current user: public

If you have questions about the server, please let us know.

Query: TM0009 TM0009 281890 Purified-2001-02-14, from T.maritima

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MIGPRDLLNIALRIESTGYSYYKNLTEKTEGETKALFERLAEQERDHSRKFKEILEKYEQDLNPSDEVLGYLEALAEISIFPKLEETPPDDLREAVRRAIEVEKDSIVFYSEILSYVPEKEPVQTIIDEEKKHLRDLLRLEVLast
1 -44.100PF09968.9; A6LNR3_THEM4/28-188; Uncharacterized protein domain (DUF2202 topsan)  ali follow..  15  2....TESIMQMRKEEKLARDVYLVFYDLWG---IRVFSNIAGAEQQHMDAVLTLIKKYDSNDPIKVDERGIFEDENLQALYNQLVEQGSKSLEDALIVGATIEDLDIYDLEEFLKITDNEFVYKNLIKGSENHMRAFVSQLS 139
2 -29.000PF02915.17; O26850_METTH/9-145; Rubrerythrin  ali follow..  14  1.....ENLTKAFIGESQARNRYTFYAKIAKKQISEIFLTTADNEREHAKWLFRLINDLKKEVGEDLS---------SIVVDAEAPLTLGTTDENLIAAIEGEHYENSEMYPEFADVAEEAKRLRAIAEAEKHHEERYRKL.. 136
3 -25.000PF13668.6; Q11V37_CYTH3/38-167; Ferritin-like domain  ali follow..  17  1..SVTDTLNYALTLEYLEEAFYVQGLAKIDSADMTIFNQIKKHESAHVVFLKNVLGSAANPSPAFDFGTAF------------------DSYANFLATAQALEDTGVRAYKNLITNKVALTAALQIHSVEARHASEVRRLRM 129
4 -23.800PF14530.6; C6WDL2_ACTMD/9-146; Domain of unknown function (DUF4439 topsan)  ali follow..  14  1......AVQVGLGAEHAAVWTYGLVSAFLPKAQEAVVAEGANAHRARRDTTERWLRDAGQQPKPAAAAYLPPEGV--------------QDAASSIAALVAVEADCCAAWRGVLERTDDRTTALTALTESAVRGTRWRRAAG 125
5 -21.100PF11266.8; Q8DJB4_THEEB/11-228; Long-chain fatty aldehyde decarbonylase  ali follow..  13  11...YSRINAIVIEGEQEAHDNYIDLAKLL-PQHQEELTRLAKMEARHKKGFEACGRNLSVTPDMEFAKAFFEK-----RANFQRALAEGKTATCLLIQALIIESFAIAAYNIYIPMADPRKITESVVKDEYSHLN....... 139
6 -20.500PF05067.12; Q9KAU6_BACHD/1-281; Manganese containing catalase  ali follow..  35..............EISVALQYQGWNTRGDGKYRDLLMDTGTEELAHVEMLATMIARLLDGAPVGDQEAAAKNPVIGAVLWTADYIIASGNLLADFRMNLTAESQGRLQAVRLYEMTTDRDMLSFLIARDRMHQNQWYAAIC 191
7 -17.500PF03232.13; H0VHI5_CAVPO/48-217; Ubiquinone biosynthesis protein COQ7  ali follow..  16  1..AVDRIIRVDHAGEYGADRILAQMAVLGRTSVGPVIQKMWDQEKAHLKKFSELMVAFRVR-------PTALMPLWNVMGFALGAGTALLGKEGAMACTVAVEETIAHHYNNQIRMLMELQLIKTIRDEELEHHDTGLY... 140
8 -17.000PF12902.7; A4FHP6_SACEN/30-243; Ferritin-like  ali follow..  19  1.......LQAAMQIELTTIPLYMSIHPGTNEEAQLVIRSVVLEEMLHLTLAANLVNALGGNPRDQAHNLPSYPAKAPYSAESVTPFPLTPFSRAALDMFIAIESPP-QFYGLIDKGLRN-EAIEVIIEEQEAHYFRFKEIR. 213
9 -16.300PF03405.14; E1ZCJ2_CHLVA/69-399; Fatty acid desaturase  ali follow..  10  59..DYFVCLVGDMITEEALPTYMAMLNTAAPTPWGRWTRQWVAEENRHGDLMNKYCWLSGRVDL------RQVEVTIQNLIGSGMDPKTENNPYLGFIYTSFQERATKVSHGNTARMAAEGKVCGAIASDESRHEIAYTRIVD 207
