWAEIVAFTRKGLPE-DGDFTLQEGKVRAFYAGPAHTPDGIFVYFPDEQVLYGGCIL----------------------KEKLGNLSFADVKAYPQTLERLKAMPIKTVIGGHDSPLHGELIDHYEALIKAAPQSS......... 228
60 -31.3001ztc_A mol:protein length:221 hypothetical protein TM0894  ali model follow..  15  27...........................HFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELISPDDITDVLFTHVHLDHIFNSVLF----ENATFYVHEVYKTKNYLSFGTIVGRIVVLLKGEESLFDEK---VKVFHTP-WHAREHLSFLENAGRVLITGDITPNRLSYYDIIKGY-------------------GSVQVKNFLDRVGRID--LLVFPHDAPLKPE......................... 212
61 -30.7002p97_A mol:protein length:201 Hypothetical protein  ali model follow..  12  16.....................FNPARNIDFNGFAWIRPEGNILIDPVALSN-----HDWKHLESLGGVVWIVLTN--SDHVRSAKEIADQT-YTKIAGPVAEKENF--------PIYCDRWLSDGDELVPG---LKVMELQGSKTPGELALLLE-ETTLITGDLV---------------RAYRAGGLEILPDEKLMNKQKVVASVRRLAALKVEAVLVGDGWSVFRDGRDRLKELVATLA............ 201
62 -29.3002zwr_A mol:protein length:207 Metallo-beta-lactamase superfamily protein  ali model follow..  17  11...........................LQENAYLVETGEGPVLIDPGDEP--EKLLALFQTT----IPLAILLTHAHFDHVGAVAPLVEAL-DLPVYLHPLDLPLYEGADLAARAWGLAIPKPPLPVRPLEEFGFQVLHLP-GHSPGHVAFYDPEGAQVFSGDLLFRGSVGRYDLPGA-------------------DPKALFASLKRLLSLPPETVHPGHGPGTTLGLEARTNPFLTGLE............ 204
63 -29.0006ao1_A mol:protein length:364 Beta-lactamase domain protein  ali model follow..  12  44............................HINLWLLRDQKGWTIVDCGSGEIKANWETVFDTALEGLPVLRVIVTHCHPDHLGLANWLCEGG-DKKRWNVRLWITLGEYMLGVPAVPGQYRRLRDGDALSIGARTWRVVTGF-GHSPEHCALHAEADGVLISGDVLPRISTNVSVFDIEPEGNPLALYL---------------ESLGRYETMAADLVLPSHGKPFRGTRIGQLRDHHAARLAEVRAACA.... 301
64 -28.9005u8o_A mol:protein length:367 Zn-dependent hydrolase  ali model follow..  12  44............................HINLWLLRDEIDGTVVDCGSDAIRTHWEQIFDAHLDGLPVLRVIVTHCHPDHFGLANWLCEGG-DKRRWNVRLWMTLGEYMDLVPAVPPRYRRLRDGDAVTIGTRTWRVVTGY-GHSPEHCALHSEADGVLISGDVLPRISTNVSVFDLEPEANPLALYL---------------QSLGRYETMAPDLVLPSHGKPFRGTRIAQLRAHHDARLDEV......... 296
65 -28.8004v0h_A mol:protein length:266 METALLO-BETA-LACTAMASE DOMAIN-CONTAINING PROTEIN 1 1  ali model follow..  18  66...........................GGAEAALEEAARGPILVDTGGPWAREALLGALAGQVAPGDVTLVVGTHGHSDHIGNLGLF----PGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPG---------LEVWATP-GHGGQRDVS------VVVAGTALGTVVVAGDVFERDGDEDSWQA--------LSEDPAAQERSRKRVLVV-ADVVVPGHGPPFR........................... 236
66 -28.6002xf4_A mol:protein length:210 HYDROXYACYLGLUTATHIONE HYDROLASE  ali model follow..  15  11...........................FSQNCSLIWCEQLAALVDPGGDA--EKIKQEVDAS----TLMQILLTHGHLDHVGAASELAQHY-GVPVIGPEKEDEFWLQGLPACQPLTPDRWLNDGDRVSVGNVTLQVLHCP-GHTPGHVVFFDEQSQLLISGDVIFKGGVGRSDFPRGD------------------HTQLIDAIKRKLLPLGDDVFIPGHGPLSTLGYERLHNPFLQD.............. 210
67 -28.3005i0p_A mol:protein length:366 Beta-lactamase domain protein  ali model follow..  12  44............................HINLWLLRDQAGWTIVDCGSEAIRTHWEQIFDRHLDGLPVLRVLVTHCHPDHFGLANWLCEGG-DQGRWNVRLWMTLGEYMFGVPAVPPRYRRLREGDAVKIGARTWRVVTGY-GHSPEHCALHSEADGVLISGDVLPRISTNVSVFDLEPEANPLALYL---------------ESLGRYETMAPDLVLPSHGKPFRGTRIAQLRAHHDARLEEVRVACA.... 301
