current user: public

If you have questions about the server, please let us know.

Query: TM0012 TM0012 281893 Purified-2001-08-29, from T.maritima

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MKKFPINSDQEVAVLVKSKEELFKELENFIEENGYEGKKDALIQVLHKAQELFGYLPADVLEYISDKLDVPLSKVYGVVTFYNFFSTKPKGKHQIKVCLGTACYVKGADRIFERFLEELKVNPDEPTSDGMFSVHGVRCLGACSMAPVVMVDEDDFYGRVTPDMVPQIISKYKREGLast
1 -79.200[C] COG1905 NADH:ubiquinone oxidoreductase 24 kD subunit  ali follow..  27  10.......EPAAMPDAFELSAEERDAIEHEKHHYE--DARAASIEALKIVQKQRGWVPDGAIHAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKKLSIKPGQTTFDGRFTLLPTCCLGNCDRGPTMMID-DDTHSYLKPEEIEKLLEQY.... 171
2 -77.800[C] KOG3196 NADH:ubiquinone oxidoreductase, NDUFV2/24 kD subunit  ali follow..  30  31LFVHRDTPEDNPNIPFEFTAENKKRVEAILSIYPEGHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILQLPNMRVYEVATFYTMFMRKPTGKYHIQVCTTTPCWLRGSDDILETCKKQLGIGVGDTTKDRKFTISEVECLGACVNAPMVAIN-DDYYEDLTSKDMQDILNDLKAD. 204
3 -34.900[C] COG3411 Ferredoxin  ali follow..  19  131.........................RSWGIQFWNGANEQLMTILLPNPLVDGENLLPEGKPNLDKLALYQDLRDIYVLGKKPIPFSKNPLKHSYISVCTSTRCLPRKWQPTFDALKSAVE------NAGLDIEVRTSGCLEVCQLGPVVFYNDRTWYTRVNPNVAENIVNEHLIKG 277
4 -17.400[S] COG5469 Predicted metal-binding protein  ali follow..  15  5.....................................................................................NSLGVAEHTLFVCKTKRVGESGGQKLLNQLQQLAQ----EWELRDKFPIQEVECMSACNRSCVVAFTGKGLFGDLAVDDHASAVLECAG.. 101
5 -10.000[O] COG4759 Uncharacterized protein conserved in bacteria containing thioredoxin-like domain  ali follow..  18  138.......................................................................................PKNHIREIMVCTDVACSRFGYP-IYQNLRQNY-----AAKSAGQLRVWRCSHIGGHQFAPLFDLPTGQFWGHIEPEILDVLVWRNSPV. 224
6 -9.950[S] COG4844 Uncharacterized protein conserved in bacteria  ali follow..  14  2...........................................................................................NPMIEFCVSN--LAHGSQEARAILEKDPNLD-----------VLEYGCLSYCGTCLFALVNGEVVMGETPAELVENIYTFIEEN. 75
7 -9.360[C] COG2221 Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits  ali follow..  13  1MTADPVAQRLQKRLPVPYTEWLPELIRRNVGKWVDRKSTGDRVFTVKVGTPPNFRMSTETLRKFIDIADDSLDKALKIKEEVEKMGFPVGGWWGINSCTAFLCTVVDSPSITKALGDALAPYFKEESLPAKLRIFVSGCPAMCAGGTAIDIA........................ 189
8 -7.600[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  12  10..........................................................HGTFTQLRSLVMIFGHAFRDTLQYPEEPVY-RGRIVLT-C--VACNLCAVACPVGCISLQKAETEDGRWYPEFFRINFSRCIGLCEEAPTTAIQLTPDFEMGEFKRQDLVYE...... 135
9 -7.320[S] COG5486 Predicted metal-binding integral membrane protein  ali follow..  12  171.............................................................................TLGVAGLYQFTTLKHICLSHCRSPLAFVAQHWRDGRVGALEMGLRHG------------LYCFGCCWALFAVLVAAGVMS--MLLLTLIVFVEKLMQRG 258
10 -7.280[P] COG0735 Fe2+/Zn2+ uptake regulation proteins  ali follow..  14  11..........................SLVMGALAHSDGPMSAYTILDKLRDNGFRAPLQVYRALDKLLEYGLVHRLESLNAFVACSCPHEHEHDHGVTAFTICEGCG--QVTEFHDEVIEDRLSTLVRAQEFKTETIEIRGHCK................................ 128

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.