current user: public

If you have questions about the server, please let us know.

Query: TM0017 TM0017 281898 Purified-2003-03-05, from T.maritima

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390
# Score Template Links and tools%idFirst MRMERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIPVESEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPINIHCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHGVEPVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKVFPEIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKIWMFRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGLGGRDIKPEHIRKAFEDAINGNLIADEQRYLGLRELast
1 -99.000[C] COG0674 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit  ali follow..  31  1.....MKKMKTMDGNTAAAHISY-AFTDVAAIYPITPSSPMAEHVDEWATQGRKNVKIMEMQSEAGAAGAVHGSLQAGALTTTYTASQGLLLMIPNMYKIAGELLPGVFHVSARALATHSNIYGDHQDVMAARQTGCALLAEGSVQEVMDLSAVAHLVAIKGRVPFINFF--DGFRTSHEIQKVEVMDYEDLRGLLDVNEFRRRALNPDHPVQRGSNEGSDIYFQGKEAQNKFYDALPEMVEHYMGEISKITGREYHLFNYYGAEDADRVIIAMGSICDTIEETIDYLRAKGEKVGVLKVHLYRPFSVEHFLKYIKTAKKIAVLDRTKEAGSAEPLYLDVVKAFYNSDVRPVIVGGRFGLGLKDTLPVHIYSVYENLKLDAPKDG--FTIGIND 395
2 -52.400[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  17  7..RDAEGEKVFLLGNEAIARGAIEAGIDVFAAYPGTPSSEIADTLSDACRRGKMDFYMEYSANEKVAFEVAVGASLAGKRAMATMKHVGVNVAADPLFSFAYVGARGGFVLVTADDPSMHSSQNEQDNRWYGKAAKLPVVEPSSVQEAKDYAKLCFDLSEKFGLPMILRSYTRLSHASGVVELGKIPEKEFSRVEWERHPETDVVLPAHA------------------------RKLKPILLEKLEKIERYFNSS--EMNWVDEGDGDVGIIACGLSYAYTKEALENL---NLNLPVLKLSSMHPLPERLIENFVSQMKKVIVVEEV-----DPFVELHVRAMGLAEVYG-KMNGYMPMNY--EYNVGRVETGIAKALGIKPSRD......... 354
3 -18.900[R] COG4032 Predicted thiamine-pyrophosphate-binding protein  ali follow..  12  3..........VVNPEEKVIEIMKQTGIDLAATLPCDRIKNLLPLVSE-------NFPEIKLTREENGVGICAGIYLAGGKPMMLIQSTGLGNMINALSLNVTCKIPLPILASWRGVYKEGILGAHLPSILEGAGLTYTII---GETEKLPLLENVILDAFENSRPHIALVSPKVWEASECCAW-QAAGMPIKPEIMERTCRFSLTSGTLKPFML.................................................................................................................................................................................... 201
4 -15.400[C] COG0022 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit  ali follow..  15  20..............RDAMAEEMRADEKVFVMGEEVAEYQGAYKITQGLLQEFGERRVIDTPITEHGFAGIGVGAAMTGLKPIVEFMTFNFAMIDQIVNSAAKTLAPMVFRGPSGAAARVGAQHSQCYAAWYSHIPGLKVVMPYTAADAKGLLKAAIRDPN----PVIFLENEILYGQSFEVPKLDDFVLPIGKARIHR------------------------------------------------------------------KGKDATIVSFGIGMTYAIKAVAELEKLGIDVELIDLRTIRPMDLPTVIESVKKTGRLVTVEEGPQSSVGDFIANQVMRAAFDY-----LDAPILTIAGKDVNVDEVVQAVKTVCYK.............. 335
