current user: public

If you have questions about the server, please let us know.

Query: TM0002 TM0002 281883 Purified-2001-08-29, from T.maritima

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst MSPEDWKRLICFHTSKEVLKQTLDDAQQNISDSVSIPLRKYLast
1 -6.420d2j01s1 c.55.4.1 (S:23-108) Ribosomal protein L18 (L18p) {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  32  3.......RLSVFRSLKHIYAQIIDDEKGVTLVSAS...... 30
2 -4.680d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  24  7...........NHLGQEVIDNSVDEALAGHAKRVDVILHA. 35
3 -4.320d2lb9a1 d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]}  ali model 3D-neighbors follow..  25  133.....WGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQ. 167
4 -4.200d2cmyb1 g.2.4.1 (B:7-29) Trypsin inhibitor VhTI {Veronica hederifolia [TaxId: 202477]}  ali model 3D-neighbors follow..  36  2.......KVMCYHSSPELLRRCLDNC............... 23
5 -3.890d1l3la2 d.110.5.1 (A:2-169) Transcription factor TraR, N-terminal domain {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  17  79KHIFTWSGEHERPTLSKDERAFYDHASDGIRSGITIPIK.. 118
6 -3.860d4ubpa_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]}  ali model 3D-neighbors follow..  22  3LNPAEKEKLQIFLASELLLRRKARGLKLNYPEAVAI..... 38
7 -3.850d4cqha2 d.110.2.1 (A:138-318) automated matches {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  20  147.....WGLIVCHHQTPYVLPPDLRTTLEYLGRLLSLQVQR. 181
8 -3.760d3cwva1 d.122.1.0 (A:8-206) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  13  24...........HHLVYFLLDVAYEEARRGECRDVVLEVGG. 52
9 -3.680d1k0ra4 d.202.1.1 (A:1-99) Transcription factor NusA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  34  74DTPEGFGR-IAATTARQVMLQRFRDAE.............. 99
10 -3.550d5viqa2 d.110.2.0 (A:127-314) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}  ali model 3D-neighbors follow..  11  152.....WGLVVCHHYLPRFIRFELRAICKRLAERIATRITA. 186

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.