current user: public

If you have questions about the server, please let us know.

Query: TM0020 TM0020 281901 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MIELDYLTIAFGGAIGAVLRYLVSRTINSLLPFSYIPLGTIIVNSVGSFFLSFLMFAAIEKVPLSKEAILFFGTGLLGAFTTFSTFTYETLSLIEESPARGVAYALANLLFAFTCAYFGMILGRGKVLast
1 -57.600PF02537.15; CRCB2_BACLD/5-113; CrcB-like protein, Camphor Resistance (CrcB)  ali follow..  33  1......VAVFIGGAIGSLLRYAVNLLGGT----AVFPWPTFIENTSGSLLLGLLTGFFAAR-AKKPLVQLCLGTGFCGGYTTMSAFSKETVLLLQSAAHIGVLYLMASLACGVCFAFLGI....... 109
2 -8.550PF11200.8; A7AQJ9_BABBO/2-370; Protein of unknown function (DUF2981 topsan)  ali follow..  12  4LFYIAIQQFLLGISLYSVIHYL---------SLTQLAWLLFGTNAISAVL------------------------GFMGALKR--NIVMECVYLVFYAISLFLIFLTVLDMAELV............. 84
3 -7.610PF10278.9; A7RLX2_NEMVE/18-205; Mediator of RNA pol II transcription subunit 19  ali follow..  10  16..........INGSSNLLVQNGLEQSYQKFCGKKV-NLSAFLPHLPGYIDENSLRSVIDKPPIGGKELLPL-------PSHALSGFRLNPGPIPEQFRFM........................... 104
4 -7.190PF03213.14; VP35_FOWPN/1-327; Poxvirus P35 protein  ali follow..  14  286.....................................FGKYDITMMFLIAIVIIIGLAI--FDINNKLLWLLS----GVFLAYS........................................... 326
5 -7.150PF13054.6; C3AQ16_BACMY/1-123; Protein of unknown function (DUF3915 topsan)  ali follow..  47.........................................VCNVLRHIAIGTEISLLTIKG--NVTFRNVIFEGFSNGVALFSALNMDNQNNMNATKFTGLLRVCPEDIIAI.............. 123
6 -7.120PF17638.2; UL42_HCMVM/1-125; HCMV UL42  ali follow..  23  86...................................WTFALLVVAILGIIFLAVVFTVVINRDSAN------ITTG-----TQASS.......................................... 124
7 -7.040PF16297.5; F7ASC6_CALJA/2-113; Domain of unknown function (DUF4939 topsan)  ali follow..  32..........FDGDTDRLPEFIVQMGSYMFMDENTFSNDALKVTFLITRLTGPTLQWMIPYIKKQSPL-----------LNDYWGFLAEMKRVFGC............................... 106
8 -6.610PF13074.6; A0A073KFW3_9BACI/25-122; Protein of unknown function (DUF3938 topsan)  ali follow..  16  15...........................................TIVSALLIGRLVLFFLDSEESSQKTVLLTMIGIVGGCLSYSITNYPIVLHISSAFFHGL......................... 73
9 -6.490PF05505.12; NCAP_EBOZM/19-734; Ebola nucleoprotein  ali follow..  15  1MDYHKILTAGLSVQQGIVRQRVIPVYQVNNLEEQAFEAGVDFQESADSFLLMLCLHHAYKLFLESGAVKYLEGHGFRFEVKKRDGVK-ELLPAVSSGKNIKRTLAAMEANAGQFLSFASLFLPKLVV 145
10 -6.490PF05297.11; LMP1_EBVB9/1-386; Herpesvirus latent membrane protein 1 (LMP1)  ali follow..  23  34LALLFWLYIVMGGALLVLYSFALMLIIIILIRDLLCPLGALCINLHGALFLGIVLFIFGCLLVLGIWIYLLEMLWRLGALAFFLAFFLDLILLLQQNWWTLLVDLLWLLLFLAILIW.......... 183

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.