current user: public

If you have questions about the server, please let us know.

Query: TM0013 TM0013 281894 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSLLast
1 -58.400[C] COG0426 Uncharacterized flavoproteins  ali follow..  14  26IAPNTTAIRCLDWDRDRFDIEFGLQNGTTYNSYLI-RGEQTVLVDTSHQKFRQLYLETLKGLINPKAIDYIIVSHTEPDHSGLVEDVLQLAPRATVLASKIALQFLEGLVHDPFS---KRIVKSGDRIDIGGHEIEFVSAPNLHWPDTIFSYDRKTEVIYTCDAFGMHFCDNRTFDEDLE-AIEADFRFYYDCLMGPNARSLLNAMKRMGDLKIKIIANGHGPLLYHHLDVLTECYQSWSQRQAKSETTV... 272
2 -36.900[R] KOG0813 Glyoxylase  ali follow..  19  29............................GTNTYLLGSGSRRILIDTGDEDV-PQYIAHLGDVLQQESIDTILLTHWHHDHVGGVKSIVGTK-LAEKDCRVFKFGRTDAPDVCPPTDIKLHPLAHNQEFTTEGANVRVVHTP-GHTTDHVVLAMN-EGTLFSGDCILGEGTA-----------------------VFEDLFEYMKSLEKILDIKPQRIFPGHGNVIEEGKIEYYINHRNQREQQILQFFV.... 228
3 -28.800[R] COG0491 Zn-dependent hydrolases, including glyoxylases  ali follow..  18  11...........................YKTNCYVVRGENEVAIIDPGMHAH-----DDLVEYITTNNLSKIVLTHGHIDHTRDAGVVAKRF-NAPVYIHPDDAFFLEVYNMVSPDPESLRDLVDGETITLAGEEFTLKHAP-GHSPGCTLIV--GKEYCFSGDVL------------------FKGSIGRTDFEWSDADAMNESLRTAVLPLDDALILPGHGPTTTMRAERTGNPFLLAL............. 213
4 -26.500[R] KOG0814 Glyoxylase  ali follow..  12  51...........................SSTYSYLLADLKQAVIIDPVLEQ-AKRDAQLVKDL----ELKYAINTHMHADHITGSGWLRKLT-GCQSVIAAASGAKADRH------------LNEGDRIDFGTHVIDALATP-GHTNGCMTYVIKDQGCVFTGDTLLIRGCGRTDFQEGC------------------PRNLYENVHSKIFTLPENFIYPAHDNPRLTKDIEEFVKIMENLN............ 247
5 -24.400[Q] COG2015 Alkyl sulfatase and related hydrolases  ali follow..  11  110.HHGLYKVTDRIYQVRGYDLA---------NITFVKGDTGWIVFDPLVPATAKAALDFVNQELGERPVKAVVYSHAHADHFGGVKGIVSDRGEVPIIAPKGFLNHAVAENVLAGNAMSKVISEQTETVVIDGVTMEFQNTPGTESPAEMNTYFPQFKALWMAENTVGGLHN----------------VYTLRGAEVRDAKAWSKYINESIHKEADVMFASHTPRWGNDNINHFLRKQRDMYGYI......... 374
6 -24.300[S] KOG4736 Uncharacterized conserved protein  ali follow..  16  294...........................AVGAITLVNDNGYIVLIDTGASSDTERLLHSLAKEVTLDQIDSVVITHASPGHMGNMNFF----AQKPILYHSMEYIGRHVTPTELKERPYRKLSGN----------VEVWKTP-GHTQHDLSVLVHNVAMAIVGDLI-------------PSEHLLSEKRDVMIEEGVWDNAIKRQNANLIVCM-ADWIVPGHGQPFR........................... 468
7 -20.200[R] COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily)  ali follow..  12  34TTRILTTFKAINMKVIPLASE---SLGVRSLALFLKIGKVGILIDPGVAAEMKALSLAREKIEYAKKAQIVTISHYHYDHHTPFFEGIYEIKHPTENINNSQKKRAHEFLKNAKEIAKDIKFADSQSFDFGSFTIEFSP-PVPHGREMVLVDDGKKSVLHASDTQLINDKAVEWIIEKNPDILIAGGPPTYHRVGNVKEIGMKNINRIISETNAKIVLDHH------IRDKGYERFFSELDERPLTFAEFLG. 316
