|
current user: public |
|
Query: TM0004 TM0004 281885 Purified-2004-07-19, from T.maritima |
. 10 . 20 . 30 | |||||||
# | Score | Template | Links and tools | %id | First | MKDLYERFNNSLEVWKLVELFGTSIRIHLFQ | Last |
1 | -3.590 | [P] COG3303 Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit | ali follow.. | 34 | 1 | MK-IYLRF-----VWILIIILNFLLNLFI.. | 23 |
2 | -3.270 | [D] COG2917 Intracellular septation protein A | ali follow.. | 21 | 134 | ..NIYIAFWLPQNIWVNFKVFGLTALTLIF. | 161 |
3 | -2.740 | [UW] COG5295 Autotransporter adhesin | ali follow.. | 12 | 1 | MNKIFKVWNPATGNYTVTSETAKS....... | 25 |
4 | -2.740 | [S] COG2995 Uncharacterized paraquat-inducible protein A | ali follow.. | 12 | 346 | ......EVVEFVGRWSMIDVFVIAVLSALVR | 370 |
5 | -2.540 | [R] COG2346 Truncated hemoglobins | ali follow.. | 24 | 24 | .VTLYEAIGGDATVRALTRRFYELMD..... | 48 |
6 | -2.380 | [S] COG3360 Uncharacterized conserved protein | ali follow.. | 50 | 2 | ..........SEHVYKKIELIGSS....... | 15 |
7 | -2.320 | [O] KOG3259 Peptidyl-prolyl cis-trans isomerase | ali follow.. | 19 | 130 | MQKPFEDASFALRTGEMSGPVFTDSGIHIIL | 160 |
8 | -1.830 | [S] COG2322 Predicted membrane protein | ali follow.. | 19 | 163 | ..........TMPLWLYVSLTGVLVYLMISP | 183 |
9 | -1.820 | [S] COG4818 Predicted membrane protein | ali follow.. | 27 | 28 | .............FFLLLERKNKFVRFHAMQ | 45 |
10 | -1.800 | [R] KOG4264 Nucleo-cytoplasmic protein MLN51 | ali follow.. | 31 | 220 | ....HDKFREDEQAPKLIALYGYDIR..... | 245 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Rychlewski L, Jaroszewski L, Li W, Godzik A. Comparison of sequence profiles. Strategies for structural predictions using sequence information. Protein Sci. 2000 Feb;9(2):232-41. |