current user: public

If you have questions about the server, please let us know.

Query: TM0016 TM0016 281897 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
1 -33.9005xtb_B mol:protein length:176 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial  ali model follow..  30  34LGMTLSYLFREPA--TINYPFEKGPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTET. 143
2 -33.8002fug_9 mol:protein length:182 NADH-quinone oxidoreductase chain 9  ali model follow..  28  10LGITLKYLFSKPV--TVPYPDAPVPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAEVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYE. 125
3 -33.6005lc5_I mol:protein length:176 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial  ali model follow..  30  34LGMTLSYLFREPA--TINYPFEKGPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTET. 143
4 -32.3006cfw_N mol:protein length:139 NADH-plastoquinone oxidoreductase subunit  ali model follow..  21  7LPTVIKNLFKKPA--TNPFPKTEPVPVPEDFR--KLVYNVDKCVGCRMCVTVCPAGVFVYLPERKVTLWIGRCVMCKQCVDVCPTAALQMSDEFLLASYD. 104
5 -31.9005gpn_b mol:protein length:212 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8  ali model follow..  30  70LGMTLSYLFREPA--TINYPFEKGPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTET. 179
6 -31.8006g2j_I mol:protein length:212 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial  ali model follow..  30  70LGMTLSYLFREPA--TINYPFEKGPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTET. 179
8 -30.6002vkr_A mol:protein length:103 ZINC-CONTAINING FERREDOXIN  ali model follow..  27  37..................................IVGVDFDLCIADGSCITACPVNVFQWYDTKADPINEQACIFCMACVNVCPVAAIDVKP......... 102
9 -30.5001xer_A mol:protein length:103 FERREDOXIN  ali model follow..  27  37..................................IVGVDFDLCIADGSCINACPVNVFQWYDTKADPVNEQACIFCMACVNVCPVAAIDVKP......... 102
10 -29.7001k0t_A mol:protein length:80 PSAC SUBUNIT OF PHOTOSYSTEM I  ali model follow..  19  1.................................SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTR. 74
11 -29.5001jb0_C mol:protein length:80 PHOTOSYSTEM I IRON-SULFUR CENTER  ali model follow..  19  1.................................AHTVKIYDTCIGCTQCVRACPTDVLEMVPWDASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRS 75
12 -29.5004kt0_C mol:protein length:81 Photosystem I iron-sulfur center  ali model follow..  21  3..................................HSVKIYDTCIGCTQCVRACPLDVLEMVPQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTR. 75
13 -29.4002wsc_C mol:protein length:81 PHOTOSYSTEM I IRON-SULFUR CENTER  ali model follow..  19  3..................................HSVKIYDTCIGCTQCVRACPTDVLEMIPWGASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTR. 75
14 -29.4005zgb_C mol:protein length:81 PsaC  ali model follow..  19  3..................................HTVKIYDNCIGCTQCVRACPLDVLEMVPQMASAPRTEDCVGCKRCETACPTDFLSIRVYLGGETTR. 75
15 -29.3005zji_C mol:protein length:81 photosystem I subunit VII  ali model follow..  19  3..................................HSVKIYDTCIGCTQCVRACPTDVLEMIPWDASAPRTEDCVGCKRCESACPTDFLSVRVYLGPETTRS 76
16 -28.4005t5i_G mol:protein length:82 Tungsten formylmethanofuran dehydrogenase subunit fwdG  ali model follow..  30  4..................................GLKAYPELCHGCGNCVIACPVNALRSPEGVVNIKNPDLCGKCGTCVESCPVDAIRLEELE....... 82
17 -27.1003gyx_B mol:protein length:166 Adenylylsulfate Reductase  ali model follow..  27  2...................................TYVDPSKCDGCKACMYICPNDLMILDPEKAFNQEPEACWECYSCIKICPQGAITARPYADFAPMGG 74
18 -26.9005c4i_B mol:protein length:315 Oxalate oxidoreductase subunit delta  ali model follow..  42  232.............GTVPSPVTENEGMVTGNWRIQRPIIDREACTECYTCWIYCPDSCITRTEEG-PVFNMKYCKGCGLCTAVCPSGALTNVPELDFKD... 315
