|
current user: public |
|
Query: TM0003 TM0003 281884 Purified-2001-12-06, from T.maritima |
. 10 . 20 . 30 . 40 | |||||||
# | Score | Template | Links and tools | %id | First | METVKAYEVEDIPAIGFNNSLEVWKLFPASSSRSTSSSFQ | Last |
1 | -4.330 | [S] KOG3098 Uncharacterized conserved protein | ali follow.. | 14 | 4 | ..TTRRYELLSAAMLGFGHLCIMVGYDSGFFDQEPTN... | 38 |
2 | -4.020 | [E] COG4401 Chorismate mutase | ali follow.. | 13 | 31 | ICEENEIDPENVAQVILTVTEDLTATFPAKALRRLAG... | 67 |
3 | -3.600 | [K] COG0781 Transcription termination factor | ali follow.. | 35 | 94 | ...LAVYELLDVPKVVINEAIEVAKVFGADESHK...... | 128 |
4 | -3.240 | [S] COG2001 Uncharacterized protein conserved in bacteria | ali follow.. | 25 | 106 | .........KGLMLVGQLNKFEIWS............... | 121 |
5 | -2.650 | [J] COG0048 Ribosomal protein S12 | ali follow.. | 13 | 82 | ...IRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKY. | 117 |
6 | -2.530 | [S] COG3790 Predicted membrane protein | ali follow.. | 25 | 63 | ...........IHGVGFRPQKVLWQGI............. | 78 |
7 | -2.410 | [R] KOG3263 Nucleic acid binding protein | ali follow.. | 57 | 236 | ...............GFNRPLD.................. | 242 |
8 | -2.360 | [O] KOG0549 FKBP-type peptidyl-prolyl cis-trans isomerase | ali follow.. | 20 | 46 | ..........DQLHMHYTGTLLDGTEFDSSRTRNEEFTFT | 75 |
9 | -2.240 | [S] COG4731 Uncharacterized protein conserved in bacteria | ali follow.. | 21 | 6 | ..............VGVGAELTAFRILAAISCE....... | 24 |
10 | -2.180 | [D] COG2917 Intracellular septation protein A | ali follow.. | 20 | 137 | ..............IAFWLPQNIWVNFKVFGLTALTLIF. | 161 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Igarashi Y, Eroshkin A, Gramatikova S, Gramatikoff K, Zhang Y, Smith JW,Osterman AL, Godzik A. CutDB: a proteolytic event database. Nucleic Acids Res. 2007 Jan;35(Database issue):D546-9. Epub 2006 Nov 16. |