5 -14.800[C] KOG0524 Pyruvate dehydrogenase E1, beta subunit  ali follow..  13  45..............NSAMEEEMKRDDRVFLIGEEVAQYNGAYKISRGLLDKFGPKRVIDTPITEMGFTGLATGAAFAGLRPICEFMTFNFSMIDHIVNSAARTLCPIVFRGPNGPAAAVAAQHSQHFAPWYGSIPGLKVVSPYSAEDARGLLKAAIRDPN----PVVVLENEILYGKTFPISKEALSEDFVL------------------PFGLAKVER---------------------------------------------PGKDITIVGESISVVTALEAADKLADYGVEAEVINLRSIRPLDINTIAASVKKTNRIVTVDQAYSQHGIG---SEIAAQIMESDAFDYLDAPVERVSMADVNADVVVAAAKKCLYIK............. 366
6 -14.400[G] COG3958 Transketolase, C-terminal subunit  ali follow..  11  2IKLAPAGLKDDIEMRKVYAGFIAGQI-PIIALEADLMSSMAMDSVARDYPQHVINCGI----MEANVIGTAAGLALTGRKPFVHTFTAFASRRCQLFMALDYQRNNVKVIASDAGVTHNGGTHMSFEDMGIVRGLHSVVLEVTDAVMFADILRQLMDLDGFYWLRTI-----QARSIYAPGSTFTIGKGNVLR-----------------------------------------------------------------------EGDDITLIANGIMVAEALEAARQLEQEGVSAAVIDMFTLKPIDRMLVKNYAEKTRRIVTCENHSIHNGLGSAVAEVLVENCPVPMRRVGVKERYGQVGTQLTAEAIVEAAKSLL................ 317
7 -12.800[HI] COG1154 Deoxyxylulose-5-phosphate synthase  ali follow..  11  326.............GDWLCETA--AKDSKLMAITPAMREGSGMVEFSRKFPDRYFDVAI----AEQHAVTFAAGLAIGGYKPVVAIYSTFLQRAYDQVIHDVAIQKLPVMFAIDRAGGADGQTHQGAFDLSYLRCIDMVIMTPSDENECRQMLFTGYHYND---TAVRYPRGNAQGVALTPLEKLPIGKGLVKR-----------------------------------------------------------------------HGEKLAILNFGTLMPEAAKVA-----EALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAG---SGVNEVLMAHRKPVPVLNIGLPRAELGLDAAGIEAKIKAWLA............... 620
8 -10.400[G] COG0021 Transketolase  ali follow..  10  359..............QNSIEILAKELPELVGGSADLTPSNLTDWSNSVSVTRDKGGNYIHYGVREFGMGAIMNGLVLHGVKPFGATFLMFSEYERNALRMAALMKINPVFVFTHDSLGEDGPTHQPIEQTATLRLINMDVWRPCDTAE----SLVAWAEAVKAADHPSCLI--------------------------------------------------------------FSRQNLKFQARSEQQLNDIKRGGYVISE--AQGNAQAVIIATGSEVELALEAQKALAAQNIAVHVVSMPSTNVFDRQDTAAVLPESLPRIAVEAGHADGWYKYVGLNGAVVGINRFGESAPADLLFKAFG--FTVDNVVDTVKSVL................ 659
9 -9.910[G] KOG0523 Transketolase  ali follow..  13  471..................................LASSNMTLLKAFGDFQKATPEERNLRF-REHGMGAICNGIALPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTH-GLGEDGPTHQPIEHIASFRAMNTLMFRPADGNE----TAGAYKIAVTKRKTPSILA-----LSRQKLPHLPGTSIEGV-----------------------------------------------------------EKGGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVSFVCWELFDEQSDE-LPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAPLLYKEFG--ITVEAVVDAAKSFF................ 754
10 -9.080[EH] COG0028 Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase]  ali follow..  10  26VKEKIVAEDTTLTTAQLMVQCLENEGVEYIFGLPGEENIRFVDALGD-------TIRFIVVRHEQGASFMADIGRVTGKAGVCSTLGPGAINLLLGTADAFTDSTPLVAISAQVSLNRIYKETHQVVDLLNMKPVTKWAEMIIGSAAIPEMMREAFEKAQTSR-AVYLCVPEDVESISGLTGLRPLARSDEADSMPGSTRAAQVLQEATKPIILAG-------------HGAVRDYAGDALVRFSERLRIPVATTFMGKGIF-PDDHPNSLGTIGDYVNFGFDEADVIVCVGYDLQEFDPVRINPNADKKILHLHRYPAEI---HYPVTVSVEGNLSAALDGLAAIITPKEGLDAEDRKIDAYPVKPQRLVSDIRAAMGDSD............ 411

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.