19 -26.8001jnr_B mol:protein length:150 adenylylsulfate reductase  ali model follow..  26  1.................................MPSFVNPEKCDGCKACEYICPNDLMTLDKEKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGG 75
20 -26.0001bqx_A mol:protein length:77 PROTEIN (FERREDOXIN)  ali model follow..  27  4....................................ITEPCIGTKCASCVEVCPVDCIHEGEDQYY-IDPDVCIDCGACEAVCPVSAIYHEDFVP...... 61
21 -25.4005t5i_F mol:protein length:349 Tungsten formylmethanofuran dehydrogenase subunit fwdF  ali model follow..  21  263..................................ELIIDQDTCQACETCVMVCPCNVLSFPKPEKLHKDERFCIYCGACERSCPVTAITVKRNRINTTPI. 335
22 -25.4001rgv_A mol:protein length:80 ferredoxin  ali model follow..  26  1...................................ALYINDDCTACDACVEECPNEAITPGDP-IYVIDPTKCSECVQCRLVCPADCIPDNPDYRETREE. 70
23 -25.1003eun_A mol:protein length:82 Ferredoxin  ali model follow..  30  1...................................ALMITDECINCDVCEPECPNGAISQGDET-YVIEPSLCTECSQCVEVCPVDAIIKDPSHEETEDE. 70
24 -24.9001blu_A mol:protein length:82 FERREDOXIN  ali model follow..  29  1...................................ALMITDECINCDVCEPECPNGAISQGDET-YVIEPSLCTECSQCVEVCPVDCIIKDPSHEETEDE. 70
25 -24.9002zvs_A mol:protein length:85 Uncharacterized ferredoxin-like protein yfhL  ali model follow..  31  1...................................ALLITKKCINCDMCEPECPNEAISMGDHI-YEINSDKCTECPTCQKVCPIPNTIVKDPAHVETEEQ 71
26 -24.5003exy_A mol:protein length:82 Ferredoxin  ali model follow..  29  1...................................ALMITDECINCDGCEPECPNGAISQGDET-YVIEPSLCTECSQCVEVCPVDCIIKDPSHEETEDE. 70
27 -23.9002fgo_A mol:protein length:82 Ferredoxin  ali model follow..  26  1...................................SLKITDDCINCDVCEPECPNGAISQGEEIYV-IDPNLCTECPQCQQVCPVDCIPLDDANVESKDQ. 70
28 -23.4001fdn_A mol:protein length:55 FERREDOXIN  ali model follow..  34  1...................................AYVINEACISCGACEPECPVNAISSGDDR-YVIDADTCIDCGACAGVCPVDAPVQA.......... 55
29 -23.2001h98_A mol:protein length:78 FERREDOXIN  ali model follow..  26  1...................................PHVICEPCIGVKSCVEVCPVECIYDGGDQFY-IHPEECIDCGACVPACPVNAIYPEEDVPEQWK.. 65
30 -23.2006fah_A mol:protein length:396 Caffeyl-CoA reductase-Etf complex subunit CarE  ali model follow..  35  5.....................................VIEEKCIGCSKCQKSCPFDAITIENKIA--VIGDACTNCGTCIDVCPTEAILQEGTEKIVRDLS 66
31 -23.2001fca_A mol:protein length:55 FERREDOXIN  ali model follow..  38  1...................................AYVINEACISCGACEPECPVDAISQGGS-RYVIDADTCIDCGACAGVCPVDAPVQA.......... 55
32 -23.1001bc6_A mol:protein length:77 7-FE FERREDOXIN  ali model follow..  27  3.....................................VITEPCIGTASCVEVCPVDCIHEGEDQYY-IDPDVCIDCGACEAVCPVSAIYHEDFVPEEWK.. 65
33 -23.0001clf_A mol:protein length:55 FERREDOXIN  ali model follow..  34  1...................................AYKIADSCVSCGACASECPVNAISQGDS-IFVIDADTCIDCGNCANVCPVGAPVQE.......... 55
34 -22.9001b0v_A mol:protein length:106 PROTEIN (FERREDOXIN)  ali model follow..  26  1...................................AFVVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IHPDECNDCALCEPECPAQAIFSEDEVPEDMQ.. 65
35 -22.8001dur_A mol:protein length:55 2[4FE-4S] FERREDOXIN  ali model follow..  32  1...................................AYVINDSCIACGACKPECPVNCI--QEGSIYAIDADSCIDCGSCASVCPVGAPNPED......... 55
36 -22.8001f5b_A mol:protein length:106 FERREDOXIN 1  ali model follow..  27  3.....................................VVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
37 -22.8002fd2_A mol:protein length:106 FERREDOXIN  ali model follow..  29  3.....................................VVTDNCIKCKDCVEVCPVDAFYEGPNFLV-IHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
38 -22.7001d3w_A mol:protein length:106 FERREDOXIN 1  ali model follow..  27  3.....................................VVTDNCIKCKECVEVCPVDCFYEGPNFLV-IHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
