current user: public
If you have questions about the server, please let us know.

Query: TM0002 TM0002 281883 Purified-2001-08-29, from T.maritima

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst MSPEDWKRLICFHTSKEVLKQTLDDAQQNISDSVSIPLRKYLast
1 -4.490PF17196.4; Q82NZ0_STRAW/1-65; Protein of unknown function (DUF5133 topsan)  ali follow..  16  36...DDAAYTLCVSTGTKDVEAALVAARRRLPLA........ 65
2 -4.190PF05318.12; MP1_TCV/1-72; Tombusvirus movement protein  ali follow..  23  30......KRLVASHAASSVLNKKRNEGSASHGGTWVIVADK. 63
3 -4.170PF15825.5; W5NRH4_SHEEP/30-94; FAM25 family  ali follow..  25  3............HVVEGVVKEVIDHAKEAGEKAIADALKK. 30
4 -4.150PF00861.22; RL18_BACSU/5-120; Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast  ali follow..  32  26.......RLNVFRSNKHIYAQIIDDVNGVTLASAS...... 53
5 -4.110PF14452.6; E6W9I5_PANSA/105-171; Multiubiquitin  ali follow..  12  17ISGAALYELAKPGDGDAVFMVIRGGDDRQIEPNEAVDLTT. 56
6 -4.060PF03959.13; LOVG_ANOGA/1-211; Serine hydrolase (FSH1)  ali follow..  13  13.......KVLALHQNADSFKSKLGSFRKMLNKYVEF..... 44
7 -4.040PF00547.18; R7EWA2_9BACT/1-99; Urease, gamma subunit  ali follow..  11  3LTPKELDKLLLLSAGMVAERRLKKGLKLNYPEAVAY..... 38
8 -4.020PF13999.6; A8AGS3_CITK8/1-63; MarB protein  ali follow..  20  4........VLLVVSGQSIAEQTAQPGTQNDRDAMVMP.... 32
9 -4.000PF11034.8; G3JKJ7_CORMM/1-67; Glucose-repressible protein Grg1  ali follow..  36  22.............TSKEANKEVAKDSNANVGTRLS...... 43
10 -4.000PF06591.11; I6ZYJ3_9CAUD/1-152; T4-like phage nuclear disruption protein (Ndd)  ali follow..  28  132....................QTLEEMNRMLADNFKFVLQAY 152
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 7 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.