8 -20.000[R] COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II  ali follow..  12  29...............................SALVESNGYKVLVDTGTDG--KVLLNNMHELIDANDIDVLFITHGHYDHTGGLKEFLKERSEPIEVYAHPGI--FDERIALKPRKRDIGIPFQRKELEELGARFNLSPEPLEFLPGALIVEGSKGLVVISGCGHSGIINIARHAMELRGSK--IAALIGGFHLRGAKKELLDDVVTNMKELGVNALYPGH-GIEEFSYLWSKLDNVEGIYVGKEI....... 270
9 -17.600[R] KOG3798 Predicted Zn-dependent hydrolase (beta-lactamase superfamily)  ali follow..  14  89...........................LGHATVLVDLEGVKFVTDPVWADRASRYRPPPMKLEDLPDLDFAVVSHDHYDHLDAVKRITNLNPQIKWFVPLGLKKWMKNQGIGADGSNTVTELNESSEFVKNGKTITIWCLPAQHSGQGWAVIGENRRFYFPGDTGFCDVEFKKIGEKLGPFDLAAIPIGAYEPRWFMKSHHIDEAVEVHKLVRARNSIGIHWGTYPMGTTEYYLEPRDKLKELMDAREDL... 337
10 -16.700[R] COG2333 Predicted hydrolase (metallo-beta-lactamase superfamily)  ali follow..  15  95...............................ATLIVKNGKGILYDTGSSRGGSMAELEILPYLQREVLEKLILSHDDNDHAGGASTILKAYPNVELITPSR----------KNYGENYRTFCTAGRDWHWQGLHFQILSPHNVVTRADILVDDGKNSVLLTGDA---------------------------------EAKNEQIFARTLGKIDV-LQVGHHGS--KTSTSEYLLSQVRPDVAIISSRWNPWKF 280
11 -15.400[R] COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold  ali follow..  13  108...........................FGHSAFLLNVDNKQLLIDPGRNRYEYSEDIMLHLIDEMPPIDAVLITHDHYDHLRSIVKLNNKVS--HFFVPLGCSAHLIRWGIPEEK---ITELNWWEETEYQG--LTVALTPSRHSSGGWVILGNKTRVYTSGDS-GYGPHFKQIGDKYGPFDITLIEGAQYDRNWPDLHMVPEQAIQANLDVGGKTMMLMHWGAFTNEPIERALKEAKIREVNIIA....... 350
12 -15.000[J] COG1236 Predicted exonuclease of the beta-lactamase fold involved in RNA processing  ali follow..  10  6................................SSEIGVISKKLIDLGVLALRQRSIDTTRSPGKQPQPDAYLITHAHSDHHGKSAML-----SPRAVCTDKTATALE---IRHDRKYVGSMCRLGDEIEIEGVRVKTYPT--AHTAGAAAFYDVGTRILVTGDV-------KNASKLPPCDVLITEANYGDPEDPSCHFADDLESMKCALFESGPVAFGAYE-----GKAQRAVELMRGFGYEGAIRME.... 228
13 -14.700[R] COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain  ali follow..  14  189...........................VGRSCYLLQTPESRILIDCGVNVSNLSSYLYVPEVQPLDALDAVVITHAHLDHCGLVPLLYKFGYRGPIYLTPPTRDLQLDFLEVAGREGTNPPYSSNLIREA-SPDVRLTFYNAGHILGSAIAHEGHYNIAFTGDFLFDRAATNFPRLEALVMEATYGGPNDFQPSRKEAEERLIEVINRTLDRGGKVLIPTFAVGRSQEVMIVLEEAMRE.............. 430
14 -14.400[A] KOG1136 Predicted cleavage and polyadenylation specificity factor (CPSF subunit)  ali follow..  15  15...........................VGRSCLLLSMGGKNIMLDCGDERRFPDFSYIVPEGPITSHIDCVIISHFHLDHCGALPYMSEIVGTGPIYMTHPTKAIAPTQMIKDCMKKVIPVTLHQSMMVDTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRDFLKKVHECVAKGGKVLIPVFALGRAQELCILLETYWERMNLKYPIYFA.... 268
15 -14.300[A] KOG1137 mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit)  ali follow..  12  33...........................VGRSCVYMSFRGKNILFDCGIHPAYSGMAAPYFDEIDPSSIDVLLITHFHIDHAASLPYFLELLTDYVKVSKVSVEDMLFDEQDINKSMDKIEVIDFHQTVEVNGIKFWCYTAGHVLGAAMFMVDIAGVRILYTGDYSREEDRHLRAAELPQFSPDICIIESTSGVQLHQSRKRFTDVIHSTVAQGGRVLIPAFALGRAQELLLILDEYWAN.............. 269