39 -22.6001ftc_A mol:protein length:106 FERREDOXIN  ali model follow..  29  1...................................AFVVTDNCIKCKDCVEVCPVDCFY-EGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
40 -22.5001pc4_A mol:protein length:107 Ferredoxin I  ali model follow..  24  1..................................MAFVVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IHPDECIDCALCEPECAAQAIFSEDEVPEDMQ.. 66
41 -22.5001a6l_A mol:protein length:106 FERREDOXIN  ali model follow..  27  3.....................................VVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
42 -22.4001g6b_A mol:protein length:106 7FE FERREDOXIN I  ali model follow..  27  3.....................................VVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IHPDECIDCALCESECPAQAIFSEDEVPEDMQ.. 65
43 -22.4001ff2_A mol:protein length:106 FERREDOXIN I  ali model follow..  25  3.....................................VVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IHPDECIDDALCEPECPAQAIFSEDEVPEDMQ.. 65
44 -22.4001fri_A mol:protein length:106 FERREDOXIN  ali model follow..  27  3.....................................VVTDNCIKCKDCVEVCPVNCFYEGPNFLV-IHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
45 -22.4001frk_A mol:protein length:106 FERREDOXIN  ali model follow..  27  3.....................................VVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IDPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
46 -22.4001frl_A mol:protein length:106 FERREDOXIN  ali model follow..  27  3.....................................VVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IHPDSCIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
47 -22.4001gao_A mol:protein length:106 FERREDOXIN I  ali model follow..  25  3.....................................VVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IHPDECIDCASCEPECPAQAIFSEDEVPEDMQ.. 65
48 -22.4001b0t_A mol:protein length:106 PROTEIN (FERREDOXIN I)  ali model follow..  27  3.....................................VVTDNCIKCKKCVEVCPVDCFYEGPNFLV-IHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
49 -22.4001fd2_A mol:protein length:106 FERREDOXIN  ali model follow..  25  3.....................................VVTDNCIKCKDCVEVAPVDCFYEGPNFLV-IHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
50 -22.3001frm_A mol:protein length:106 FERREDOXIN  ali model follow..  29  3.....................................VVTDNCIKCKDCVEVCPVDCFYEGPNFLV-IHPDECIDCALCAPECPAQAIFSEDEVPEDMQ.. 65
51 -22.3002xsj_A mol:protein length:437 SULFITE REDUCTASE ALPHA SUBUNIT  ali model follow..  18  264................................GAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKL-QINNRECTRCMHCLNVMPRALRIGNDR........ 323
52 -22.3001g3o_A mol:protein length:106 7FE FERREDOXIN I  ali model follow..  27  3.....................................VVTDNCIKCKDCVEECPVDCFYEGPNFLV-IHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
53 -22.2002v2k_A mol:protein length:105 FERREDOXIN  ali model follow..  33  5.......................................AEPCVDVKACIEECPVDCIY-EGARMLYIHPDECVDCGACEPVCPVEAIYYEDDVPDQWS.. 65
55 -22.0001f5c_A mol:protein length:106 FERREDOXIN 1  ali model follow..  28  5.......................................TDNCIKCKDCVEVCPVDCHYEGPNFLV-IHPDECIDCALCEPECPAQAIFSEDEVPEDMQ.. 65
56 -21.7003or1_A mol:protein length:437 Sulfite reductase alpha  ali model follow..  16  265.................................AHAGRDWGKFDIEAEVVGLCPTGCMTYESGTL-SIDNKNCTRCMHCINTMPRALKIGDER........ 323
57 -21.5001hfe_L mol:protein length:421 PROTEIN (FE-ONLY HYDROGENASE (E.C. (LARGER SUBUNIT))  ali model follow..  32  29....................................QIDEAKCIGCDTCSQYCPTAAIFGEMGEHSIPHIEACINCGQCLTHCPENAIYEAQSWVPEVEK. 93
