current user: public

If you have questions about the server, please let us know.

Query: TM0005 TM0005 281886 Purified-2001-01-30, from T.maritima

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650
# Score Template Links and tools%idFirst MTVQQFIKKLVRLVELERNAEINAMLDEMKRLSGEEREKKGRAVLGLTGKFIGEELGYFLVRFGRRKKIDTEIGVGDLVLISKGNPLKSDYTGTVVEKGERFITVAVDRLPSWKLKNVRIDLFASDITFRRQIENLMTLSSEGKKALEFLLGKRKPEESFEEEFTPFDEGLNESQREAVSLALGSSDFFLIHGPFGTGKTRTLVEYIRQEVARGKKILVTAESNLAVDNLVERLWGKVSLVRIGHPSRVSSHLKESTLAHQIETSSEYEKVKKMKEELAKLIKKRDSFTKPSPQWRRGLSDKKILEYAEKNWSARGVSKEKIKEMAEWIKLNSQIQDIRDLIERKEEIIASRIVREAQVVLSTNSSAALEILSGIVFDVVVVDEASQATIPSILIPISKGKKFVLAGDHKQLPPTILSEDAKDLSRTLFEELITRYPEKSSLLDTQYRMNELLMEFPSEEFYDGKLKAAEKVRNITLFDLGVEIPNFGKFWDVVLSPKNVLVFIDTKNRSDRFERQRKDSPSRENPLEAQIVKEVVEKLLSMGVKEDWIGIITPYDDQVNLIRELIEAKVEVHSVDGFQGREKEVIIISFVRSNKNGEIGFLEDLRRLNVSLTRAKRKLIATGDSSTLSVHPTYRRFVEFVKKKGTYVIFLast
1 -72.200d2gk6a3 c.37.1.19 (A:703-911) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  35  1...............................................................................................................................................................................................................................................................................................................................................................................................................................................................RMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPD----------KPMFFYVTQG----QEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVE. 198
2 -65.800d2gk6a1 c.37.1.19 (A:295-324,A:416-702) Upf1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  3...........................................................................................EDAYQYQNIFGPLVKLEA----DYDKKLKESQXKSTSFDRMQSALKTFAVDETSVSGYIYHVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVL-QRPLSLIQGPPGTGKTVTSATIVYHLARQGNPVLVCAPSNIAVDQLTEKIHQGLKVVRLCAKSRIDSPVSFLALHNQIRNMDSMPELQKLQQ--------------------------------------------------LKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGKQLILVGDHCQLGPVVMCKKAAGLSQSLFERLVVLGIRPI-RLQVQY........................................................................................................................................................................................................... 318
3 -50.000d4pj3a4 c.37.1.19 (A:1134-1381) Pre-mRNA splicing factor Cwf11 / Aquarius {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  1...........................................................................................................................................................................................................................................................................................................................................................................................................................................................DAQGRARASLCNLYN-WRYKN-LGNLPHVQLL----------------PEFSTANAGLLYDF-VEDFQGVGESEPNPYFYQNLGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRNKVTTVDRFQGQQNDYILLSLVRTR---AVGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHI 199
4 -49.600d3jb9x4 c.37.1.19 (X:1045-1284) Pre-mRNA splicing factor Cwf11 / Aquarius {Schizosaccharomyces pombe 972h- [TaxId: 284812]}  ali model 3D-neighbors follow..  16  1.............................................................................................................................................................................................................................................................................................................................................................................................................................................................QYNVRESISSLCS-SIYPLDIKTVDSSPNKRLDY-------------GNSGFAHEVQFINVGAFKG-SQETEPVSGYKQNLGEAEYAVALFQYMRMLGYPTNEIVICTLYESQVSLLNEIISVRAFVGTVEKLPSDKVNFVIFTTVESK---EASDHWNPKTFYKAFSACSYGLYVLCNRDLFRSTRGLEKLWNEIEKTPDKLLL 198
5 -49.000d4pj3a3 c.37.1.19 (A:416-492,A:662-1133) Pre-mRNA splicing factor Cwf11 / Aquarius {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  46.TLHDYLLRNFNLFRLESTYEIRQDIEDSVSRMXKENNFKAVLETIRNLMNTDC-LHDIILGYGDPSSAHYSKMPNQIATLDFND--TFLSIEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIPNRGPYPYNQPKRNQFTHTQIEAIRAGM-QPGLTMVVGPPGTGKTDVAVQIISNIYHNEQRTLIVTHSNQALNQLFEKIMAERHLLRLGHGEEELETEKDFSRYGRVNYVLARR--IELLEEVKRLQKSLGVPGDASYTCETAFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSGLDRSKYLLVKEAKIIAMTCTHAALKR-LGFKYDNILMEEAAQILEIETFIPLLLQKRWIMIGDHHQLPPVIKNMAFQNMEQSLFTRFVRVGVPTVDL................................................................................................................................................................................................................ 550
6 -46.400d3jb9x3 c.37.1.19 (X:385-460,X:619-1044) Pre-mRNA splicing factor Cwf11 / Aquarius {Schizosaccharomyces pombe 972h- [TaxId: 284812]}  ali model 3D-neighbors follow..  14  185.........................................................................................................................................................................TYNDKQLESILRGS-QPGLTMVNGPTRCGKHVLVCKLLEVLQDTNDRTVVLSDSNFSMNTLFTLLEKQGHLLYLSDEGKDETLERYGTLSSWISKLPG-REIGRLAASIQAPGSHDASPDTALYFRDAYIKRGDKSKRPIETYNKDNFFDYATKLYGELEYMFQQLEEIRGLLRYYEDQELYALCQQSRIIGCTWTSLSTRLGTGFCFNNLIVMNSQNISESSITSILLSNDRLVLLGNQYLTSGNQDIN--NTSNGSLFKRLRYL-KSRIIDLNT............................................................................................................................................................................................................. 503
