FFAS03 results for 281882

Query: TM0001 TM0001 281882 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.

						`. 10 . 20 . 30 . 40`
#	Score	Template	Links and tools	%id	First	`MVYGKEGYGRSKNILLSECVCGIISLELNGFQYFLRGMETL`	Last
1	-5.720	`d1skza1 g.3.15.1 (A:7-58) Factor Xa inhibitor antistasin {Mexican leech (Haementeria officinalis) [TaxId: 6410]}`	`ali model 3D-neighbors follow..`	32	10	`........GSACNIITDRCTCSGVRCRVHGFQRSRYGCE..`	43
2	-5.060	`d1agga_ g.3.6.2 (A:) omega-Agatoxin IV, IVa, IVb {Funnel web spider (Agelenopsis aperta) [TaxId: 6908]}`	`ali model 3D-neighbors follow..`	29	9	`..YGKCTWGGTKCCRGRPCRCSMIGTNCE............`	35
3	-4.040	`d1bx7a_ g.3.15.1 (A:) Hirustasin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}`	`ali model 3D-neighbors follow..`	23	2	`NTCGGETCSAAQVCLKGKCVCNEVHCRIYGLKKDENGCE..`	43
4	-3.290	`d1y29a_ g.3.6.2 (A:) Huwentoxin-X {Spider (Selenocosmia hainana) [TaxId: 209901]}`	`ali model 3D-neighbors follow..`	44	6	`...GKPCYGATQKI-----CCGVCS................`	23
5	-3.210	`d3brda2 b.2.5.8 (A:195-380) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}`	`ali model 3D-neighbors follow..`	18	31	`...AQKSYGNEKRFFCPPPCIYLIG................`	52
6	-3.130	`d1bhpa_ g.13.1.1 (A:) beta-Purothionin {Wheat (Triticum aestivum) [TaxId: 4565]}`	`ali model 3D-neighbors follow..`	16	12	`.CYNLCRARGAQKLCANVCRCKLTS................`	35
7	-3.060	`d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]}`	`ali model 3D-neighbors follow..`	25	9	`.LVGKGFLTQNKEIFCQKCGSGMDT................`	32
8	-3.060	`d1nj7a_ g.63.1.1 (A:) Attractin {California sea hare (Aplysia californica) [TaxId: 6500]}`	`ali model 3D-neighbors follow..`	17	15	`MQHKNCEDANGCDTIIEECKTSMVERCQNQEFESAAGSTTL`	55
9	-2.950	`d3pzya_ c.57.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}`	`ali model 3D-neighbors follow..`	11	63	`VILTSGGTGIAPTDSTPDQTVAVVDYLIPGLAEAIR.....`	98
10	-2.920	`d1ylka1 c.53.2.0 (A:2-163) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}`	`ali model 3D-neighbors follow..`	19	70	`LAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQ.....`	105

FFAS is supported by the NIH grant R01-GM087218-01

jobs submitted since Jan 1, 2011

Comments and questions to: webmaster