16 -14.300[T] COG5212 Low-affinity cAMP phosphodiesterase  ali follow..  13  14.TDQVVGLVENSFTLYSLGQNGGPLES-CCSSHLISAFQEIISLDGGSH------LSALVELISEQRIKTFLITHCHLDHIYGAVINSAMFNPRTIVGLNYVIDTLKKHSLDKAGFINFQVVEPSMYTSLTT-TLSILPFPVNHGSSFGQELKSDRYFLAFGDVEPDMVASEPLNIHIWRACSSLIAQRKLSHILIECSRHLVNELCILQSMPTLTCLLTHSANPADVILEQLESLSSKSSLSVTFKILQRG. 341
17 -14.100[R] COG1235 Metal-dependent hydrolases of the beta-lactamase superfamily I  ali follow..  44..........................GGNTICIEVRCGDHVLLFDAGSG-----LHPAGLALAEGITDVNLFFSHCHYDHIVGFPYFKPFYNSSEMLKDFMSPPWFPVPLEICCAKIATRDFKAGDVLDVHP-GLSIRTGMLNHPGNAIGLDWEGKSLAIITDTEHEPSSIDETVLDLIRDVDLFLYDAMFTDEEMGLYRSWQQAIRLAKLADAKNVGFIH-PSRSDEELDDIEKQAKAEFNGAFAAMDGQVI 290
18 -13.500[R] KOG2121 Predicted metal-dependent hydrolase (beta-lactamase superfamily)  ali follow..  15  486.............EIVILGTGSSQPSKYNVSAIFILFSRGSLLLDCGEGTLGQLKRDGADEAV--RKLRCIWISHIHADHHTGLARILALRSKLLVVGPRPLKRFLDAYQRLEDLDMEFLDCRSTTATSWASLE-DLISFPVVHCPQAYGVVIKAAKMVYSGDSTVEASRDATILIHEATFEDALI-----EEALAKNHSTTKEAIDVGSAANVYRIVLTHFSCIAFDLMSINMADLHVLPKVLPYFKTLFR. 815
19 -13.100[R] COG0595 Predicted hydrolase of the metallo-beta-lactamase superfamily  ali follow..  11  15...........................FGKNMYLVEVEEQIFVLDAGDQLGVDFVIPDITYLLE-DRVAGIFLTHGHADSIGALPYIVSEL-KVPVFGSELTIELAKKNYADSRKFNDFHVVTEDTEIDFGKAVISFFSTHTIPESLGIVISTNDGNIVYTGDFRFDPAVAKGYRTNMRRLAELSSSPNALSTMQSASEHEIYEKIYDIDDNEGRVIIACNAGNLGR--IQQTIDAAIKLGRRVAFT...... 252
20 -13.000[L] KOG1361 Predicted hydrolase involved in interstrand cross-link repair  ali follow..  15  153......................................GTPFTVDA--------------RYGCVQGCSAYFLTHFHADHYIGLT---KAWSHGPIYCSSLTSRLLRLSLSVNPSSIHPLEL--DVEYTINGIKVTLIEA---HCPGAALIHFRLLDYLHTGDF--------------------------ASKQMQTHPLLFNQRVHVL--LDTTYCNPRYKFPSKEDVLSYVVRITKDFQPKTLIVVGSYSI 327
21 -13.000[A] KOG1135 mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit)  ali follow..  13  16...........................EGPLCYLLQVDGDYILLDCGWDERFGQYFEELKPFIP--KISAVLISHPDPLHLGGLPYLVSKCGTAPVYATVPVYKMYTLDDVDTAFEKVEQVKYNQTVVLKGDSGVHFTALPAGHMLGGSIWRICREDIVYCVDF--NHKKERHLNGCSFDNFNRPHLLITGAHHISLPQMRRKDRDEQLVTKILRTVRQKGDCMIVIDTAGRVLELAHLLDQ........... 251
22 -12.800[R] COG1234 Metal-dependent hydrolases of the beta-lactamase superfamily III  ali follow..  14  2.............DIQFLGTGAGQPSKARNVSSLALKINEVWLFDCGEGTQ-----RILETTIRPRKVSKIFITHLHGDHIFGLPGFLSSRTDLEIYGPQGIKSFVLTSSRLPYRIHFHEFDQDSLGKILETDKFTVYAEELDHTIFCVGYRVMQKIITILGDTSVRLAVNADVLVHESTYGKGDE-----KIARNHGHSTNMQAAQVAVEAGAKRLLLNHSARFLSKDISKLKKDAATIFENVHVVKDLEEV 307

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.