current user: public

If you have questions about the server, please let us know.

Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSELast
1 -51.900[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  21  1......TFQCKFWGFGSDGTVGANKAAIKIGDNTDLYAQGYFSYDSKKSGGLTVSHLRFGENRIRSAYLIQQADFVSCSTSAYLRSDLLKGLKPGGTFLLNTIWEGEQLEYIAKNNIQFYTLNAMRIAGEAGLGRRINTVMQTAFFRVTDILPFEKALADLKASAIATYGKAVAEKNILAMDQTVANLHKVE 200
2 -9.800[R] KOG2820 FAD-dependent oxidoreductase  ali follow..  10  1..MVGKAYDVIVVGAGIFGSCTAYHC-----QRLGLRTLLLEQYSLGHSNGSSHGKSRIIRYAHTDPEYVPLVGDSYLQIEELEKKRGEKLWNKLGLLWATGNQVDSISGHLKKHNIDHEVLPGTKITERYPQFKFDDKWT-ALIDPMGGVIYANKWLKAFQEEFITLGGTIQDNEPVISYGETDNVIVNVK 185
3 -7.930[Q] KOG0023 Alcohol dehydrogenase, class V  ali follow..  186........HLGVAGLGGLGHVAV-----KIGKAFGLKVTVISSSSTKAEEAIADSFLVTTDPQKMKAAIGTMDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGMKETQEMLDFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFV.................. 350
4 -7.920[R] COG1064 Zn-dependent alcohol dehydrogenases  ali follow..  11  176........KVAIVGLGGLGHMGVKLAHAMGAEVTVLSQTLSKKEDGLKLGA--DHYYATKDPETFTKLAGSFDLIICTVAAEIDWNAYLNLLKVDGELVLVGIPENPVPVHAFSLVPARRSISGSMIGSIKETQEMLDFCGEHGIVSEIETIRMEQINEAYERVVRSDVRYRFV.................. 339
5 -7.360[F] COG0125 Thymidylate kinase  ali follow..  15  6.........ITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDIAEQIREVIL--NENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSPLAYQGYARGLGIDEV-----------LSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLE-TKVQEGYQELMKRF 179
6 -6.970[Q] COG5310 Homospermidine synthase  ali follow..  12.VYGEITGPVVMIGFGSIGRGTLPLIERHFKFDKSRMTVLDPRDTDRKLLDERGIAFVQEAVTENNYKKLGGQGFCVNLSVDTGSVDLMRLCRKLGVLYIDTVVEPFDAKADNASRTNYALREAMIKEKHDKPGGATVVSTCGANPGMVSWFVKQALVN................................. 182
7 -6.820[S] KOG3154 Uncharacterized conserved protein  ali follow..  12  83..........................................................................VLSPVGRQCVSREDYDLIKRKGLAVVDCSARLTDVPFAKLRCTAPRLLPWLVAANPVNYGRPCELSCVEALSAALILCGEKETAELLLGKF--KWGHAFLSLNKDILKE-YSKCENSA 198
8 -6.810[S] COG2042 Uncharacterized conserved protein  ali follow..  10  50............................................................................ILLDPMAEKALSPADDPKKGIIVLDCSEVERVFPELEKLNLEHRALPYMLAGNPVNFGRPFKLNSAEAFAAALYILGYKEQAEKVMSKF--NWGHSFLELNREPLDE-YATAKNSS 164
9 -6.670[G] COG3265 Gluconate kinase  ali follow..  11  6.........IIVMGVSGTGKSCVGQALALAL---GAKFIDGDDLHPRANIQKMAAGQPLNDQDAYSLQQKNEVGFLVCSALKKQYRDRLREGNEGIRFLWDYDLVLHRMQQRAGHFMPESLLKSQFATLEAPGSDEPDVIPIDI-------SSIADVVEHCIAALSLENHVSAILSE............... 178
10 -6.660[C] COG0644 Dehydrogenases (flavoproteins)  ali follow..  11  1...MTEQYDVVVAGAGTAGAYASYLLAKAGLKVALLESKSGDQIGVKTCGDGLGLHHKIEGVELISPTTLIVRGEGYVLDRFAWGKWLVEEAVRAGAVLYEGHTATAPIVE----NGSVVGVKAVERISGVAKEFRARVVI-GSAAVLRSKLIGWLVSEPLHPE............................ 179

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.