current user: public
If you have questions about the server, please let us know.

Query: TM0004 TM0004 281885 Purified-2004-07-19, from T.maritima

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30
# Score Template Links and tools%idFirst MKDLYERFNNSLEVWKLVELFGTSIRIHLFQLast
1 -3.500d5ig0a_ d.17.4.0 (A:) automated matches {Salpingoeca rosetta [TaxId: 946362]}  ali model 3D-neighbors follow..  18  109..RVWVKDAAFKFGWKLVHFHRSG....... 130
2 -3.320d2wsda3 b.6.1.0 (A:357-512) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  25  48.........GTTEIWSIINPTRGTHPIHL.. 67
3 -3.000d2mnta_ d.26.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}  ali model 3D-neighbors follow..  16  87YTEGFDTVAFSLKSGEVSAPVETELGVHLIY 117
4 -2.890d2itka2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  80MQKPFEDASFALRTGEMSGPVFTDSGIHIIL 110
5 -2.840d2bkma_ a.1.1.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  34  3WQTLYEAIGGEETVAKLVEAFYRRVA..... 28
6 -2.830d6bmea_ a.1.1.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}  ali model 3D-neighbors follow..  16  1.STLHAKLGGAAAVAATVDVFYKKL...... 24
7 -2.750d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}  ali model 3D-neighbors follow..  16  1.KSFYDAVGGAKTFDAIVSRFYAQVA..... 25
8 -2.650d3wu2h_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}  ali model 3D-neighbors follow..  13  10LRPLNSEYGKVAPGWGTTPLMAVFMGLFLV. 39
9 -2.600d1wgsa1 b.34.13.3 (A:8-127) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  45  44....YVGFNRRLDEW................ 54
10 -2.570d1ayea2 d.58.3.1 (A:4A-99A) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  23LLQLEAQEHLQLDFWKSPTTPGETAHVRV.. 51
FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 8 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.