current user: public

If you have questions about the server, please let us know.

Query: TM0002 TM0002 281883 Purified-2001-08-29, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# E-value Template Links and tools%idFirst MSPEDWKRLICFHTSKEVLKQTLDDAQQNISDSVSIPLRKYLast
1 8.000e-20UniRef50_Q9WXL7 Uncharacterized protein n=1 Tax=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) TaxID=243274 RepID=Q9WXL7_THEMA  ali  100  1MSPEDWKRLICFHTSKEVLKQTLDDAQQNISDSVSIPLRKY 41

FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 6 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.