10 -14.700PF04305.14; C1MSR4_MICPC/21-274; Protein of unknown function (DUF455 topsan)  ali follow..  15  66..SRVAILHSLAHIESWAIDLSWDAIARFGRKFFEDFLAVAADEARHFSLLAARLVELGSSYGALTAHDGLWESATETRDSLEARLVIEHCVHEAR--GLDVLPGTIAKFRRFGDDPSADLLEHVIYPEEITHCA....... 202
11 -14.400PF09537.10; A4XUK4_PSEMY/9-119; Domain of unknown function (DUF2383 topsan)  ali follow..  18  1..ELVRTLNKLIETCKDGEAGFKVCAEDIKRDIKQLFTQRARQCGEAAAELQRVVLEFGGEPEDSTSISADLHRRWVD-----KSLVTGKDEEAILNEAERGEDVAKERYSEALSK.......................... 111
12 -14.100PF11583.8; G0G4P5_AMYMS/7-282; P-aminobenzoate N-oxygenase AurF  ali follow..  10  67..EVASVATTGLWFEILLMQMLLKYEQDPTSAHAQFALTEIADECRHSTMFARMASRIGCPAYGPVPWLRRLAKLMP---------TISYGPARYGAVLVAEEVLDRLQREQMTDEGVQRMVNRIHVLEEARHVTEVTRGMA 206
13 -12.800PF06175.11; Q8CX43_SHEON/3-250; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)  ali follow..  11  83......QFLARDVKKNELVAVLQPNQHFSFADLIPPLIRLIKEEFHHFEQVLELMHARQ-------PYRNIRAGRYAKGMMSHVTTHEKNILRDKLIVGAYIEARSCERFAKLAPYLDASKFYVSLLRSEARHFEDYLKL.. 213
14 -11.100PF05974.12; Q3J1S1_RHOS4/10-166; Domain of unknown function (DUF892 topsan)  ali follow..  16  1..SMDDLLQDIYYAEQQIEKALPKMIEKAGAGLREGFEHHLDETRTHVSRLERVFALLGQDAKGTTCPAID---IKEANEVAGDIAEQDVLDAALAAAAQAVEHYEMTRYGTLIAWSKEASILEQTLSEEKAADMKLTKL.. 148
15 -11.000PF14518.6; A0QTA7_MYCS2/140-317; Iron-containing redox enzyme  ali follow..  11  1....REYFVHRSLYHLKEGDPHAWLIPRISGQAKASFVAIEYDEHLHQQLFADLMEAADLDTTYLGYIGHVPAESLALVNLMSMFGLHRKLRGAAAGHFAATEITSSPGSQRLTAALKR-RFYAEHVEADAVHEQVVRLN.. 150
16 -10.400PF02332.18; G7ZAS0_AZOL4/60-290; Methane/Phenol/Toluene Hydroxylase  ali follow..  73...LQNHVGAFKHAEYGLGTALMRAQRYGTQMVNNAILTNASYKLRFAQDLTLYLAEVGSDIGGFDLDAGKAHREAVEHIRAATDFLEQYFAVNLVFEPLVGELFRSGFVMQVAAAQNDPSVISAAEADYERNLA....... 218
17 -10.300PF05138.12; Q5P3I7_AROAE/1-255; Phenylacetic acid catabolic protein  ali follow..  9..EHIEYVLRLGDNALILGQRLSEWCGHAPVEEDMALANMSLDLIGQARMLLTHAGRLEGRGRDEDQLAFLRTE--PNYRNLTLCELPNQDFARTMVRNFLYSSFQKLLWERLMTSSDAAAIAAKSIKEARYHAQ....... 142
18 -10.200PF01786.17; V2XMG8_MONRO/89-321; Alternative oxidase  ali follow..  11  73ILFLESIAGVPGMVAATMRHLTSLRLMRRDNGWIHTCLEEAENERMHLMTFMTLRKP----------FFRAMILGAQGVFYNLFFLSYMISPRICHRFVGHLEEEAVVTYTRCIKDIEALDVIYAVRSDETTHRFV...... 227
19 -9.700PF00268.21; RIR2_SHV21/5-277; Ribonucleotide reductase, small chain  ali follow..  15  49...YKFLFTFLGMAEKLVNINIEDLLSQFSHDISHYYAEQMAMENIHGKVYANILNMLFKNNITEACDIMNDSALQEKLRWLNGRVTEASDKAEKILLFLLVE--GIFFISSFFIMNGICLANDYIARDEMLHTSAAALLYN 199

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.