58 -21.5002v4j_A mol:protein length:437 SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT ALPHA  ali model follow..  15  264................................GAHSGRDWGKFDIEAEVVNRCPSKCMKWDGSKL-SIDNKECVRCMHCINTMPRALHIGDER........ 323
59 -21.1006cz7_B mol:protein length:234 4Fe-4S ferredoxin, iron-sulfur binding domain protein  ali model follow..  26  41..........................TEGTFPDVKYTYIPTLCNHCDDCVKVCPTGAMHKDKRGLTLQNNDECIGCKKCMNACPYGVISFN.......... 107
61 -20.5003mm5_B mol:protein length:366 Sulfite reductase, dissimilatory-type subunit beta  ali model follow..  14  164.DHKLPAMCRISLACCANMCGAVHASDIAIVGIHRTPPIPRKTCEIPSTVAACPTGALKPDMNKTIKVDVEKCMYCGNCYTMCPGMPLFDPENDGAA.... 265
62 -20.2002vpw_B mol:protein length:195 NRFC PROTEIN  ali model follow..  25  42..........................EVGEYPNLVVEFRPEQCLHCENCVPVCPTGASYQTKDGLVLVDPKKCIACGACIAACPYDARYLHPA........ 110
63 -19.6003mm5_A mol:protein length:418 Sulfite reductase, dissimilatory-type subunit alpha  ali model follow..  20  254.......................................ASWMDIENEVVKLCPTGAIKWDGKEL-TIDNRECVRCMHCINKMPKALKPGDER........ 306
64 -19.2001yq3_B mol:protein length:252 succinate dehydrogenase Ip subunit  ali model follow..  22  150..................................QKLDGLYECILCACCSTSCPSYWWNGDKQLQDPFSLYRCHTIMNCTRTCPKGL.............. 229
65 -19.1004v4c_B mol:protein length:274 Pyrogallol hydroxytransferase small subunit  ali model follow..  20  7....................................VIDVAKCQDCNNCFMGCGNGAVYQREDGIVLIDPEKAKGKKELLDTCPYGVMYWNEEENVAQK.. 125
66 -19.1003cf4_A mol:protein length:807 Acetyl-CoA decarboxylase/synthase alpha subunit  ali model follow..  30  415........................................AKCADCGACLLACPEEIAKKGDFSYFEEIHDTCIGCRRCEQVCKKE-IPILNVIEKIAQK. 481
67 -19.0005odc_A mol:protein length:654 Heterodisulfide reductase, subunit A  ali model follow..  21  555.............SAAASRAAIPLAKGEVEVEPIIASVDAEICGGCGVCVKQCPYGAPRLVEKDVAEVISALCKGCGTCPAGCPSGALEQD.......... 635
68 -18.9005d6s_A mol:protein length:399 Epoxyqueuosine reductase  ali model follow..  24  202.......................................DYGCGDCRRCLDACPTSCLIGD----GTMNARRCLGCDICQISCPYNRGIDNPLASDIDPD. 281
69 -18.8004ytp_B mol:protein length:280 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial  ali model follow..  21  175...............................EEREKLDGLYECILCACCSTSCPSYWWNGDAKLQDPFSLYRCHTIMNCTGTCPKGL.............. 257
70 -18.5004z3w_E mol:protein length:179 Iron-sulfur cluster-binding oxidoreductase, putative benzoyl-CoA reductase electron transfer protein  ali model follow..  23  80....................................IIDGKEYDECGFCRASCPSRDLFREPDSGLPLKCDLCDG--LCVKWCLVGALSVTEREVEEPDES 146
71 -18.3005d08_A mol:protein length:437 Epoxyqueuosine reductase  ali model follow..  29  207.......................................EDMCGSCTKCLDACPTGALV----NPGQLNAQRCIGCDTCQTVCPLN............... 272
72 -18.3002bs2_B mol:protein length:241 QUINOL-FUMARATE REDUCTASE IRON-SULFUR SUBUNIT B  ali model follow..  23  140...............................EVAQEVFELDRCIECGCCIAACGTTDEDYYELIGDDDGVFGCMTLLACHDVCPKNL.............. 222
73 -18.3001kf6_B mol:protein length:243 FUMARATE REDUCTASE IRON-SULFUR PROTEIN  ali model follow..  26  137...............................AQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHCTFVGYCSEVCPKHV.............. 218
74 -18.2004ras_A mol:protein length:704 Oxidoreductase, NAD-binding/iron-sulfur cluster-binding protein  ali model follow..  24  474............IGDTLLNPFIGPRSKSIVFTTDLPM--QDFCNQCRKCARECPCNAISFGDKEIWKADVEKCTACGRCMKMCPWN............... 571
75 -18.1003vr8_B mol:protein length:282 Iron-sulfur subunit of succinate dehydrogenase  ali model follow..  23  171...............................KEQEKLDGLYECILCACCSASCPSYWWNADARMQDGFSAFKCHTIMNCTKTCPKHL.............. 253

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.