7 -19.600d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  148.........................................................................................................................................................................DEINWQKVAAAVALTRR-ISVISGGPGTGKTTTVAKLLAALIQERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGN------------------------------------------------------------------------------------------------PLHLDVLVVDEASMPMMSRLIDALPDHARVIFLGDRDQLASVICAYANAGFTAERARQLSRLTGTHLCLLQKSYR.......................................................................................................................................................................................................... 359
8 -16.800g1qhh.1 c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}  ali 3D-neighbors follow..  15  8......................................................................................................................................................................LLAHLNKEQQEAVRTT--EGPLLIMAG-AGSGKTRVLTHRIAYLMAEKHNILAITFTNKAAREMRERVQSAAEDVWISTFHSMCVRILRRDIDRIGINRNFS--------DPTDQLSVMKTILKEKNIDPKKFEPRTILGTISAAKNELLPPEQFAKRXYYEKVVSDVYQEYQQRLLRNHSLDFDDLIMTTIQLFDRVPDVLHYY--QYKFQYIHIDEYQDTNRAQTLVKKLAEQNICAVGDADQ---SIYRWRGADIQNILFER--DYPNAKVILLEQNYRSTKRILQAANEVIEHNVNRKPKRI------------------------------------TENPEGKPILYYEAMNEADEAQFVAGRIREAVERGRRYRDFAVLYRTNAQSRVMEEMLKANIPYQIVGGYDRKEKDILAYLRVIANPDDDLSL---LRIINV........................................ 415
9 -13.900d3lfua1 c.37.1.0 (A:3-315) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  1...................................................................................................................................................................VSYLLDSLNDKQREAVAAP--RSNLLVLAG-AGSGKTRVLVHRIAWLMSVENSIMAVTFTNKAAAEMRHRIGQ------MGTSQGGMWVGTFHGLAHRLLRAHHMDANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQSYGNPVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILQRERFTNILVDEFQDTNNIQAWIRLLAGGKVMIVGDDDQ---SIYGWRGAQVENIQFLN--DFPGAETIRLEQNYRSTSNILSAANALIENNNGRLGKKL.................................................................................................................................................................................. 306
10 -13.300d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}  ali model 3D-neighbors follow..  13  1.........................................................................................................................................................................RLNPGQQQAVEFV--TGPCLVLAG-AGSGKTRVITNKIAHLIRGCRHIAAVTFTNKAAREMKERVGQ------LGRKEARGLMISTFTLGLDIIKREYAALGMKANFSLFDDTDQLALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPSQAAASAIGERDRIFAHCYGLYDAHLKACNVLDFDDLILLPTLLLQANEEVRKQNKIRYLLVDEYQDTNTSQELVKLLVGARFTVVGDDDQ---SIYSWRGARPQNLVLSQ--DFPALKVIKLEQNYRSSGRILKAANILIANNPHVFEKRL.................................................................................................................................................................................. 301
11 -12.900d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  21  1.....................................................................................................................................................................................MLKKGMTTVLDFHPGAGKTRRFLQILAECARRRLRTLVLAPTRVVLSEMKEAFHG.............................................................................................................................................................................................................................................................................................................................................................................................................................. 56
12 -12.100d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  43..............................................................................................................................................................................QKMWAKRILRKESFAAT-APTGVGKTSFGLAMSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENLIGY--------------------------------------------------------------------------------------YHGRIPKREKENFMQNLRNFKIVITTTQFLSKHYRELGHFDFIFVDDVDAILKASKNVDKL----LHLLGFHYDLKTKSWVGEARG--CLMV--STATAKKGKKAELFRQLLNFDIGS................................................................................................................................................................................................... 228
13 -11.900d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  1..........................................................................................................................................................................MSDVAETLDPLRLPLQGERLIEASAGTGKTFTIAALYLRLL-TVEELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNLNLNAFESELDALIESSGIDRRKFNRSNQAKWIDKISAWAEEETNSYQLPESLEKFSQRFLEDRTKAGGETPRHPLFEAIDQLLAEPLSIRDLREKRRRGELGFDDMLSRLLRSESGEVLARTRFPVAMIDEF-QDTDPRRIWHHQPETALLLIGDPKQ---AIYA---RGADIFTYMKARSEVHAH-YTLDTNWRSAPGMVNSVNKLF............................................................................................................................................................................................. 461
14 -9.890d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  18  3....................................................................................................................................................................................AVPQSFQVAHLHAPTGSGKSTKV----AAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVIRTGVRTITTGSPITYSTYGKF.................................................................................................................................................................................................................................................................................................................................................................................................... 84

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.