current user: public
If you have questions about the server, please let us know.

Query: TM0001 TM0001 281882 Purified-2001-08-24, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# E-value Template Links and tools%idFirst MVYGKEGYGRSKNILLSECVCGIISLELNGFQYFLRGMETLLast
1 2.000e-16UniRef50_UPI00030A8BC0 hypothetical protein n=1 Tax=Thermotoga TaxID=2335 RepID=UPI00030A8BC0  ali  87  23MVYGKREYGSSKNILLPECVCGIISLELNGFQYFLRGMETI 63
2 4.000e-09UniRef50_R4NNH1 Uncharacterized protein n=5 Tax=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) TaxID=243274 RepID=R4NNH1_THEMA  ali  90  23MVYGKGGYGSSKNILLSDCVCGIISLELNGFQ......... 54
3 1.000e-08UniRef50_R4P342 Uncharacterized protein n=2 Tax=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) TaxID=243274 RepID=R4P342_THEMA  ali  78  5MVYGKREYGSSKNILLSECVCGINSPELNGVS......... 36
4 1.000e-03UniRef50_B9K7E9 Uncharacterized protein n=1 Tax=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) TaxID=309803 RepID=B9K7E9_THENN  ali  81  2...................LCGIISLKSNGFQYFLRGMETV 23
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 9 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;