68 -26.4004chl_A mol:protein length:238 PERSULFIDE DIOXYGENASE ETHE1, MITOCHONDRIAL  ali model follow..  18  17...........................SCTFTYLLGDREEAVLIDPV-LETAPRDAQLIKEL----RLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLH------------IEDGDSIRFGRFALETRASP-GHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGC------------------AKTLYHSVHEKIFTLPGDCIYPAHD............................... 180
69 -25.8002yhe_A mol:protein length:668 SEC-ALKYL SULFATASE  ali model follow..  12  114.IAGLFEVMPKLYQVRGLDP---------ANMTIIEGDSGLVLIDTLTAETARAALDLYFQHRPKKPIVAVVYSHSHIDHFGGARGIIDEADKVKVFAPSGFMEHAVSENILAGTAMARLIEKPYERHTVDGVELEFQLTLGSEAPSDMNIYLPQFKVLNTADNAPPAMHNLLTPRGAEVRDAKA--------------AGYIDASLEKYGDRTDVLIQQHNWPVWGG--DKVRTYLADQRDMYAFLNN.... 381
70 -25.6002cfu_A mol:protein length:658 SDSA1  ali model follow..  104.KYGLFEVAEGIYQVRGFDL---------ANITFIRGDSGWIVVDTLTPATARAAYELVSRELGERPIRTVIYSHAHADHFGGVRGLVEPQQAVQIIAPAGFMEAAIKENVLAGNAMMRLIEGEGEDLVLDGVPFTFQNTPGTESPAEMNIWLPRQKALLMAENVVGTLHN----------------LYTLRGAEVRDALGWSKYINQALHRQAEVMFAVHNWPRWGN--AEIVEVLEKQRDLYGYLHD.... 370
71 -25.5005eht_A mol:protein length:253 N-acyl homoserine lactonase  ali model follow..  15  36...........................VPVWCYLLETEEGPILVDTGMPESADRIVNILKRVYEPDDLLYIISSHLHFDHAGGNGAF----TNTPIIVQRTEYEAALHREEYMTECILPHLN-EGDYEVVPG--VQLLYTP-GHSPGHQSLFIETEQVLLTIDAS-----------------YTKENFEDEVPFAGFDPELALSSIKRLKEVVKKMIFFGHDI.............................. 240
72 -25.5004nur_A mol:protein length:633 PSdsA  ali model follow..  10  86.ISGLFEVTDGIYQVRNYDL---------SNMTIVEGKDGITIFDPLSQETAKAALDLYYKHRPKKPVVAVIYTHSHVDHYGGVRGVVDEADKVKIYAPLGFLEHAVAENVMAGTAMSDIIKETGETHVIDGLTYEFMYAPGSEAPAEMLYYIKEKKALNAAEDSTHTLHN----------------TYSLRGAKIRDPLAWSKYLNEALKLDVQVMYAMHHWPVWGN--KEVREQLSLQRDMYRYIND.... 352
73 -25.5002r2d_A mol:protein length:276 Zn-dependent hydrolases  ali model follow..  10  41...........................IPVSAYLIQCTDATVLYDTGCHPECCNLPERLRQLLSPDDISTVVLSHLHNDHAGCVEYF----GKSRLIAHEDEFATIEAWLATPRNWDLVGRDERERELAPG---VNLLNFGTGHASGMLGLAVRLEKFLLVSDACYTATNYGP---------------PARRAGVLHDTIGYDRTVSHIRQYAESTVLFGHDR.............................. 261
74 -25.3003dha_A mol:protein length:254 N-Acyl Homoserine Lactone Hydrolase  ali model follow..  14  37...........................LPVWCYLLETEEGPILVDTGMPESADRIVNILKRVYEPDDLLYIISSHLHFDHAGGNGAF----TNTPIIVQRTEYEAALHREEYMKECILPHLN-EGDYEVVPG--VQLLYTP-GHSPGHQSLFIETEQVLLTIDAS-----------------YTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGHDI.............................. 241
75 -25.1005eh9_A mol:protein length:253 N-acyl homoserine lactonase AiiA  ali model follow..  14  36...........................LPVWCYLLETEEGPILVDTGMPESADRIVNILKRVYEPDDLLYIISSHLHFDHAGGNGAF----TNTPIIVQRTEYEAALHREEYMKECILPHLN-EGDYEVVPG--VQLLYTP-GHSPGHQSLFIETEQVLLTIDAS-----------------YTKENFEDEVPFAGFDPELALSSIKRLKEVVKKIIFFGHDI.............................. 240

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.